Open navigation menu

Upload

User Settings

Welcome to Scribd!

Skip carousel

0% found this document useful (0 votes)

13 views

Raw Sequence

Uploaded by

vesasc

Copyright:

Attribution Non-Commercial (BY-NC)

Available Formats

Download as TXT, PDF, TXT or read online from Scribd

Flag for inappropriate content

Normal Lab Values
Document3 pages
Normal Lab Values
Julius Linsangan De Guzman
100% (4)
Gunold QFL Catalog
Document205 pages
Gunold QFL Catalog
carloscarinelli
No ratings yet
2G 3G Counters For ENIQ - v1
Document12 pages
2G 3G Counters For ENIQ - v1
akmamit
No ratings yet
63 Lab Values
Document4 pages
63 Lab Values
Yemaya84
No ratings yet
ZTE 3G RAN Parameter Baseline V1.4 20131206
Document73 pages
ZTE 3G RAN Parameter Baseline V1.4 20131206
Poobalan Murugeya
50% (2)
9.harvesting Cabbage
Document7 pages
9.harvesting Cabbage
MengTang
No ratings yet
MSC Practicals
Document13 pages
MSC Practicals
linubinoy
No ratings yet
3G Parameter Template RU30
Document27 pages
3G Parameter Template RU30
Kuldeep Sharma
No ratings yet
Mercy Hospital For Women, Monash Pelvic Floor Clinic, 2. Monash Pelvic Floor Clinic, 3. University of Melbourne, 4. James Cook University
Document3 pages
Mercy Hospital For Women, Monash Pelvic Floor Clinic, 2. Monash Pelvic Floor Clinic, 3. University of Melbourne, 4. James Cook University
murugeshlp
No ratings yet
EP210 - Comandos Elétricos em Sistemas Pneumáticos: S S S S S S S S
Document1 page
EP210 - Comandos Elétricos em Sistemas Pneumáticos: S S S S S S S S
Ivan Silva
No ratings yet
Normal Lab Values: Chemistry Hematology WBC Differential
Document1 page
Normal Lab Values: Chemistry Hematology WBC Differential
Harleen Shahi
No ratings yet
Nok Umts Adaptations
Document8 pages
Nok Umts Adaptations
Rocky
No ratings yet
MRHZU2ZP013 Alignment
Document1 page
MRHZU2ZP013 Alignment
doudoudi452
No ratings yet
Schedul For CCPC Meeting 28 Apr 2011-Kh
Document2 pages
Schedul For CCPC Meeting 28 Apr 2011-Kh
Ccpc Cambodia
No ratings yet
Tổng Hợp Doanh Nghiệp Trả Cổ Tức Bằng Tiền Mặt
Document4 pages
Tổng Hợp Doanh Nghiệp Trả Cổ Tức Bằng Tiền Mặt
Quoc Vinh
No ratings yet
General Banking Awareness
Document1 page
General Banking Awareness
brahmasys
No ratings yet
Huawei Parameters Dictionary - Rev2
Document43 pages
Huawei Parameters Dictionary - Rev2
Iqbal Hamdi
No ratings yet
2g Kpi Param
Document62 pages
2g Kpi Param
Rasyidi Usman
No ratings yet
Model GPY Panel Manual
Document12 pages
Model GPY Panel Manual
Mostafa Abd El-razek
No ratings yet
Complete Blood Count: 483138 Mrs Neelofer Jafri 68 Years / Female 434333
Document1 page
Complete Blood Count: 483138 Mrs Neelofer Jafri 68 Years / Female 434333
Zain Ali
No ratings yet
Capture D'écran . 2024-03-06 À 14.31.23
Document1 page
Capture D'écran . 2024-03-06 À 14.31.23
tx7vr6jxjv
No ratings yet
Design QPCR For Different Regions
Document7 pages
Design QPCR For Different Regions
bskienhvqy
No ratings yet
Adjacenadjacenadjacenalarm Stransmission Packet Loss Rate (%%)
Document6 pages
Adjacenadjacenadjacenalarm Stransmission Packet Loss Rate (%%)
fkkgđkjk
No ratings yet
R) Aykarn - Sþibi Karsiksabinirnþrrpabkarciba©Wmcivitrbs Rbcaensat Nig Ksikr Enapumi Ekahb Ssi Xmurblaymas Rsukkmbg Elg Extþkmbg Qñamg
Document40 pages
R) Aykarn - Sþibi Karsiksabinirnþrrpabkarciba©Wmcivitrbs Rbcaensat Nig Ksikr Enapumi Ekahb Ssi Xmurblaymas Rsukkmbg Elg Extþkmbg Qñamg
Sokheng Khel
No ratings yet
3G QoS Optimization Progress S7 2015
Document24 pages
3G QoS Optimization Progress S7 2015
leandre vanie
No ratings yet
Logica Cul. Gen. Biologia Chimica Fis. & Mat. Totale Posizione in Ateneo Posizione Nazionale
Document57 pages
Logica Cul. Gen. Biologia Chimica Fis. & Mat. Totale Posizione in Ateneo Posizione Nazionale
Skuola.net
No ratings yet
Expasy
Document1 page
Expasy
Leticia Bonancio Cerqueira
No ratings yet
ZTE 3G RAN Parameter Baseline V1!4!20131206
Document100 pages
ZTE 3G RAN Parameter Baseline V1!4!20131206
Bromand Turkmani
No ratings yet
2G GPL Non GPL Parameters - Bharti Project
Document4 pages
2G GPL Non GPL Parameters - Bharti Project
Harish Adhikari
No ratings yet
Week4 PCR Detailed Strategy
Document6 pages
Week4 PCR Detailed Strategy
Arjun Bujji
No ratings yet
Pembimbing: DR - Dr. Mardiastuti H. Wahid, M.SC, SPMK (K)
Document27 pages
Pembimbing: DR - Dr. Mardiastuti H. Wahid, M.SC, SPMK (K)
Hanung Pujangga
No ratings yet
Factura Electronica - Impresion - VILLANUEVA
Document1 page
Factura Electronica - Impresion - VILLANUEVA
Wilder Escudero
No ratings yet
SUMUR
Document2 pages
SUMUR
banaran.desaku
No ratings yet
HIV-1 Reverse Transcriptase
Document3 pages
HIV-1 Reverse Transcriptase
Joshua Arrojo
No ratings yet
Book 2
Document63 pages
Book 2
roni
No ratings yet
e-CHECK XE - 4073 - XE
Document1 page
e-CHECK XE - 4073 - XE
renyan
No ratings yet
Protien Synthesis Elongation & Termination
Document14 pages
Protien Synthesis Elongation & Termination
vesasc
No ratings yet
Presentation On Index Nnumbeumbers and Their Typesa
Document1 page
Presentation On Index Nnumbeumbers and Their Typesa
vesasc
No ratings yet
V.E.S. College of Arts, Science & Commerce Shri Mahavirprasad G. Saraf Best Student Award ACADEMIC YEAR: 2012 - 13 Application Form
Document7 pages
V.E.S. College of Arts, Science & Commerce Shri Mahavirprasad G. Saraf Best Student Award ACADEMIC YEAR: 2012 - 13 Application Form
vesasc
No ratings yet
The Cells of The Immune System: Aditya Gupta & Alok Singh S.Y.Bsc (Microbiology) V.E.S. College
Document22 pages
The Cells of The Immune System: Aditya Gupta & Alok Singh S.Y.Bsc (Microbiology) V.E.S. College
vesasc
No ratings yet
Ceramics Materials
Document4 pages
Ceramics Materials
vesasc
No ratings yet
Project Cyber Crime
Document51 pages
Project Cyber Crime
vesasc
No ratings yet
When The List of Target Markets Is Made, A Company Might Want To
Document155 pages
When The List of Target Markets Is Made, A Company Might Want To
vesasc
No ratings yet

Raw Sequence

Uploaded by

vesasc

0% found this document useful (0 votes)

13 views1 page

Copyright

Available Formats

TXT, PDF, TXT or read online from Scribd

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Report this Document

Copyright:

Attribution Non-Commercial (BY-NC)

Available Formats

Download as TXT, PDF, TXT or read online from Scribd

Flag for inappropriate content

Download as txt, pdf, or txt

0% found this document useful (0 votes)

13 views1 page

Raw Sequence

Uploaded by

vesasc

Copyright:

Attribution Non-Commercial (BY-NC)

Available Formats

Download as TXT, PDF, TXT or read online from Scribd

Flag for inappropriate content

Download as txt, pdf, or txt

Jump to Page

You are on page 1of 1

Search inside document

>2L05:A|PDBID|CHAIN|SEQUENCE

MGHHHHHHSHMPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWL
TGEELHVEVLENVPL

Normal Lab Values
Document3 pages
Normal Lab Values
Julius Linsangan De Guzman
100% (4)
Gunold QFL Catalog
Document205 pages
Gunold QFL Catalog
carloscarinelli
No ratings yet
2G 3G Counters For ENIQ - v1
Document12 pages
2G 3G Counters For ENIQ - v1
akmamit
No ratings yet
63 Lab Values
Document4 pages
63 Lab Values
Yemaya84
No ratings yet
ZTE 3G RAN Parameter Baseline V1.4 20131206
Document73 pages
ZTE 3G RAN Parameter Baseline V1.4 20131206
Poobalan Murugeya
50% (2)
9.harvesting Cabbage
Document7 pages
9.harvesting Cabbage
MengTang
No ratings yet
MSC Practicals
Document13 pages
MSC Practicals
linubinoy
No ratings yet
3G Parameter Template RU30
Document27 pages
3G Parameter Template RU30
Kuldeep Sharma
No ratings yet
Mercy Hospital For Women, Monash Pelvic Floor Clinic, 2. Monash Pelvic Floor Clinic, 3. University of Melbourne, 4. James Cook University
Document3 pages
Mercy Hospital For Women, Monash Pelvic Floor Clinic, 2. Monash Pelvic Floor Clinic, 3. University of Melbourne, 4. James Cook University
murugeshlp
No ratings yet
EP210 - Comandos Elétricos em Sistemas Pneumáticos: S S S S S S S S
Document1 page
EP210 - Comandos Elétricos em Sistemas Pneumáticos: S S S S S S S S
Ivan Silva
No ratings yet
Normal Lab Values: Chemistry Hematology WBC Differential
Document1 page
Normal Lab Values: Chemistry Hematology WBC Differential
Harleen Shahi
No ratings yet
Nok Umts Adaptations
Document8 pages
Nok Umts Adaptations
Rocky
No ratings yet
MRHZU2ZP013 Alignment
Document1 page
MRHZU2ZP013 Alignment
doudoudi452
No ratings yet
Schedul For CCPC Meeting 28 Apr 2011-Kh
Document2 pages
Schedul For CCPC Meeting 28 Apr 2011-Kh
Ccpc Cambodia
No ratings yet
Tổng Hợp Doanh Nghiệp Trả Cổ Tức Bằng Tiền Mặt
Document4 pages
Tổng Hợp Doanh Nghiệp Trả Cổ Tức Bằng Tiền Mặt
Quoc Vinh
No ratings yet
General Banking Awareness
Document1 page
General Banking Awareness
brahmasys
No ratings yet
Huawei Parameters Dictionary - Rev2
Document43 pages
Huawei Parameters Dictionary - Rev2
Iqbal Hamdi
No ratings yet
2g Kpi Param
Document62 pages
2g Kpi Param
Rasyidi Usman
No ratings yet
Model GPY Panel Manual
Document12 pages
Model GPY Panel Manual
Mostafa Abd El-razek
No ratings yet
Complete Blood Count: 483138 Mrs Neelofer Jafri 68 Years / Female 434333
Document1 page
Complete Blood Count: 483138 Mrs Neelofer Jafri 68 Years / Female 434333
Zain Ali
No ratings yet
Capture D'écran . 2024-03-06 À 14.31.23
Document1 page
Capture D'écran . 2024-03-06 À 14.31.23
tx7vr6jxjv
No ratings yet
Design QPCR For Different Regions
Document7 pages
Design QPCR For Different Regions
bskienhvqy
No ratings yet
Adjacenadjacenadjacenalarm Stransmission Packet Loss Rate (%%)
Document6 pages
Adjacenadjacenadjacenalarm Stransmission Packet Loss Rate (%%)
fkkgđkjk
No ratings yet
R) Aykarn - Sþibi Karsiksabinirnþrrpabkarciba©Wmcivitrbs Rbcaensat Nig Ksikr Enapumi Ekahb Ssi Xmurblaymas Rsukkmbg Elg Extþkmbg Qñamg
Document40 pages
R) Aykarn - Sþibi Karsiksabinirnþrrpabkarciba©Wmcivitrbs Rbcaensat Nig Ksikr Enapumi Ekahb Ssi Xmurblaymas Rsukkmbg Elg Extþkmbg Qñamg
Sokheng Khel
No ratings yet
3G QoS Optimization Progress S7 2015
Document24 pages
3G QoS Optimization Progress S7 2015
leandre vanie
No ratings yet
Logica Cul. Gen. Biologia Chimica Fis. & Mat. Totale Posizione in Ateneo Posizione Nazionale
Document57 pages
Logica Cul. Gen. Biologia Chimica Fis. & Mat. Totale Posizione in Ateneo Posizione Nazionale
Skuola.net
No ratings yet
Expasy
Document1 page
Expasy
Leticia Bonancio Cerqueira
No ratings yet
ZTE 3G RAN Parameter Baseline V1!4!20131206
Document100 pages
ZTE 3G RAN Parameter Baseline V1!4!20131206
Bromand Turkmani
No ratings yet
2G GPL Non GPL Parameters - Bharti Project
Document4 pages
2G GPL Non GPL Parameters - Bharti Project
Harish Adhikari
No ratings yet
Week4 PCR Detailed Strategy
Document6 pages
Week4 PCR Detailed Strategy
Arjun Bujji
No ratings yet
Pembimbing: DR - Dr. Mardiastuti H. Wahid, M.SC, SPMK (K)
Document27 pages
Pembimbing: DR - Dr. Mardiastuti H. Wahid, M.SC, SPMK (K)
Hanung Pujangga
No ratings yet
Factura Electronica - Impresion - VILLANUEVA
Document1 page
Factura Electronica - Impresion - VILLANUEVA
Wilder Escudero
No ratings yet
SUMUR
Document2 pages
SUMUR
banaran.desaku
No ratings yet
HIV-1 Reverse Transcriptase
Document3 pages
HIV-1 Reverse Transcriptase
Joshua Arrojo
No ratings yet
Book 2
Document63 pages
Book 2
roni
No ratings yet
e-CHECK XE - 4073 - XE
Document1 page
e-CHECK XE - 4073 - XE
renyan
No ratings yet
Protien Synthesis Elongation & Termination
Document14 pages
Protien Synthesis Elongation & Termination
vesasc
No ratings yet
Presentation On Index Nnumbeumbers and Their Typesa
Document1 page
Presentation On Index Nnumbeumbers and Their Typesa
vesasc
No ratings yet
V.E.S. College of Arts, Science & Commerce Shri Mahavirprasad G. Saraf Best Student Award ACADEMIC YEAR: 2012 - 13 Application Form
Document7 pages
V.E.S. College of Arts, Science & Commerce Shri Mahavirprasad G. Saraf Best Student Award ACADEMIC YEAR: 2012 - 13 Application Form
vesasc
No ratings yet
The Cells of The Immune System: Aditya Gupta & Alok Singh S.Y.Bsc (Microbiology) V.E.S. College
Document22 pages
The Cells of The Immune System: Aditya Gupta & Alok Singh S.Y.Bsc (Microbiology) V.E.S. College
vesasc
No ratings yet
Ceramics Materials
Document4 pages
Ceramics Materials
vesasc
No ratings yet
Project Cyber Crime
Document51 pages
Project Cyber Crime
vesasc
No ratings yet
When The List of Target Markets Is Made, A Company Might Want To
Document155 pages
When The List of Target Markets Is Made, A Company Might Want To
vesasc
No ratings yet

Raw Sequence

Uploaded by

Copyright:

Available Formats

You might also like

Raw Sequence

Uploaded by

Document Information

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

Raw Sequence

Uploaded by

Copyright:

Available Formats

>2L05:A|PDBID|CHAIN|SEQUENCE

You might also like