Experimental Lung Research, Early Online, 110, 2014

Copyright 2014 Informa Healthcare USA, Inc.

ISSN: 0190-2148 print / 1521-0499 online
DOI: 10.3109/01902148.2014.926434

ORIGINAL ARTICLE

The human Cathelicidin LL-37 induces MUC5AC mucin

production by airway epithelial cells via
TACE-TGF--EGFR pathway

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

Yuke Zhang,1 Maoxiang Zhu,2 Zhihua Yang,2 Xiujie Pan,2 Yuanyuan Jiang,1 Congcong Sun,1
Qin Wang,1 and Wei Xiao1
1

Department of Respiratory Medicine, Qilu Hospital, Shandong University, Jinan, China

Beijing Institute of Radiation Medicine, Beijing, China

A B STRA CT
Aim: To investigate the mechanism for LL-37 inducing MUC5AC mucin production in airway epithelial cells.
Materials and Methods: The airway epithelial NCI-H292 cells were stimulated with various concentrations of
LL-37 synthetic peptide and scrambled LL-37 (sLL-37) synthetic peptide ranged from 2.5 to 10 g/mL. The effects of LL-37 and sLL-37 on TNF--converting enzyme (TACE) and EGFR activation and MUC5AC mucin production were evaluated by fluorescence resonance energy transfer (FRET) assay, Western blotting and ELISA
respectively. Furthermore, we measured changes of transforming growth factor-alpha (TGF-) in culture supernatants. A serious of inhibitors including TACE inhibitor TAPI-1, EGFR inhibitor AG1478, EGFR-neutralizing
antibody, TGF--neutralizing antibody, amphiregulin (AR)-neutralizing antibody, and heparin binding-epidermal
growth factor (HB-EGF)-neutralizing antibody were used to block the signaling pathway. Human serum and FBS
were also used to investigate the effects of serum on LL-37-induced MUC5AC mucin production. Results: LL-37
induced TACE and EGFR activation, as well as TGF- and MUC5AC mucin production by NCI-H292 cells in a
dose-dependent manner. EGFR-neutralizing antibody and AG1478 inhibited LL-37-induced EGFR activation and
subsequent MUC5AC mucin production, whereas TGF--neutralizing antibody increased LL-37-induced TGF production. TAPI-1 inhibited LL-37-induced TGF- production, EGFR activation and subsequent MUC5AC
mucin production, whereas TGF--neutralizing antibody, but not AR- or HB-EGF-neutralizing antibody, inhibited LL-37-induced EGFR activation and subsequent MUC5AC mucin production in NCI-H292 cells. The sLL-37
had no effect on TACE and EGFR activation and MUC5AC mucin production. Additionally, Human serum, rather
than FBS, inhibited LL-37-induced MUC5AC mucin production. Conclusions: LL-37 induces MUC5AC mucin
production by airway epithelial cells via TACE-TGF--EGFR pathway.
KEYWORDS Cathelicidin, COPD, EGFR, mucins, TACE, TGF-

INTRODUCTION
Airway mucus overproduction is the hallmark of airway inflammatory diseases, including chronic obstructive pulmonary disease (COPD), asthma, and
cystic fibrosis [1, 2]. Excessive mucus secreted into
the airway lumen contributes to morbidity and mortality of COPD by causing airway obstruction and
Received 6 March 2014; accepted 15 May 2014
We thank Professor Qinzhi Xu and Dr. Long Xu for technical assistance.
Address correspondence to Wei Xiao, Department of Respiratory Medicine,
Qilu Hospital, Shandong University, Wen-hua-xi-lu Road 107, Jinan, China.
E-mail: xiaowei433@yahoo.com; xiaowei4226@163.com

recurrent infections [3]. MUC5AC mucin is a major component of airway mucus, and its production
is regulated by a signaling pathway involving epidermal growth factor receptor (EGFR) [2, 46].
The human cationic antimicrobial peptides of
18KD (hCAP-18) is the only member of human
Cathelicidin family with a 37-residue helical peptide
(LL-37) cleaved to display potential antimicrobial activity and various biological functions involving the
regulation of cellular proliferation, apoptosis, inflammation and immune responses [7]. LL-37 is present
at high concentrations in airway epithelium and airway secretions of subjects with COPD [810]. LL-37
is involved in the development of COPD by causing
1

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

Y. Zhang et al.

airway inflammation and alveolar apoptosis, as well

as airway mucus overproduction [11, 12].
Several studies in airway epithelial cells showed
that TNF--converting enzyme (TACE) is responsible for the transactivation of EGFR and subsequent
MUC5AC mucin production [4, 5, 13]. TACE plays
an essential role in the ectodomain shedding of multiple cell surface proteins, resulting in the generation
of soluble mature transforming growth factor-alpha
(TGF-), amphiregulin (AR) and heparin-binding
epidermal growth factor (HB-EGF) [13]. It has been
reported that cigarette smoke extract (CSE) and human neutrophil elastase (HNE) induce MUC5AC
mucin production by causing activation of TACE,
which cleaves pro-TGF- into soluble TGF-, leading to phosphorylation of EGFR and subsequent
mucin production [4, 5]. In our recent study regarding COPD, we have shown that LL-37 induces
MUC5AC mucin production in airway epithelial
NCI-H292 cells through a pathway involving EGFR
[12]. However, the precise mechanism for LL-37induced activation of EGFR is yet to be determined.
Here, we hypothesize that TACE mediated TGF-
release is responsible for the transactivation of EGFR
and subsequent MUC5AC mucin induction by
LL-37 in airway epithelial cells. In the present study,
we examined the effects of LL-37 on TACE activity
and soluble TGF- release, and then investigated
the role of TACE-mediated TGF- release in LL37-induced EGFR phosphorylation and subsequent
MUC5AC mucin production in airway epithelial
NCI-H292 cells. On the other hand, as TACE is also
responsible for the generation of AR and HB-EGF
which are implicated in the transactivation of EGFR
induced by CSE or LL-37 in multiple cell types
[1416], we investigated the involvement of AR and
HB-EGF in LL-37-induced EGFR phosphorylation
and MUC5AC mucin production in airway epithelial
cells.

MATERIALS AND METHODS

Materials
LL-37
(amino
acid
sequence:
[LL-37, 37 aa])
and scrambled LL-37 (sLL-37: RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL) were
synthesized by GL Biochem, Shanghai, China. Human MUC5AC ELISA kit was from USCN, Houston, USA. AG1478, TAPI-1, EGFR-neutralizing
monoclonal antibody (Ab-3) were from Calbiochem,
San Diego, USA. EGFR (1005) polyclonal antibody and p-Tyr (PY99) monoclonal antibody were

from Santa Cruz Biotechnology, Santa Cruz, USA.

SensoLyte 520 TACE activity assay kit was from
AnaSpec, San Jose, USA. Human TGF- ELISA
kit, TGF--neutralizing monoclonal antibody,
amphiregulin-neutralizing monoclonal antibody and
HB-EGF-neutralizing monoclonal antibody were
from R&D systems, Minneapolis, USA. Human
serum (type AB) and fetal bovine serum (FBS) were
from Sigma, St. Louis, USA. The M-PER mammalian protein extraction reagent, Halt phosphatase
inhibitor cocktail and BCAprotein assay kit were
from Thermo Fisher Scientific, Rockford, USA.

Preparation for LL-37 and sLL-37 Solutions

The LL-37 concentrations used in the present study
ranged from 2.5 to 10 g/mL, which was determined
by MTT method in our previous study [12]. Under
this condition, the cell viability was not less than
80%. The LL-37 synthetic peptide was dissolved in
serum-free RPMI 1640 medium to prepare the stock
solution (1 mg/mL), which was further diluted to
working concentrations indicated above in following
experiments. As a control peptide, equivalent concentrations of sLL-37 were prepared and used in
selected experiments.

Cell Culture
The NCI-H292 cells, a human airway epithelial
cell line, were obtained from American Tissue Culture Collection. Cells were cultured in RPMI 1640
medium supplemented with FBS (10%), penicillin
(100 U/ml) and streptomycin (100 g/mL) at 37 C
in a humidified, 5% CO2 /95% air, water-jacketed incubator. After the cells reached near 80% confluence,
they were serum-starved for 24 hours before sequential treatments, and the in vitro studies were done in
serum-free media unless otherwise indicated.

Western Blot Analysis for EGFR

Phosphorylation
After treatments, cells were lysed in M-PER mammalian protein extraction reagent, and protein
concentrations were determined using BCA protein
assay. Samples containing an equal amount of total
protein (30 g) were subjected to SDS-PAGE on the
8% glycine-based gel, and dissolved proteins were
transferred to a polyvinylidene difluoride membrane
(300 mA, 4 hours). After the nonspecific binding
sites were blocked with 5% BSA, the membranes
were incubated with primary Abs against phosphorylated EGFR (diluted 1:200 with TBST buffer)
overnight at 4 C and then incubated with secondary
Experimental Lung Research

LL-37 Induces Mucin Production via TACE-TGF--EGFR Pathway

HRP-conjugated antibodies (1:5000 dilution with

TBST buffer) for 1 hours after washing three times
with TBST buffer. The ECL western blotting detection system was used to reveal immunoreactivity.
The membrane was then stripped and reprobed
with primary antibodies against EGFR (diluted
1:200 with TBST buffer) and secondary HRPconjugated antibodies (1:5000 dilution with TBST
buffer) following the same steps specified above.
The representative bands presented are from three
independent repeated experiments.

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

Assay of TACE Activity

The TACE activity of cell lysates were measured
by fluorescence resonance energy transfer (FRET)
method using Sensolyte 520 TACE activity assay
kit according to the manufacturers instruction. After treatments, NCI-H292 cells were lysed in Assay
buffer (Component C) containing 0.1% (v/v) TritonX 100, and cell lysates were incubated at 4 C for
10 minutes before cell supernatants were collected for
use. The TACE substrate solution was freshly prepared with TACE substrate (Component A) diluted
in Assay buffer by the proportion of 1:100. Equal
amounts of cell supernatants were incubated with
50 L of TACE substrate solution for 30 minutes at
37 C, and 50 L of stop solution (Component E) was
then added to end the reaction. The fluorescence intensity was monitored by the fluorescence microplate
reader with 490-nm excitation and 520-nm emission
settings, and was expressed as relative fluorescence
units (rfu).

ELISA for MUC5AC Mucin and Soluble TGF-

The MUC5AC mucin production were determined
as previously described [5]. After treatments, the cell
culture media were collected and the cells were lysed
with the M-PER Mammalian Protein Extraction
Reagent. The cell culture media and cell lysates were
centrifuged at 12,000 g for 5 minutes at 4 C, and the
supernatants were stored at 80 C until assay. The
levels of MUC5AC mucin in the culture supernatants
and cell lysates were measured with a specific ELISA
kit and summed for each sample. Simultaneously, the
total protein levels in cell lysates were determined
using the BCA Protein Assay Kit. The summed total MUC5AC mucin in each sample was normalized to total protein in cell lysates and was expressed
as g/mg protein. Soluble TGF- in the cell culture supernatants of each sample was measured using
TGF- specific ELISA kit following the manufacturers instructions and was expressed as pg/106 cells.

C

2014 Informa Healthcare USA, Inc.

Statistical Analysis
Data were expressed as mean SEM. Statistical
analyses were performed using SPSS for Windows
(version 13.0, Chicago, USA). Comparisons between
multiple treatment groups were performed using
ANOVA and the Bonferroni post-test. A P-value <.05
was considered significant.

RESULTS
Ligand-dependent EGFR Phosphorylation is
Required for LL-37-induced MUC5AC Mucin
Production
LL-37 induced EGFR phosphorylation (Figure 1A)
and MUC5AC mucin production (Figure 1B) dosedependently in NCI-H292 cells. These effects were
blocked by pretreatment of the cells with AG1478 (a
selective inhibitor of EGFR phosphorylation, Figure
1C and D), implicating EGFR phosphorylation
in LL-37-induced MUC5AC mucin production.
These effects were also prevented by preincubation
of the cells with an EGFR-neutralizing antibody
(Ab-3), which was used to prevent ligand binding
and internalization of the receptor-bound ligand
(Figure 1C and D). These results implicate liganddependent EGFR phosphorylation in LL-37-induced
MUC5AC mucin production.

LL-37 Induces Shedding of Soluble TGF- via

Activation of TACE
Pro-TGF- is constitutively expressed on the membrane surface of NCI-H292 cells and can be cleaved
by TACE to release soluble TGF- [17]. LL-37 increased TACE activity time- and dose-dependently
in NCI-H292 cells (Figure 2A and B). LL-37 also
increased TGF- release by NCI-H292 cells timeand dose-dependently (Figure 2C and D). In addition, TAPI-1 (a relatively selective TACE inhibitor)
inhibited LL-37-induced TACE activation (Figure
2E) and TGF- release (Figure 2F). These results
suggest an essential role of TACE activation in LL37-induced TGF- shedding.

TACE-mediated TGF- Release Plays an

Essential role in LL-37-induced EGFR
Phosphorylation and MUC5AC Mucin
Production
Preincubation of the cells with a TGF--neutralizing
antibody prevented LL-37-induced EGFR phosphorylation (Figure 3A) and MUC5AC mucin production (Figure 3B), and preincubation of the cells with

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

Y. Zhang et al.

FIGURE 1. LL-37 induces ligand-dependent EGFR phosphorylation and MUC5AC mucin

production. (A and B) NCI-H292 cells were treated with LL-37 at various concentrations for 15
minutes and analyzed for EGFR phosphorylation by Western blotting analysis (A), or stimulated for
24 hours and analyzed for MUC5AC mucin production by ELISA (B). (C and D) NCI-H292 cells were
pretreated with EGFR-neutralizing antibody (Ab-3, 4 g/mL) and the selective inhibitor of EGFR
phosphorylation AG1478 (5 M) for 30 minutes, and then stimulated with LL-37 (7.5 g/mL) for
15 min and analyzed for EGFR phosphorylation by Western blotting analysis (C), or stimulated for
24 hours and analyzed for MUC5AC mucin production by ELISA (D). Data are expressed as mean
SEM of three independent experiments. P < .01 versus untreated control, P < .01 versus LL-37 alone.

an EGFR-neutralizing antibody (Ab-3) increased the

accumulation of soluble TGF- (Figure 3C), suggesting the involvement of EGFR ligand TGF-
in LL-37-induced responses. Additionally, pretreatment of cells with TACE inhibitor TAPI-1 prevented
LL-37-induced EGFR phosphorylation (Figure 3A)
and mucin production (Figure 3B), as well as prevented LL-37-induced TGF- accumulation even in
the presence of EGFR-neutralizing antibody (Ab-3)
(Figure 3C), suggesting the involvement of TACE
in LL-37-induced responses. All these results indicate that TACE-mediated TGF- plays an essential
role in LL-37-induced EGFR phosphorylation and
MUC5AC mucin production.

AR and HB-EGF are not Involved

in LL-37-induced EGFR Activation
and MUC5AC Mucin Production
AR and HB-EGF are potential EGFR ligands that
can be generated by airway epithelial cells through

the ectodomain shedding by TACE [13, 14, 16].

We examined the involvement of AR and HBEGF in LL-37-induced EGFR phosphorylation and
MUC5AC mucin production. Pretreatment of the
cells with either AR-neutralizing antibody or HBEGF-neutralizing antibody did not affect LL-37induced EGFR phosphorylation (Figure 4A) and
MUC5AC mucin production (Figure 4B). These results suggest that AR and HB-EGF are not involved
in LL-37-induced responses.

The Effects of LL-37 on NCI-H292 Cells

are Peptide-specic
To exclude a nonspecific effect of LL-37, different
concentraions of a scrambled version of LL-37 (sLL37) were used to treat cells. The sLL-37 control
peptide had no effect on MUC5AC mucin production (Figure 5A), EGFR activation (Figure 5B), and
TACE activation (Figure 5C). These results suggest
that LL-37 activates TACE-TGF--EGFR pathway
Experimental Lung Research

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

LL-37 Induces Mucin Production via TACE-TGF--EGFR Pathway

FIGURE 2. LL-37 induces TGF- release involving TACE activity. (A) NCI-H292 cells were treated with LL-37 (7.5 g/mL) for
various time periods and analyzed for TACE activity by fluorescence resonance energy transfer (FRET) assay. (B) NCI-H292 cells were
treated with LL-37 at different concentrations for 3 hours and analyzed for TACE activity by FRET assay. (C) NCI-H292 cells were
treated with LL-37 (7.5 g/mL) for various time periods and analyzed for soluble TGF- release by ELISA. (D) NCI-H292 cells were
treated with LL-37 at different concentrations for 6 h and analyzed for soluble TGF- release by ELISA. (E and F) After pretreatment
with a selective TACE inhibitor TAPI-1 (10 M) for 30 minutes, NCI-H292 cells were stimulated with LL-37 (7.5 g/mL) for 3 hours
and analyzed for TACE activity by FRET assay (E), or stimulated for 6 hours and analyzed for soluble TGF- release by ELISA (F).
Data are expressed as mean SEM of three independent experiments. P < .01 versus untreated control, P< .01 versus LL-37 alone.

specifically to induce MUC5AC mucin production in

NCI-H292 cells.

Human Serum Inhibits LL-37-induced

MUC5AC Mucin Production
LL-37 has been reported to be able to interact with
some components in serum [18, 19], we investigated
whether serum affects LL-37-induced responses in
cultured airway epithelial NCI-H292 cells. LL-37induced MUC5AC mucin production was inhibited
by human serum whereas FBS enhanced MUC5AC
mucin production induced by LL-37 (Figure 6).
These results suggest that some components from
human serum, rather than FBS, may prevent LL37 from exerting downstream effects on NCI-H292
cells.

DISCUSSION
Here, we demonstrate for the first time that LL-37
activates TACE in human airway epithelial cells, lead
C

2014 Informa Healthcare USA, Inc.

ing to cleavage of pro-TGF- into mature soluble

TGF-, resulting in EGFR activation and subsequent
mucin production. We also show that EGFR ligands
AR and HB-EGF are not involved in these LL-37induced responses.
Airway epithelial cells are exposed to LL-37 in
higher concentrations in pathological conditions such
as cystic fibrosis and COPD [8, 9, 11]. In our previous study regarding COPD, we have implicated
EGFR-ERK1/2 signaling pathway in LL-37-induced
MUC5AC mucin production by blocking EGFRERK1/2 pathway with corresponding pharmacological inhibitors [12]. However, the precise mechanism
for LL-37-induced EGFR activation is unclear. Stimuli relevant to COPD such as cigarette smoke and
HNE have been shown to induce mucin overproduction in airway epithelial cells with TACE-TGF-EGFR axis established [4, 5]. In the present study,
we investigated whether TACE-mediated TGF- release is responsible for LL-37-induced EGFR activation and subsequent MUC5AC mucin production.
EGFR activation plays an essential role in mucin
induction by various stimuli [2, 4, 5, 20]. We

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

Y. Zhang et al.

FIGURE 3. TACE-mediated TGF- release plays an essential role in LL-37-induced EGFR

phosphorylation and MUC5AC mucin production. (A and B) NCI-H292 cells were pretreated with
TGF--neutralizing antibody (1 g/mL) and TAPI-1 (10 M) for 30 minutes, and then stimulated with
LL-37 (7.5 g/mL) for 15 minutes and analyzed for EGFR phosphorylation by Western blotting analysis
(A), or stimulated for 24 hours and analyzed for MUC5AC mucin production by ELISA (B). (C) Cells
were pretreated with EGFR-neutralizing antibody (Ab-3) alone (4 g/mL) or EGFR-neutralizing
antibody (4 g/mL) plus TAPI-1 (10 M), and then stimulated with LL-37 (7.5 g/mL) for 6 hours
and analyzed for soluble TGF- release by ELISA. Data are expressed as mean SEM of three
independent experiments. P <.01 versus untreated control, P < .01 versus LL-37 alone.

found that LL-37 induces EGFR phosphorylation

and MUC5AC mucin production, and the induction can be effectively inhibited by selective
EGFR tyrosine kinase inhibitor AG1478, suggesting the involvement of EGFR in LL-37-induced
mucin production. It has been reported that two
different processes are involved in EGFR activation: ligand dependent EGFR phosphorylation and
ligand-independent EGFR phosphorylation. A growing body of evidence indicates that EGFR can be
transactivated by metalloprotease-dependent shedding of EGFR ligands. These results suggest that
some of the EGFR activation previously considered
ligand-independent are essentially ligand-dependent.
To investigate whether ligand binding is required for
EGFR phosphorylation by LL-37, we preincubated
cells with a neutralizing anti-EGFR antibody to block
the EGFR ligand binding sites on the cell surface.

This pretreatment effectively prevented EGFR phosphorylation and mucin production induced by LL37, implicating ligand-dependent EGFR activation in
mucin induction by LL-37.
EGFR ligand TGF- is constitutively expressed in
airway epithelial cells [17]. Pro-TGF- (2022 kDa)
is synthesized as a transmembrane precursor of TGF. The newly synthesized pro-TGF- is cleaved by
metalloproteases, resulting in the release of mature
soluble TGF- (6 kDa) [21, 22]. Our data showed
that LL-37 promoted the release of soluble TGF-
by NCI-H292 cells, and that blocking EGFR ligand
binding sites caused a accumulation of soluble TGF while blocking TGF- prevented EGFR phosphorylation and MUC5AC mucin induction by LL-37.
These results suggest that TGF- is implicated in LL37-induced mucin production by binding to and activating EGFR. To examine whether a metalloprotease
Experimental Lung Research

LL-37 Induces Mucin Production via TACE-TGF--EGFR Pathway

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

FIGURE 4. AR and HB-EGF are not involved in LL-37-induced EGFR activation and MUC5AC
mucin production. (A) NCI-H292 cells were pretreated with AR-neutralizing antibody (20 g/mL) and
HB-EGF-neutralizing antibody (4 g/mL) for 30 minutes, and then stimulated with LL-37
(7.5 g/mL) for 15 minutes and analyzed for EGFR phosphorylation by Western blotting analysis. (B)
NCI-H292 cells were pretreated with AR-neutralizing antibody (20 g/mL) and HB-EGF-neutralizing
antibody (4 g/mL) for 30 minutes, and then stimulated with LL-37 (7.5 g/mL) for 24 hours and
analyzed for MUC5AC mucin production by ELISA. Data are expressed as mean SEM of three
independent experiments. P < .01 versus untreated control.

FIGURE 5. LL-37-induced responses in NCI-H292 cells are peptide-specific. NCI-H292 cells were

treated with LL-37 (5 g/mL) or sLL-37 (5 g/mL and 10 g/mL) for different time periods. (A) After
stimulated for 24 hours, the MUC5AC mucin production was analyzed by ELISA. (B) After stimulated
for 15 minutes, the EGFR phosphorylation was analyzed by Western blotting. (C) After stimulated for
6 hours, the TACE activity was analyzed by FRET assay. Data are expressed as mean SEM of three
independent experiments. P < .01 versus untreated control.

C

2014 Informa Healthcare USA, Inc.

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

Y. Zhang et al.

FIGURE 6. Human serum inhibits LL-37-induced MUC5AC

mucin production. NCI-H292 cells were treated with LL-37 for

24 hours in the absence of serum or in the presence of human
serum (HS, 5%, 10%) and fetal bovine serum (FBS, 5%, 10%),
the MUC5AC mucin were analyzed by ELISA. Data are
expressed as mean SEM of three independent experiments.

P < .01 versus untreated control, P < .01 versus LL-37 alone.

is involved in the ectodomain shedding of pro-TGF induced by LL-37 in NCI-H292 cells, we utilized
TAPI-1, an inhibitor of metalloprotease. We found
that TAPI-1 inhibited soluble TGF- release, EGFR
phosphorylation and MUC5AC mucin production
induced by LL-37, implicating metalloprotease activity in these processes. TACE is one member of a
disintegrin and metalloprotease (ADAM) family proteases and is constitutively expressed in NCI-H292
cells [13, 23]. It has been reported to be responsible
for the ectodomain shedding of TGF- in various epithelial tissues [13, 24]. In this study, we demonstrate
that LL-37 possesses the ability to increase TACE
activity in NCI-H292 cells and that LL-37-induced
TACE activity could be inhibited by TAPI-1. Altogether, these findings suggest a crucial role of TACEmediated TGF- release in LL-37-induced EGFR
activation and mucin production with TACE-TGF-EGFR axis established.
Previous studies have reported that TACE is also
responsible for the generation of AR and HB-EGF by
ectodomain shedding of pro-amphiregulin and proHB-EGF in membrane surface of epithelial cells [13,
14, 16]. AR and HB-EGF are considered potential
EGFR ligands which bind to and activate EGFR.
In the present study, we show that pretreatment of
the cells with corresponding neutralizing antibodies against AR and HB-EGF have no effect on LL-

37-induced EGFR phosphorylation and MUC5AC

mucin production. These results suggest that AR
and HB-EGF are not mediators between TACE
and EGFR activation in LL-37-induced mucin
production.
Importantly, in this study, we examined the specificity of LL-37-induced responses in NCI-H292 cells.
We demonstrate that a scrambled version of LL-37
(sLL-37) had no effect on TACE and EGFR activation, as well as MUC5AC mucin production, which
can be induced by LL-37. These results suggest
that LL-37-induced responses in NCI-H292 cells are
peptide-specific. In addition, as most in vitro experiments were preformed in the absence of serum, we
investigated whether the effects of LL-37 were influenced by serum. We demonstrate that human serum
inhibits LL-37-induced MUC5AC mucin production. It has been reported that some special components existed in human serum, such as apolipoprotein A-1 and high-density lipoprotein (HDL), could
bind to LL-37 and thus suppress its cytotoxicity [18,
19, 25]. Such components may also prevent LL-37
from interacting with NCI-H292 cells by binding to
LL-37 in the presence of human serum. However, despite the potential effect of serum on LL-37-induced
responses, epithelial cells in human airways, which
generally reside in serum-free environments, are not
influenced by serum and thus may be sensitive to
high concentrations of LL-37 encountered during inflammation such as observed in airway surface from
COPD patients.
Some limitations should be noticed in this study.
First, the results presented here were from studies
performed in a cancer cell line (NCI-H292 cells),
which often behave quite differently from primary
airway epitheial cells. Under some circumstances,
the effect of LL-37 may only be observed in welldifferentiated primary cultures [22, 26]. Although
a variety of studies involving mucin induction employed NCI-H292 cells, studies performed in primary airway epithelial cells are needed to provide a
more accurate description for the effects of LL-37 on
airway mucin induction. Second, the concentrations
of LL-37 used in this study (2.510 g/mL) might be
supraphysiologic. It is difficult to determine the exact concentration of LL-37 in the microenvironment
surrounding airway epithelial cells. Several studies
have examined LL-37 levels in human airway, and
the results are variable in magnitude. LL-37 can be
detected at airway mucosal surfaces in healthy individuals at concentrations of around 25 g/mL, and
is upregulated to approximately 20 g/mL in bronchoalveolar lavage fluid from children with lung infections [27]. Nevertheless, a recent study reported

Experimental Lung Research

LL-37 Induces Mucin Production via TACE-TGF--EGFR Pathway

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

elevated LL-37 concentrations in the epithelial lining

fluid (ELF) from COPD patients in the ng/mL range
[10]. Considering the variability in magnitude, a wide
range of LL-37 concentrations should be employed
to further investigate the in vitro effects of LL-37 on
airway mucin production.
In summary, we show that stimulation with LL-37
specifically induced MUC5AC mucin production via
TACE-TGF--EGFR pathway in airway epithelial
cells. EGFR ligands AR and HB-EGF are not
involved in these LL-37-induced responses. These
findings are rather important because LL-37 is
closely associated with COPD. The discovery may
help researchers further understand the mechanism
for airway mucus overproduction in COPD.
Declaration of interest: The authors report no
conflicts of interest. The authors alone are responsible for the content and writing of the paper.
This work was supported by Grant 81170041 from
the National Natural Science Foundation of China.

[10]

[11]

[12]

[13]

[14]

[15]

REFERENCES
[1]

[2]
[3]
[4]

[5]

[6]

[7]

[8]

[9]


C

Hogg JC, Chu F, Utokaparch S, Woods R, Elliott WM, Buzatu

L, Cherniack RM, Rogers RM, Sciurba FC, Coxson HO,
Pare PD: The nature of small-airway obstruction in chronic
obstructive pulmonary disease. N Engl J Med. 2004;350:
26452653.
Voynow JA, Rubin BK: Mucins, mucus, and sputum. Chest.
2009;135:505512.
Tuder RM, Petrache I: Pathogenesis of chronic obstructive pulmonary disease. J Clin Invest. 2012;122:27492755.
Shao MX, Nakanaga T, Nadel JA: Cigarette smoke induces
MUC5AC mucin overproduction via tumor necrosis factoralpha-converting enzyme in human airway epithelial (NCIH292) cells. Am J Physiol Lung Cell Mol Physiol. 2004;287:
L420L427.
Shao MX, Nadel JA: Neutrophil elastase induces MUC5AC
mucin production in human airway epithelial cells via a cascade involving protein kinase C, reactive oxygen species,
and TNF-alpha-converting enzyme. J Immunol. 2005;175:
40094016.
Song KS, Lee WJ, Chung KC, Koo JS, Yang EJ, Choi JY,
Yoon JH: Interleukin-1 beta and tumor necrosis factor-alpha
induce MUC5AC overexpression through a mechanism involving ERK/p38 mitogen-activated protein kinases-MSK1CREB activation in human airway epithelial cells. J Biol Chem.
2003;278:2324323250.
Bucki R, Leszczynska K, Namiot A, Sokolowski W: Cathelicidin
LL-37: a multitask antimicrobial peptide. Arch Immunol Ther
Exp (Warsz). 2010;58:1525.
Xiao W, Hsu YP, Ishizaka A, Kirikae T, Moss RB: Sputum
cathelicidin, urokinase plasminogen activation system components, and cytokines discriminate cystic fibrosis, COPD, and
asthma inflammation. Chest. 2005;128:23162326.
Golec M, Reichel C, Mackiewicz B, Skorska C, Curzytek K,
Lemieszek M, Dutkiewicz J, Gora A, Ziesche R, Boltuc J,
Sodolska K, Milanowski J, Spiewak R: Cathelicidin LL-37,

2014 Informa Healthcare USA, Inc.

[16]

[17]

[18]

[19]

[20]

[21]

[22]

[23]

[24]

[25]

granzymes, TGF-beta1 and cytokines levels in induced sputum

from farmers with and without COPD. Ann Agric Environ Med:
AAEM. 2009;16:289297.
Golec M, Reichel C, Lemieszek M, Mackiewicz B, Buczkowski
J, Sitkowska J, Skorska C, Dutkiewicz J, Milanowski J, Ziesche
R: Cathelicidin LL-37 in bronchoalveolar lavage and epithelial
lining fluids from COPD patients and healthy individuals. J Biol
Regul Homeost Agents. 2012;26:617625.
Jiang YY, Xiao W, Zhu MX, Yang ZH, Pan XJ, Zhang Y, Sun
CC, Xing Y: The effect of human antibacterial peptide LL-37
in the pathogenesis of chronic obstructive pulmonary disease.
Respir Med. 2012;106:16801689.
Zhang Y, Jiang Y, Sun C, Wang Q, Yang Z, Pan X, Zhu M,
Xiao W: The human cathelicidin LL-37 enhances airway mucus
production in chronic obstructive pulmonary disease. Biochem
Biophys Res Commun. 2014;443:103109.
Shao MX, Ueki IF, Nadel JA: Tumor necrosis factor alphaconverting enzyme mediates MUC5AC mucin expression in
cultured human airway epithelial cells. Proc Natl Acad Sci U
S A. 2003;100:1161811623.
Richter A, ODonnell RA, Powell RM, Sanders MW, Holgate
ST, Djukanovic R, Davies DE: Autocrine ligands for the epidermal growth factor receptor mediate interleukin-8 release from
bronchial epithelial cells in response to cigarette smoke. Am J
Respir Cell Mol Biol. 2002;27:8590.
Yin J, Yu FS: LL-37 via EGFR transactivation to promote high
glucose-attenuated epithelial wound healing in organ-cultured
corneas. Invest Ophthalmol Vis Sci. 2010;51:18911897.
Fischer OM, Hart S, Gschwind A, Ullrich A: EGFR signal
transactivation in cancer cells. Biochem Soc Trans. 2003;31:
12031208.
Polosa R, Prosperini G, Leir SH, Holgate ST, Lackie PM,
Davies DE: Expression of c-erbB receptors and ligands in human bronchial mucosa. Am J Respir Cell Mol Biol. 1999;20:
914923.
Wang Y, Agerberth B, Lothgren A, Almstedt A, Johansson J: Apolipoprotein A-I binds and inhibits the human antibacterial/cytotoxic peptide LL-37. J Biol Chem. 1998;273:
3311533118.
Wang Y, Johansson J, Agerberth B, Jornvall H, Griffiths WJ:
The antimicrobial peptide LL-37 binds to the human plasma
protein apolipoprotein A-I. Rapid Commun Mass Spectrom.
2004;18:588589.
Li Q, Lei RX, Zhou XD, Kolosov VP, Perelman JM:
Regulation of PMA-induced MUC5AC expression by heparin in human bronchial epithelial cells. Mol Cell Biochem.
2012;360:383391.
Hinkle CL, Mohan MJ, Lin P, Yeung N, Rasmussen F, Milla
ME, Moss ML: Multiple metalloproteinases process protransforming growth factor-alpha (proTGF-alpha). Biochemistry.
2003;42:21272136.
Vermeer PD, Einwalter LA, Moninger TO, Rokhlina T, Kern
JA, Zabner J, Welsh MJ: Segregation of receptor and ligand regulates activation of epithelial growth factor receptor. Nature.
2003;422:322326.
Reddy P, Slack JL, Davis R, Cerretti DP, Kozlosky CJ, Blanton RA, Shows D, Peschon JJ, Black RA: Functional analysis of
the domain structure of tumor necrosis factor-alpha converting
enzyme. J Biol Chem. 2000;275:1460814614.
Zhao J, Chen H, Wang YL, Warburton D: Abrogation of
tumor necrosis factor-alpha converting enzyme inhibits embryonic lung morphogenesis in culture. Int J Dev Biol.
2001;45:623631.
Lau YE, Bowdish DM, Cosseau C, Hancock RE, Davidson
DJ: Apoptosis of airway epithelial cells: human serum sensitive

10

Y. Zhang et al.
wound closure. Am J Physiol Lung Cell Mol Physiol. 2005;289:
L842L848.
[27] Schaller-Bals S, Schulze A, Bals R: Increased levels of antimicrobial peptides in tracheal aspirates of newborn infants during
infection. Am J Respir Crit Care Med. 2002;165:992995.

Exp Lung Res Downloaded from informahealthcare.com by Cornell University on 07/17/14

For personal use only.

induction by the cathelicidin LL-37. Am J Respir Cell Mol Biol.

2006;34:399409.
[26] Shaykhiev R, Beisswenger C, Kandler K, Senske J, Puchner
A, Damm T, Behr J, Bals R: Human endogenous antibiotic LL-37 stimulates airway epithelial cell proliferation and

Experimental Lung Research