Download as pdf or txt
Download as pdf or txt
You are on page 1of 140

Klaudio Zic's Storefront - Lulu.

com

Buy | My Lulu | Community | Help

* The Academic Zodiac consists in 22 zodiacal constellations.


* Which one of the 16 is your own true Eastern Ascendant?
* Change your personal future for the best right now!
* Render your own reality with the Reality Rendering Tools.
* Resolve economical crisis to your own favor.
* Protect your family, identity, horoscope and futurity from superstition!
* Render and establish personal prosperity forever.
* Catch up with the latest zodiacal upgrade.
* Render your own reality in minutes with the Real Time Reality Renderin

The Right to Dream (e-book)


Download: €27.70
EU calling USA. There is a new kid in town.
Add Download to Cart

Infant Astrologer (e-book)


Download: €22.16
Your true natal ascendant is marked with an "E".
Add Download to Cart

American Zodiac (e-book)


Download: €16.22
Which one among the following three choices represents
Ophiuchus, Serpens Cauda or Aquila?
Add Download to Cart

Cascade (e-book)
Download: €97.13
"Just paste yourself within an ideal situation and enjoy be
materialize as soon as impossible." Complete RTRRT insta
First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved.
No part of this material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for commercial
purposes or otherwise, without the written permission of the author.

RIGHTS

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

THE RIGHT TO PERSONALITY

Your personalityi has been more or less decided by the systemii you were born in.
In many cases, you personality or the lack of one, was decided before you were
born. This prefab personality of course lacks any. Mostly, you were destined to
mount guard at the cabin. Much as the Russians are all the same, so are the
Americans. In London, they even make a ritual of mounting guard on the cabin.

THE RIGHT TO ONE'S OWN NATAL DATA

Essentially, this is the right to one's own horoscope. One has the right of the sight
of one's own natal skies. This right applies in approaching the Academic Zodiac
and personal Precessed Ascendant as housed within the universal Cartesian house
system. For thousands of years, the population had no access to their own natal
data. Later on, they deliberately mangled the data in order to have you wear a
false identity for a lifetime, much according to their own practice. You are not a
slave. You have your own right to your original horoscope, the faithful blueprint
of your true natal skies. And when you have it in your hands, you will see that it
has nothing to do with the crooked personality they were about to impose on you.
THE RIGHT TO MAKE MIRACLES

One of the hardest rights to obtainiii is making miracles freely. Our Lord Jesus
Christ is an example as He was judged for making good deeds. Essentially, this is
like the right to help others. Even a guru may forbid you to do so! Obviously,
there is great danger for both sides in helping others (sic). Miracle makers may be
viewed with suspicion and even hate, even by their own neighbors. Since good
neighbors mount guard at the cabin, they are told to shoot first and ask
questions later. In approaching them in order to help them, count on their
paranoid, forced collectivism and total lack of freedom. One musty be extra wise
in order to feed the dog who bites. An advice is to perform miracles in secret. This
has always been an advice. You do not have to sneak around thew synagogue in
order to avoid stones from people you want to help. Another advice would be not
to help at all. How do you know you are actually helping? An initiate can be
rebuked by his master for curing cancer. This is because an appointed fate was
sometimes set by Divine Providence. Also, the healed will bite, too. So beware
your healing hands, next time you think you know that it is good to help that one.

THE RIGHT TO PERFORM MAGICK

Essentially, this is the same as making miracles, only that in making miracles we
often imply helping others, while in performing magick we mostly help ourselves.
A true initiate will tacitly help others, while otherwise disinterested in
influencing them or even doing them harm. The initiate is not a human being as
interested in other human beings. He will do no harm. On the other hand, the
human being will do much harm in witch hunt, since one is afraid of freedom.
Then, helping oneself can become a right. In this case you do not mount the guard
at the cabin, but help your very inner self. In terms of contemporary society,
you hacked the matrix and have thus become a genuine rebel.

THE RIGHT NOT TO THINK


Default mind is a tyrannic install since it is so hard to switch it off. It does not
pertain to us. Thus, in refusing to think, one finds one's own freedom and true
mind. The original mind is the basic right of every being, humans included.

THE RIGHT NOT TO BE HUMAN

The following Rights express some of the basic needs of a developing individual,
that is initiate. As often stated, an initiate is not a human being. Therefore, every
initiate has the right not to be human at all times or at all.

THE RIGHT TO BE LEFT ALONE

This license is hard to obtain by anyone who ever tried. London is under control.
Venice swarms with tourists. The deserts of Jesus and the Baptist are at risk of an
Armageddon. Bhutan is under siege and Nepal is becoming a colony.
Monasteries are what they are, so where shall one turn to? This was the logistic
problem of many a mystic. A spider's web may fool the desert police, but that
would be a risky meditation trip, indeed. Palden Dorje wielded a sword as he
disappeared into the jungle.

THE RIGHT TO DREAM

Hardly anyone can take this right from you. The basic right of the initiate is to act
in second attention, that is active dreaming. Still, in the past, warriors of the third
attention might have intervened, so be careful not to engage in the weak side of
second attention. The RTRRT have the rudimentary outlet for dreamers, called the
Bogeyman. In this option, the dreamer is initiated through dreams, that is, the
initiation happens on the astral plane.
Klaudio Zic
The Academic Zodiac & RTRRT are Copyright © 1995 - 2009 by Klaudio Zic, all rights reserved worldwide.
Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology
i Default ego.
ii Personality is not allowed at all in social intercourse, as it is assumed that we are all the same. That is, the little variants
simply do not count. You may wear a conic cap, tricorne or toque, but you are still not free. Even your own mind is not
yours, so how can you be? When Pluto entered Coma Berenices, they were trying to free themselves by growing hair.
Funny.
iii From the public scribes. Jesus had no license proper?
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/ast

Buy | My Lulu | Community | Help Customize Storefront | Log Out | View Cart

Klaudio Zic's Storefront - Lulu.com

* The Academic Zodiac consists in 22 zodiacal constellations.


* Which one of the 16 is your own true Eastern Ascendant? Add Download to Cart
* Change your personal future for the best right now!
* Render your own reality with the Reality Rendering Tools.
* Resolve economical crisis to your own favor. Pegasus Point (e-book)
* Protect your family, identity, horoscope and futurity from superstition!
Download: €16.22
* Render and establish personal prosperity forever.
A zodiacal jump into infinity.
* Catch up with the latest zodiacal upgrade. Add Download to Cart
* Render your own reality in minutes with the Real Time Reality Rendering Tools.

Ciel Ouvert (e-book)


Download: €66.84
In order to reboot your fate in the directio
Zodiacal Conspiracy (e-book) Add Download to Cart

Download: €59.41
They told you about your ascendant. They lied.
Add Download to Cart WYSIWYG Astrology (e-book)
Download: €3.89
Your own guide to your basic, professiona
European Astrology (e-book) Add Download to Cart

Download: €20.12
Did we have any astrology in Europe yet?
Add Download to Cart Pegasus Point (e-book)
Download: €9.71
The Pegasus Point is a special contribution
2012 Astrology (e-book) Venus in Pegasus. Explore the previously
Add Download to Cart
Download: €25.15
Take a splash into your own starry futurity!
Add Download to Cart
Pegasus Point (e-book)
Download: €28.00
om http://stores.lulu.com/astrologyThe legendary exaltation point of Venus a
ETER (e-book) mundane portents for the next ascent of V
you to and fro between heaven and hell.
Download: €66.84 Add Download to Cart
Time to retrieve all your energy, time and emotion. Empower yourself by possessing to the full what you
already gave up for lost.

Pegasus Point (e-book)


Download: €35.00
The Pegasus Point as delineated in the 12
Add Download to Cart

Lucifer (e-book)
Download: €20.25
A further peek into God's secret zodiacal w
exceeds in minute technical detail over th
Add Download to Cart
Facebook | Klaudio Antonio Valentin http://ww
trology

Home Profile Friends Inbox 588 Klaudio Antonio Valentin Settings Logout

Klaudio Antonio Valentin


Wall Info Photos

What's on your mind?

Attach Share

Options
http://stores.lulu.com/astrology
View Videos of Me (3)
Klaudio Antonio Valentin Did we have any astrology in EU yet? Remove
European Astrology by Klaudio Zic (Book) in
Edit My Profile Self-Improvement
Source: www.lulu.com
European Astrology by Klaudio Zic (Book) in
http://lulu.com/astrology Self-Improvement : Did we have any astrology in
http://youtube.com/RTRRTV Europe yet?
The 22 constellations of the
Academic Zodiac, 16 eastern
ascendants for the current
epoch and reality rendering.
RTRRT instant magick for
one.

Information about a minute ago · Comment · Like · Share

No basic information shown. Klaudio Antonio Valentin Get your Energy back!
ETER by Klaudio Zic (Book) in Self-Improvement
Friends Source: www.lulu.com
116 friends See All ETER by Klaudio Zic (Book) in Self-Improvement : Time to
retrieve all your energy, time and emotion. Empower
yourself by possessing to the full what you already gave up
for lost.
on of your own choice, all you need is instant magick.

Tnt Pub Murielle Camilla


Trieste Boutin Farina

Fri at 8:01am · Comment · Like · Share


Rita Društvo Alvaro
Isidori Vitezov Zambrano
al and custom horoscope. Jeruzale Meza Klaudio Antonio Valentin PP stads for Pegasus Point in your
mskega horoscope.
Templja
Pegasus Point by Klaudio Zic (Book) in
Self-Improvement
Source: www.lulu.com
Photos
Pegasus Point by Klaudio Zic (Book) in Self-Improvement :
2 of 6 albums See All The legendary exaltation point of Venus as delineated in the
12 houses of the horoscope along with mundane portents
Astrological for the next ascent of Venus into Pegasus. ...
Services
n to your horoscope as born from our experience in workingCreated
5 with
about
months ago
unknown regions of the zodiac!

Zodiacal July 21 at 10:11am · Comment · Like · Share


Design
Created about
5 months ago Klaudio Antonio Valentin Lucifer's arrival as predicted tothe
minute!

as delineated in the 12 houses of the horoscope along with Lucifer by Klaudio Zic (Book) in Self-Improvement
Venus into Pegasus. An exciting astrological report that will toss Source: www.lulu.com
Lucifer by Klaudio Zic (Book) in Self-Improvement : Venus is
the rebel of the zodiac as it climbs into Pegasus.

Video
2 videos See All

2 mundane as well individual houses of the horoscope.


July 19 at 9:29am · Comment · Like · Share

Klaudio Antonio Valentin What is yur true Sun sign?


Transparent Zodiac by Klaudio Zic (Book) in Self-Improvement
Source: www.lulu.com
Transparent Zodiac by Klaudio Zic (Book) in Self-Improvement : Sai Baba was born on
November 23rd with Sun in Libra. What about you?
July 16 at 8:22am · Comment · Like · Share
workshop as enlightened with Venus in Pegasus. The report
he most exalted zodiacal position of Venus.
Applications C
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology


  
 




%&  


     &
       &  



Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astr

Masonic Astrology (e-book)


Download: €22.16
A great Mason will have full Moon rising in Sextans. The initiation includes a complete set of practical
methods in instant magick.
Add Download to Cart    
 

  

Klaudio Zic - Complete Works 3 (e-book)


Download: €222.00
"()*+,#-
Seven major collections of treatises, essays and reports cover all facets of modern astrology at its roots,
from the Academic Zodiac, through the 16 Precessed Ascendants and towards the universal Cartesian house
system. A thousand pages reading includes a complete initiation in instant magick.
Add Download to Cart .  $ /&    
%        2&  
Academic Astrology Journal 2 (e-book)
  &  3&

Download: €7.77
An astronomical scan of the astrological skies frolics with life as Jupiter meets Neptune and Venus
congresses with Mars. Detailed scans of the major conjunctions in the year 2009 for the progressive
astrologer.Unique maps featuring all named and major transneptunian dwarf planets as they cluster in the
July skies. 4%.4#."*%54%.,%6-
Add Download to Cart

Amen Re - Zodiacal Commandments (e-book) 5


&     
 7  
Download: €22.20    
.    

The Zodiacal Commandments of Amen Re. << Brahma introduced a simplistic zodiac for his first initiates.
   82* 
The original instruction was to keep an update for precession, which was forgotten in time, as a fixed mind
found dubitable comfort in an unchanging model of the solar system. >> Third edition with the first
prophecy for the 2012.
Add Download to Cart
5   9 :   
3

 $   8     



"    $ 2      & 


Academic Astrology Journal 5 (e-book)
 $
& 
      2
Download: €5.55 /
 0     $    9

Get the latest boost in modern astrology with Sun in Orion  


    

 
$ 
(sic) and the summer solstice 2009.
Add Download to Cart

  .  
2 
   
  2 

  >.  8
   
A Short History of the Zodiac (e-book) &     $ ;.  
   %       
Download: €22.16
&
 

 
$ & 
 7
& ?&&
Is the Sun in Orion yet?
Add Download to Cart

  & < & & & 
2>"   &
   
 < 

 >
y

  !
 "

# #  $ 
  
  & 
 Klaudio Zic's Storefront - Lulu.com


Zodiacal Astrology (e-book)
Download: €16.22
The zodiac that rules the future of many was completely unknow
Add Download to Cart
rology

Objections to Fate in Modern Synastry (e-book)


Download: €72.60
All the wonders of instant magick and modern synastry as packe
your marriage in minutes. Determine the favorite wedding time o
rendering takes 20 minutes, then instant magick must manifest
the same. Marriage rendering initiation is a practical jewel in mo
$  '


 touch that will shatter the matrix.
Add Download to Cart

Futurendering (e-book)
Download: €59.41
Paint your blushing future rosy. Update your futurity according to
that dark transit. Your true horoscope is your own intent! Comple
Marriage Rendering Tools inside.

0 & 
 Add Download to Cart

 
 

2  


 $   

  Future Architecture (e-book)
Download: €59.41
Did you update your horoscope yet? Klaudio Zic introduces the re
and magick. The document features a complete initiation into pe
Add Download to Cart

Services by Klaudio Zic (e-book)


 *  
    &
Download: FREE
       $  Your horoscope as the original blueprint of your true natal skies d
want to model according to your master plan. Introduce new eve
tools, as you enjoy the sequence of your life according to your or
 
 &  7   
Download for Free

  &  $  2 


 
+ 
 


   Wheel Chart (e-book)
  
$ :    Download: €144.00
2& 
&&&
 +  Change your life from the hub of the wheel of time! Organize you

2   &
    ;4$  initiation in instant magick along with an introduction in modern

 5&  
 <  Add Download to Cart
 $    
 
  =  
$  
&

   

 Wishwheel Insider (e-book)


  & 

 9  Download: €120.00
&  < *  &
  8 Enter the inner temple of instant magick with this precious volum
&?
2  *
2  &
  
    
&


(    
Download: €66.84
We heard you say "If only I could divine
Klaudio Zic's Storefront - Lulu.com prosper."http://stores.lulu.com/ast
Well, there you have it! We up
astrology initiation. All the magick in the
speed astrology and instant magick, from
rendering.
Add Download to Cart
Love & Money (e-book)
Download: €20.09
Instant Magick (e-book)
Make your dream person fall in bed with you in minutes! Instant magick & Venus astrology as blended for
successful seduction.
Klaudio Seduce her time and-space
Zic's Storefront with our Instant Magickal Download:
Lulu.com Seduction methods
€29.99 while
selecting the best time to visit her Venus. Venus in Orion does not seem to be as sexy as Venus in Hydra is.
Start
RTRRT & sci-astrology team up in order to seduce partner impossible in record time!working out real magick in your da
based on clearing techniques such as O5
Add Download to Cart Master, the famous Personal Cosmic Sec
Masters
horoscope for Barack Obama. The full powerasofwell
theas initiations
Academic in practica
Zodiac as co
http://youtube.com/RTRRTV
techniques. Updated Obama assassination dates. Printable PDF with anima
20 Minutes Astrology (e-book) Add Download to Cart Add Download to Cart

Download: €20.00
Divine anybody's marriage in minutes with this basic yet sophisticated
ObamAssassination (e-book) manual in modern
RTRRTVIP astrology. Want to
(e-book)
know the year and month of anybody's marriage. Got a spare minute?
Add Download to Cart Download: €66.84 Download: €16.22
Do youalong
Failed attempts at Obama assassination, have with
Unicorn ascending
warnings in Presid
for the your
Add Download to Cart could make miracles"? With RTRRT, you
very day. Do not delay miracles in your
The Secret Mansions of the Moon (e-book) Instant personal magick as based on you
RTRR initiates.Get your true natal ascen
Download: €31.91
Add Download to Cart
6 out of 18 zodiacal constellations as occupied
Obamaby inthe
theMoon
Stars (e-book)
were completely obscure to astrologers until
this publication disclosed the delineation for the 6 secret positions of the Moon. Moon in Auriga defines the
22nd constellation of the zodiac. This publication
Download: resumes
€19.85all that we have learned in the past about the
special positions of the Moon. Future (e-book)
Changing Kithazard
Horoscope noir for Obama. Updated with assassination dates.
Add Download to Cart
Add Download to Cart
Download: €29.28
What good is predicting events when yo
initiation plus a complete course in futur
2007 OR10 ~ Update (multimedia download) starts manifesting while creating an eve
Obama (multimedia download)Add Download to Cart
Download: €59.41
Download:
Dozens of dwarf planets rule your horoscope! €59.41
Get ready for the challenges that haunt your natal chart from
beyond the realm of Neptune. Edition updated
2008 -for potential
2012 for theObama assassination
U.S.A. Obama dates and
assassination 2007 OR10.
update.
Add Download to Cart Add Download to Cart Matrix Hacking (e-book)

Download: €25.47
Hack the matrix in real time while manif
Obama in the Stars (multimedia download) Add Download to Cart
KKK (multimedia download)
Download: €9.07
Prevent Obama assassination update. Obama Download: €97.13
astrology takes a further step with this reference publication.
Detailed maps of the real sky, hints, precise
KKK NASA ephemeris
and the Americanfor Venus in Orion
apocalypse 2008and the standard
- 2012. Edition updated for potent
objectiveness of the Academic Zodiac. Our anddigital
2007 editions
OR10. combine printable PDF&with
Love animations.
Money - Seducing Partner Im
Add Download to Cart Add Download to Cart
Download: €42.66
How to make anyone fall in bed with you
energy that was entrapped within that b
Unihipili (e-book) USA (e-book) marriage event. >> At the time you like
Klaudio Zic's Storefront - Lulu.com like nuns. Taste is manipulated by the m
http://stores.lulu.com/astrol
Download: €20.09 Facebook
Download: €17.76| Klaudio Antonio initiation After all, the partner is not imp
Valentin
Horoscope noir for Obama. An alternativeThe
review of the of
ascendant inauguration
the USA is horoscope.
Serpens New dwarf
Cauda...
Add planet
Cart 2007
or Aquila.
Download to
OR10 inside. Add Download to Cart
Add Download to Cart
Home Profile Friends Inbox 588

Obama in the Stars 2007 OR10 (e-book)


(multimedia download) Klaudio Antonio Valen
Download: €20.09 Download: €20.07 Wall Info Photos
Dangerous gifts in dangerous times. WhyThe major dwarf
is Obama planets
risking his lifeare
andan important
when? factor
Updated in yourofhoroscope.
analysis the Premie
Add Download to Cart
What's on your mind?

Attach
Federal Reserve System and the Subprime Mortgage Crisis (multim
Download: €108.00 Klaudio Antonio Vale
View Videos of Me (3)
<< 1Th 5:3 For when they shall say, Peace and safety; then sudden destruE
Edit Mywith
travail upon a woman Profile
child; and they shall not escape. >> If the econS
S
E
http://lulu.com/astrology S
http://youtube.com/RTRRTV E
29 of 35 The 22 constellations of the
Academic Zodiac, 16 eastern
ascendants for the current
epoch and reality rendering.
RTRRT instant magick for
one.

Information about a minute ago · C


Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Buy | My Lulu | Community | Help Customize Storefront | Log Out | View Cart

* The Academic Zodiac consists in 22 zodiacal constellations.


* Which one of the 16 is your own true Eastern Ascendant?
* Change your personal future for the best right now!
* Render your own reality with the Reality Rendering Tools.
* Resolve economical crisis to your own favor.
* Protect your family, identity, horoscope and futurity from superstition!
* Render and establish personal prosperity forever.
* Catch up with the latest zodiacal upgrade.
* Render your own reality in minutes with the Real Time Reality Rendering Tools.

Cascade (e-book)
Download: €97.13
"Just paste yourself within an ideal situation and enjoy beforehand the quick issue that can not help but
materialize as soon as impossible." Complete RTRRT instant magick initiation inside!
Add Download to Cart

Horoscopelements (e-book)
Download: €16.22
Your new horoscope has some extra genuine elements in bright display. Like the original positions of your
natal planets. Better make some order in that seventh house as it is swarming with dwarf planets! A comet
there, a centaur here. Did we forget to mention the eastern ascendant?
Add Download to Cart

Astrology in Open Space (e-book)


Download: €22.16
As the universal Cartesian house system takes astrology beyond the polar regions and into outer space, the
board astrologer is operating within local zodiacs. >
Add Download to Cart

Zodiacal Conspiracy (e-book)


Download: €59.41

1 of 34 07/29/2009 10:57 AM
%X\_0\/XOX_&RPPXQLW\_+HOS /RJ,Q_9LHZ&DUW


7KH$FDGHPLF=RGLDFEHLQJEDVHGRQWKH5($/1$7$/6.<FRQVLVWVLQ&2167(//$7,2167KHQXPEHURIHDVWHUQDVFHQGDQWVKDV
SUHFHVVHGWR)UHHIURPDVWUDOLQIOXHQFHPRGHOWKHHYHQWVLQ\RXUOLIH$7:,//ZLWK\RXU57557

.ODXGLR=LFSUHVHQWVWKH$FDGHPLF=RGLDFDQG3UHFHVVHG$VFHQGDQWVHWIRUWKHHSRFK8QLYHUVDO&DUWHVLDQ1LJKW 'D\KRXVHV\VWHP
(ULVLVWKHPRGLILHUJHQHRIPRGHUQDVWURORJ\(ULVDQGWKHGZDUISODQHWVDVHQOLYHQHGZLWKLQWKH$&$'(0,&=2',$& SUHFHVVHG
DVFHQGDQWHQYLURQPHQW7KH$FDGHPLF=RGLDFFRQVLVWVRI,$8FRQVWHOODWLRQV7KHSUHFHVVHGDVFHQGDQWVHWIRUWKLVHSRFKFRQVLVWVRI
,$8FRQVWHOODWLRQV(ULV2UFXV6HGQD4XDRDU,[LRQDQG9DUXQDLQWKHKRXVHV'HOLQHDWLRQIRU)<WUDQVQHSWXQLDQJLDQW
(/DQGDOOPDMRU712ZLWK+6RSKLVWLFDWHGIXWXUHGHWHFWLRQFRXSOHGZLWKSHUVRQDOIXWXUHUHQGHULQJWRROV6WLOOVOXUSLQJIOLHVLQWKH
PDUVKHVDQGSRQGVRIDVWDOOHGWZRGLPHQVLRQDODVWURORJ\"8SJUDGHIURPIURJWRHDJOHZLWKVFLHQWLILFDVWURORJ\:DQWPRUHLQIR"
LVVXHV"8QVXUHRI\RXUQDWDODVFHQGDQW"LVVXHV"'DLO\ZRUULHV"8QVXUHRIGLYLQDWLRQ"7HOOLWWR\RXU3HUVRQDOF2PLF6HFUHWDU\

/RYH 0RQH\ HERRN 

'RZQORDG
0DNHORYH PRQH\,QVWDQWPDJLFN 9HQXVDVWURORJ\DVEOHQGHGIRUVXFFHVVIXOVHGXFWLRQ6HGXFHKHUWLPHDQGVSDFH
ZLWKRXU,QVWDQW0DJLFNDO6HGXFWLRQPHWKRGVZKLOHVHOHFWLQJWKHEHVWWLPHWRYLVLWKHU9HQXV9HQXVLQ2ULRQGRHVQRW
VHHPWREHDVVH[\DV9HQXVLQ+\GUDLV57557 VFLDVWURORJ\WHDPXSLQRUGHUWRVHGXFHSDUWQHULPSRVVLEOHLQ
UHFRUGWLPH

$'''2:1/2$'72&$57 

)DVW6HGXFWLRQ HERRN 

'RZQORDG
7KH57557VHUYHDV\RXUSHUVRQDO*(1,(DQGLQVWDQWPDJLFNPLQGV\VWHP7KHH[WHQGHGLQLWLDWLRQLQ)$67
6('8&7,21FRPHVSRZHUHGZLWKWKH0DUULDJH5HQGHULQJ7RROV20DVWHUDQGWKH3HUVRQDOF2PLF6HFUHWDU\<RX
ZLOOILQGDOOWKDW\RXHYHUQHHGHGWRSHUIRUP,167$170$*,&.LQ21(3$&.$*(%RQXV:LVKZKHHO0DMLN:DQG0DWUL[
&RPSXWHUDQG3&66WHSPHWKRGV6HGXFHWKH0DWUL[ZKLOHFUHDWLQJUHDOWLPHHYHQWVDFFRUGLQJWR\RXUPDJLFNDOZLOO
ZLWKWKH57557(QWHUWKHHQFKDQWHGIRUHVWRI,QVWDQW0DJLFNWKURXJKWKHZHEIURQWRIRXUGHQDW
KWWSZZZOXOXFRPDVWURORJ\

$'''2:1/2$'72&$57 

2,5,6 HERRN 

'RZQORDG
7DNH\RXUILUVWVWHSWRZDUGVWKHUHDOPRIWKHLPPRUWDOVZLWK2,5,6DQGWKH575577KH2,5,6LQLWLDWLRQLVDIXUWKHU
VWHSIURPLQVWDQW5755PDJLFNWRZDUGVSHUVRQDOLPPRUWDOLW\5755 70'7UXH0LQG'LVWLOOHUIRU20DVWHUVLQVLGH

$'''2:1/2$'72&$57 

/RYH 0RQH\ HERRN 

'RZQORDG
6HGXFHSDUWQHULPSRVVLEOHLQUHFRUGWLPH&RQTXHU\RXUSDUWQHU
VWLPHDQGVSDFHZLWKRXU,QVWDQW0DJLFNDO6HGXFWLRQ
PHWKRG0DNHORYH PRQH\

$'''2:1/2$'72&$57 

$VWURORJ\DQG0DJLFNIRU([FHSWLRQDO:RPHQ HERRN 

'RZQORDG
$VHGXFWLYHJXLGHWR\RXULQQHUSRZHUV/RYHVHGXFHDQGH[SDQG\RXUWUXHPLQGLQPLQXWHVZLWKWKH575577KH5HDO
7LPH5HDOLW\5HQGHULQJ7RROVDUHWKHLQVWDQWPDJLFNWKDWLVWUDQVIRUPLQJWKHSODQHW,WZRXOGVHHPWKDWZRPHQZLWKGXH
FRPSOLPHQWVDUHQRWLQDQ\QHHGRIDVWURORJ\DVWKH\SRVVHVVLQQDWHSHUVRQDOPDJLFNDQGFKDUP:KLOHLWPLJKWEH
HDV\WRFKDUPWKHPDOHDXGLHQFHWKHZRPDQPD\QHYHUWKHOHVVIDOOSUH\WRKHURZQFKDUPDVLIEHLQJVHGXFHGE\.DOL
RUEHLQJDQDVWURORJHU(ULVLQSHUVRQ7KLVVHULHVRISXEOLFDWLRQVZLOOPDNHDQH[FHSWLRQDOZRPDQDVWURORJHUDVZHOO
DVSULHVWHVVRIWKH$JHRI&HWXVIURPRXUUHDGHUV:RPHQDVWURORJHUVDUHZHOFRPHWRH[SORUHDQHZORYLQJZRUOGRI
UHIRUPHGDVWURORJ\ZLWK9HQXVVSDQQLQJWKURXJKQROHVVWKDQFRQVWHOODWLRQV8SWRQRZDQGGXHWRJURVV
VXSHUVWLWLRQ9HQXVZDVDOORZHGLQWRSRVLWLRQVRQO\,WLVTXLWHGLIIHUHQWZLWKRXU9HQXVLQ&HWXV  9HQXVLQ
2ULRQ  RUSUHVHQW9HQXVRQ+\GUD  

$'''2:1/2$'72&$57 

7UXH0LQG'LVWLOOHU HERRN 

'RZQORDG
7UXHPLQGLVWKHKHDOHU.QRZZKR\RXDUHQRWILUVWLQRUGHUWRNQRZZKR\RXDUH7KHPLQG\RXDUHXVLQJLVQRW\RXUVDW
DOO:KDWJRRGLVOLIHLI\RXGRQRWNQRZWUXHSHDFH"'LVWLOO\RXUPLQGZLWK7UXH0LQG'LVWLOOHU5HDO7LPH5HDOLW\
5HQGHULQJ7RROVLQVLGH*HWWKHXOWLPDWHLQLWLDWLRQLQLQVWDQWPDJLFNZLWKDWDVWHRIHWHUQLW\+HDO\RXU5HLNLPDVWHUZLWK
WKLVXSGDWHGYHUVLRQ$FDGHPLF=RGLDFLQVLGH

$'''2:1/2$'72&$57 

3HUVRQDO&RVPLF$YDWDU HERRN 

'RZQORDG
,QVWDQWPDJLFNLQLWLDWLRQWDNHVDIXUWKHUVWHS/HDUQKRZWRSURGXFHHIIHFWVLQWKHUHDOZRUOGLQUHDOWLPHQRZ

$'''2:1/2$'72&$57 

+HDOLQJ$VWURORJ\IRU5HLNL0DVWHUV HERRN 

'RZQORDG
7LPLQJDQGSRVLWLRQRIWKHSODQHWVIRUGRFWRUVLQWURGXFLQJSUHFHVVLRQLQFRUUHFWLQJWKHWZRVLJQPLVWDNH(XURSHDQ
GRFWRUVXVHGWRFXWWKHZURQJOHJRQDFFRXQWRIODFNRIFRUUHFWLRQIRUDVWURQRPLFDOSUHFHVVLRQ$FFRUGLQJWRWKHIDWKHURI
*UHHNPHGLFLQHLWLVWKHGXW\RIDQ\GRFWRUWRDFFXUDWHO\VFDQWKHSDWLHQW
VKRURVFRSHIRUUHWXUQLQJFDQFHU

$'''2:1/2$'72&$57 

3HUVRQDO&RVPLF6HFUHWDU\ HERRN 

'RZQORDG
<RXU3(5621$/&260,&6(&5(7$5<WDNHVDIXUWKHUVWHSDKHDG7KHXVXDOWKDWLVGHIDXOWRUHYHQRXWGDWHGZD\WR
GHDOZLWKWKH352%/(0LVWR5(62/9(,7,QORQHOLQHVVGRQRWIHHOORQHO\3HRSOHDUHRIWHQORQHO\LQHDFKRWKHU
V
FRPSDQ\ZKHQWKH\ODFN,17(*5$7,21ZLWKRQHVHOI7KHILIWKHOHPHQWLVSDFNHGLQEORRGDQGWKHUHIRUHVHPHQ
6XFNLQJRQH
VVSHUPLVVXFNLQJRQH
VEORRG,WLVQRWDWDOODIDYRU!!,17(*(5,1,7,$7,21RIIHUVDQHZZD\WRGHDO
ZLWKSUREOHPV%()25(SHUIRUPLQJSHUVRQDOPDJLFN1RWHYHU\RQHREWDLQHGLQWHJUDWLRQWKURXJKVH[,WLVYHU\GLIILFXOW
WRFRQWUROWKHVXEMHFWDVPDQ\DWDQWUDLQLWLDWHZLOONQRZ$VFRQFHUQPRGHUQ0DVRQU\WKHGLVDVVRFLDWHG/DG\ZRXOG
W\SLFDOO\UXQDZD\ZLWKWKHFDVKZKLOHWKHQRYHO0DVRQVZRXOGFRQWHPSODWHKHUGLYLQHFKDUDFWHUDQGPLVVLRQ!!,QVWDQW
PDJLFNPDNHVDVSLUDOVWHSDKHDGZLWK,17(*(5,1,7,$7,210DNHPLUDFOHVLQ\RXUGDLO\OLIHULJKWXSRQXQSDFNLQJWKLV
ODWHVW57557XSGDWH3(5621$/&260,&6(&5(7$5<LQVLGH

$'''2:1/2$'72&$57 

5HDO7LPH5HDOLW\5HQGHULQJ7RROV PXOWLPHGLDGRZQORDG

'RZQORDG
,QVWDQWPLUDFOHVDUHQRORQJHUDP\VWHU\DVWKHSODQHWDSSURDFKHVDILQDONDUPLFWXUQWRZDUGVLWVGHVWLQ\1RZDGD\V
HYHU\RQHFDQSHUIRUPLQVWDQWPDJLFNLQUHDOWLPHZLWKWKH5755,QLWLDWLRQ7KH57557DUHDSRZHUIXOLQLWLDWLRQV\VWHP
WKDWHQDEOHVWKHXVHULQWRFKDQJLQJRQH
VHQYLURQPHQWIXWXUHDQGIDWHDVUHDOLW\UHQGHULQJKDSSHQVLQUHDOWLPH 3')
SS

$'''2:1/2$'72&$57 

0RRQLSXODWLRQ HERRN 

'RZQORDG
7DNHRQHJLDQWOHDSIRUPDQNLQGEDFNLQRUGHUWRSUHSDUHIRUWKH1$6$PRRQQXNH7KHILUVWFRQWDFWKXPDQ
EHLQJVZRXOGKDYHKDGZLWKDQRWKHUZRUOGZRXOGKDYHEHHQWRH[SORGHDQXFOHDUERPE+DGWKH\JRQHDKHDGZH
ZRXOGQHYHUKDYHKDGWKHURPDQWLFLPDJHRI1HLO$UPVWURQJWDNLQJRQHJLDQWOHDSIRUPDQNLQG%RQXVHGLWLRQZLWK
FRSLRXV$FDGHPLF=RGLDF 57557DEVWUDFWV

$'''2:1/2$'72&$57 

$FDGHPLF=RGLDF(GLWRULDO-XO\WK PXOWLPHGLDGRZQORDG 

'RZQORDG)5((
,QGLJR$VWURORJ\IRUWKHJHQHUDWLRQRI3OXWRLQ&RPD%HUHQLFHV   $FDGHPLF=RGLDFHGLWRULDOIRUVXPPHU
HQMR\UHFUHDWLQJ\RXUIXWXULW\ZLWK57557DQG\RXUWUXHKRURVFRSH$IWHUVRPH\HDUVRIGDUNQHVVZHILQDOO\KDYHDQ
DFFXUDWH]RGLDFSUHFHVVHGDVFHQGDQWDQGXQLYHUVDOKRXVHV\VWHPEHVLGHVIXWXUH FKDQJLQJ5755WHFKQRORJ\
$WWHQWLRQPXOWLSOHILOHVFOLFNRQOLQNWRGRZQORDG$//),/(6*HW\RXUIUHHFRS\QRZ/LPLWHGHGLWLRQ
'RZQORDGIRU)UHH 

7KH/RUGRIWKH=RGLDF, HERRN 

'RZQORDG
UHDOLW\UHQGHULQJKDSSHQVLQWKHWLPHOHVVVHFRQGZKHQWKHPLQGLVVLOHQW6FLHQWLILFDVWURORJ\LVGHWULPHQWDOWRIDOVHHJR
DVSODQHWDU\H[RUFLVPLQWKHYLJLORI\HDU7KHUHDO]RGLDFKDVFRQVWHOODWLRQV7KHUHDUHDVFHQGDQWV
SUHVHQWO\ULVLQJDWHDVW

$'''2:1/2$'72&$57 

2O\PSLFV PXOWLPHGLDGRZQORDG

'RZQORDG
7KH2O\PSLFVRSHQZLWKDQHFOLSVHDQG&KLURQDSSURDFK$Q2O\PSLFWRUFKWKDWLVH[WLQJXLVKHGILYHWLPHVLQDVLQJOH
GD\7KHV\PEROLVPRI$QRYHUYLHZRIWKH2O\PSLFVDVVHHQE\WKHH\HRIPRGHUQDVWURORJ\:KDWGRHVWKHUHDOVN\
KDVWRVD\DERXWWKH2O\PSLFSODQHWV"1HZHGLWLRQXSGDWHGIRU&KLURQDSSURDFKHFOLSVHPLQXWH0RRQHSKHPHULV
:LWFKDOORZ&UXLWKQH$$DQG:5%HVLGHVWKH$FDGHPLF=RGLDFWKHDVWURQRPLFDOVWDQGDUGIRUWKLV
SXEOLFDWLRQIHDWXUHVWKHHDVWHUQSUHFHVVHGDVFHQGDQWDQG&DUWHVLDQKRXVHV\VWHP+RURVFRSHVIRU*HRUJLD,UDQ
5XVVLDWKH86$$XVWUDOLDDQG&KLQD

$'''2:1/2$'72&$57 

,QVWDQW0DJLFN HERRN 

'RZQORDG
7KHFRPSOHWHZRUNVRQSHUVRQDOPDJLFNIRUHYHU\RQH%DVHGRQFOHDULQJWHFKQLTXHVVXFKDV2WKH5HDO7LPH5HDOLW\
5HQGHULQJ7RROVLQFOXGH2,QLWLDWLRQ20DVWHUWKHIDPRXV3HUVRQDO&RVPLF6HFUHWDU\LQVWDQWPDJLFN6QRZ&UDVK
KLQWV7UXH0LQG'LVWLOOHUIRU20DVWHUVDQGPDQ\RWKHUDUWLFOHVRQSUDFWLFDOLQVWDQWPDJLFN

$'''2:1/2$'72&$57 

8UDQXVLQ&HWXV PXOWLPHGLDGRZQORDG 

'RZQORDG
$VWKH$JHRI&HWXVUHDFKHVLWVUDYDJLQJSHDNDVWURORJLFDOO\VSHDNLQJWKLVLVWKHILUVWWLPH8UDQXVLQ&HWXVLV
SUHVHQWHGWRWKHZLGHUSXEOLF&RXOGWKHP\VWHULRXVSRVLWLRQRIWKLVIDWDOSODQHWOLQNWRWKH0D\DQSURSKHF\"7KHHQGRI
DVWURORJ\DVZHNQRZLW$6752120,&=2',$&SUHFHVVHGDVFHQGDQWDQGERQXVUHDOLW\PDJLFNLQVLGH SS3')
/HWWHUIRUPDW

$'''2:1/2$'72&$57 

&HQWDXUVLQ0DJLFN PXOWLPHGLDGRZQORDG

'RZQORDG
7KHUHDUHWZRSDWKVRQHLVWKHEURDGZD\WRDXWRGHVWUXFWLRQZKLOHWKHRWKHULVDVQDUURZDVDVZRUG
VHGJH7KHILUVW
RQHLVEURDGO\DVVRFLDWHGZLWKIDOVHHJRZKLOHWKHRWKHUZDONVLQWUXHVHOI7KHFHQWDXUVDOORZEUHDNLQJIUHHIURPRXU
KDELWVERUHGRPDQGPHQWDOVODYHU\HYHQSK\VLFDOVXUURXQGLQJDQGVH[XDOWDERR:HOLYHLQFDJHVDQGDUHVXUURXQGHG
E\HYHQELJJHUFDJHVZKHUHFDUHHUPHDQVPDNLQJIRUDODUJHUFDJH7KHFHQWDXUVDUHIUHHIURPLQKLELWLRQDVWKH\
GHPDQGWUXHVHOIWUXHOLIHDQGDSDVVLRQDWHOLIHRIRXURZQ,QLQWLPDF\ZLWKWKHJHQHWLFDOPRWKHUVRIKXPDQNLQGZH
SUHVHQWWKHGHOLQHDWLRQIRUFHQWDXUHVV&KDULNORDQDVWURORJLFDOFHQWDXUHVVWKDWLVHVVHQWLDOIRUWKHZRUOGRIJODPRXU
WKHFDWZDONVH[V\PSDWK\DQGYRRGRR2XUFHQWDXUHDQVHULHVFRQWLQXHVZLWKWKHODWHVWDERXW&KDULNORDQGWKHDOLHQ
ULQJRIOLIHDVDQQRXQFHGLQWKH\HDU

$'''2:1/2$'72&$57 

$VFHQGDQWVIRU3URIHVVLRQDO$VWURORJHUV PXOWLPHGLDGRZQORDG

'RZQORDG
7KHFRQVWHOODWLRQVRIWKH$&$'(0,&=2',$&WKHHDVWHUQDVFHQGDQWV&DUWHVLDQKRXVHV\VWHP(ULVDQGDOOWKH
GZDUISODQHWV$FODVVLFLQVFLHQWLILFDVWURORJ\DVUHYLVHGIRUWKH\HDU57557LQVLGH

$'''2:1/2$'72&$57 

7KHWK1LJKW PXOWLPHGLDGRZQORDG

'RZQORDG
7KHWK1LJKW VWHOODUPDSVIRUSURIHVVLRQDODVWURORJHUV7KRXJKPD\KDYHRIIHUHGGLIIHUHQW]RGLDFDO
SX]]OHVSUHVHQWVDQHZW\SHRIJDPHVLQFHIRUWKHILUVWWLPHLQWKHKLVWRU\RIDVWURORJ\ZHKDYH/,)(ZLWKLQWKH
KRURVFRSH3ULPLWLYHOLIHKDVEHHQIRXQGLQWKHFRQVWHOODWLRQRI&HQWDXUXV&KDULNORLQ&HQWDXUXVWKXVEHFRPHVD
VRXJKWIRUSRVLWLRQZKHQLWFRPHVWR&217$&76DWXUQULVHVDWGXHHDVWDIWHU\HDUV'HWDLOHGPDSVRI3KRHEH
/RJRVFRQMXQFWLRQLQ/HR

$'''2:1/2$'72&$57 

=RGLDF1DYLJDWRU HERRN 

'RZQORDG
0HHWWKH,$8FRQVWHOODWLRQVRIWKH]RGLDF(VVHQWLDOUHIHUHQFHIRUWKHLQFLSLHQWDVWURORJHU7KHGRFXPHQWHQOLVWVWKH
]RGLDFDOFRQVWHOODWLRQVZLWKFRORUIXOH[DPSOHV6XQLQ/LEUDRQ1RYUG9HQXVLQ+\GUDDQG0RRQLQ2ULRQ
:7& DUHVRPHRIWKHH[DPSOHV%RQXVSUHFHVVHGDVFHQGDQWV

$'''2:1/2$'72&$57 

3HUVRQDO&RVPLF$YDWDU HERRN 

'RZQORDG
$QXSJUDGHLQSHUVRQDOPDJLFNWKDWUHVXPHVWKHPDJLFNDOUHOLJLRXVDVZHOODVKLVWRULFDOEDVLVIRULQVWDQWPDJLFN<RX
OHDUQHGKRZWRSHUIRUPLQVWDQWPDJLFNZLWKWKH3HUVRQDOF2PLF6HFUHWDU\QRZOHDUQZK\/HWWKH3&$ZRUNRXW
PLUDFOHVIRU\RXLQ\RXUGDLO\OLIH3DSHUSDJHV

$'''2:1/2$'72&$57 

3/27)25,17(//,*(1&(2872)62/$56<67(0 HERRN 

'RZQORDG
)/$9,7,+9+(7',66,3$17,6917+DUGO\DQ\SUHGLFWLYHVFLHQFHRIIHUVDVPXFKLQIRUPDWLRQDVWKHUHDGLO\
UHWULHYDEOHGDWDWKDWFDQEHGLVWLOOHGLQPLQXWHVIURPDVFLHQWLILFKRURVFRSH)ROORZLQJRQWKHWUDFHVRIWKHVHFUHWDJHQW
WKHWUHDWLVHLVDFRQWULEXWLRQWRVFLHQWLILFDVWURORJ\SUHGLFWLRQIRUWKH$JHRI&HWXV3UHGLFWE\9HQXVLQ6H[WDQV(ULV
LQ&HWXVDQG0RRQLQ2ULRQ'U-RKQ'HHWKHRULJLQDOZRXOGEHSURXGRIWKLVHVVD\7KHVFDQVLQFOXGHWKHYLFWRU\
RIWKH(QJOLVKIOHHWRYHUWKH,QYLQFLEOH$UPDGD2,5,6LQLWLDWLRQLQVLGH

$'''2:1/2$'72&$57 

5HDOLW\5HQGHULQJ HERRN 

'RZQORDG
/XNH $QGWKHVFULEHVDQGWKH3KDULVHHVEHJDQWRUHDVRQLQWKHLUPLQGVVD\LQJ :KRLVWKLVZKRVSHDNV
EODVSKHPLHV":KRLVDEOHWRIRUJLYHVLQVEXW*RGDORQH"6HOIIRUJLYHQHVVLPSURYHVHPRWLRQDOOLIH,IRQHGRHVQRW
IRUJLYHRQHVHOIKRZFDQ*RGIRUJLYHKLP"*XLOWFDQGHVWUR\\RXUOLIHDQGDIWHUOLIHDVZHOO)RUJLYH\RXUVHOIIRUJLYHJRG
DQGIRUJLYHWKHSRRUGHYLODQG\RXFDQVWHSLQWRWKHOLJKW__/LJKWZHLJKWZDUULRUVKDYHIRUJLYHQWKHPVHOYHV2QHLVIUHH
IURPDVWURORJLFDOLQIOXHQFH*RDQGGRQRWEODPH\RXUVHOI

$'''2:1/2$'72&$57 

)HGHUDO5HVHUYH6\VWHPDQGWKH6XESULPH0RUWJDJH&ULVLV PXOWLPHGLDGRZQORDG

'RZQORDG
7K)RUZKHQWKH\VKDOOVD\3HDFHDQGVDIHW\WKHQVXGGHQGHVWUXFWLRQFRPHWKXSRQWKHPDVWUDYDLOXSRQD
ZRPDQZLWKFKLOGDQGWKH\VKDOOQRWHVFDSH!! ,IWKHHFRQRPLFWUHQGVWXUQRXWXQH[SHFWHGO\DJDLQVW\RXLQWKH\HDUV
DQG\RXGLGQRWUHDGWKLVUHSRUW7KH)HGHUDO5HVHUYH6\VWHPIDFHVXQLTXHFKDOOHQJHVLQWKH\HDU
7KHGRFXPHQWLVDQXSGDWHRIWKH6XESULPH0RUWJDJHFULVLVSUHGLFWLRQVIRUWKH\HDUVWRFRPH

$'''2:1/2$'72&$57 

6XESULPH0RUWJDJH&ULVLV HERRN

'RZQORDG
6XESULPHPRUWJDJHFULVLVDVVHHQE\WKHDQDO\WLFH\HRIVFLHQWLILFSUHGLFWLRQ&ULVLVSHDNVIRUWKH\HDUVDQG
DVQHVWHGLQWKHPLGVWRIWKHDSRFDO\SWLFWLPHV± SS3') 

$'''2:1/2$'72&$57 

 PXOWLPHGLDGRZQORDG

'RZQORDG
0RRQQXNHXSGDWH1$6$VKRRWVDWWKH0RRQPLG6WDJLQJRIWKH,VODPLFHQGRIWKHZRUOGVFHQDULR6XUYLYRU
V
9DGHPHFXPIRUWKH8UDQXVLQ&HWXV9HQXVLQ+\GUDWKH$[LVRI(YLODQGWKHLUHIIHFWVRQVXESULPH:DWHU:DUV
DQG::3ODQHWRFHQWULF$VWURORJ\8UDQXVLQ&HWXV6XESULPH0RUWJDJH&ULVLV6FLHQWLILF$VWURORJ\$EVWUDFWVSOXV
7UXH0LQG'LVWLOOHURIWKH57557VXLWH6XUYLYDOSDFNDJHIRU\RXUSXOORXW'LVFUHDWH::ZLWKWKLVHVVHQWLDOUHDGLQJ
$'''2:1/2$'72&$57 

,&KLQJ$VSHFWDULDQRQWKH7UHHRI/LIH HERRN

'RZQORDG
,&KLQJIRUDVWURORJHUVZLWKDVLQWHJUDWHGZLWKLQWKH7UHHRI/LIH7KHSUHFHVVHGDVFHQGDQWVDUHVXSSOLHGLQWKH
DSSHQGL[

$'''2:1/2$'72&$57 

/,/,79(5$RU&DVVLQL/LOLWK HERRN

'RZQORDG
(DUWK
VRULJLQDOIRUELGGHQPRRQDVREVHUYHG VLF E\&DVVLQLLWVRFFXOWVLGHDVWURORJ\E\DVSHFWKRXVHDQGVLJQ

$'''2:1/2$'72&$57 

0RGHUQ$VWURORJ\ PXOWLPHGLDGRZQORDG

'RZQORDG
³0RGHUQ$VWURORJ\´E\.ODXGLR=LFLVWKHFRPSOHWHUHIHUHQFHJXLGHWRFRQWHPSRUDU\VFLHQWLILFDVWURORJ\7KHJUDSKLFDO
UHSUHVHQWDWLRQVSKLORVRSK\DQGDEVWUDFWVGHILQHWKH]RGLDFDOFRPSRQHQWRIPRGHUQDVWURORJ\)URP
ZZZOXOXFRPDVWURORJ\WKHKRPHRIWKH$&$'(0,&=2',$&7KHTXLFNHQLQJVSLUDORIHYROXWLRQIXQQHOVKXPDQLW\
WRZDUGVLWVGHVWLQHGKRUL]RQVDVFKDUWHGZLWKLQWKH1LJKW 'D\KRXVHV\VWHPDQG35(&(66('$6&(1'$176(7
3')SS

$'''2:1/2$'72&$57 

2FFXOW=RGLDF HERRN

'RZQORDG
7KH]RGLDFKDGVLJQV1RZLWKDV7KHUHZHUHDVFHQGDQWV1RZWKHUHDUH/HDUQ\RXUWUXHHDVWHUQ
DVFHQGDQWRQHRIWKHIRUWKHSUHVHQWHSRFK6WXG\WKHDFDGHPLF]RGLDFWKHP\VWHULRXVFRGHWKDWFKDQJHG\RXU
SHUVRQDODVWURORJ\DVZHOODVWKHIDWHRIKXPDQNLQGIRUHYHU

$'''2:1/2$'72&$57 

,OEXFRGHOOHVWUHJKH HERRN

'RZQORDG
&
qXQEXFRQHOWXRRURVFRSR,OEXFRSXRVLJQLILFDUHXQDYLDG
XVFLWDPDDQFKHXQSRVWRGLSHUGLWH1HOEXFRF
qGD
SHUGHUHSHUJXDGDJQDUHFRPHVLHGLYHUVDPHQWHGLPRVWUDWRQHLFDVLGLDPRULIDOVLFKHHUDPHJOLRODVFLDUDQGDUHSRL
VXVVHJXLWLGDDPRULYHUL

$'''2:1/2$'72&$57 

2EVHUYHURI7LPHV PXOWLPHGLDGRZQORDG

'RZQORDG
7DNHPHWRWKHFKXUFKRQ7,0(7KH$&$'(0,&=2',$&HQDEOHVWKHSUHFLVHGHWHUPLQDWLRQRI\RXUORYLQJIXWXUHEXWWKH
57557DOORZRQHWR&+$1*(WKH&2856(RI(9(1767KHWUHDWLVHV\QFKURQL]HV)8785(&+$1*,1*ZLWK)8785(
6&$11,1*LQV\QFZLWKRQH
VUHOLJLRXVURRWV:KHQLWLVLPPHGLDWHO\SRVVLEOHWRSURGXFH,167$170,5$&/(6LWLVRQO\
QDWXUDOWRGRVR7KH5($/7,0(5($/,7<5(1'(5,1*722/6IHDWXUHWKH0$55,$*(5(1'(5,1*:,=$5'3HUVRQDO
&RVPLF6HFUHWDU\2,QLWLDWLRQ0RQH\+RQH\:LVKZKHHO&DVFDGH,QWHJHU0DJLF:DQG0DWUL[3URJUDPPLQJ
&RPSXWHU,QWHUIDFHDQG7UXH0LQG'LVWLOOHU,WLVGLIILFXOWWRGLIIHUHQWLDWHEHWZHHQSUHGLFWLRQDQGHOHFWLRQDVWKHWZR
ILQDOO\FRQYHUJHWRZDUGVHDFKRWKHUWKURXJKWKHWXQQHORIWLPH!!57557LQVLGH /HWWHUIRUPDW3')SS

$'''2:1/2$'72&$57 

6FDUOHW HERRN

'RZQORDG
7KHJUHDWDVWURQRPLFGLVFRYHULHVRIRXUWLPHFRQILUPWRWKHDSRFDO\SWLFVFHQDULRIRUWKHSODQHW:K\GRZHVWDUH
VSHHFKOHVVLQWRWKHJUHDWKROHLQWKHVN\":K\ZDV(ULVGLVFRYHUHGDWWKLVWLPH":KDWGRWKHJLDQWFRPHWVSRUWHQG"
:KDWLVWKHH[DFWGDWHRIWKH$UPDJHGGRQ"0RXWKDJDSHDWWKHQRQVFLHQWLILFVN\WKHVFLHQWLVWVGLVFRYHUREMHFWVDQG
SKHQRPHQDWKDWWKH\MXVWFDQ
WH[SODLQ6FLHQWLILFDVWURORJ\ZLWKLWVDFDGHPLF]RGLDFKDVWKHDQVZHUVDVXSKHOGE\WKH
%LEOHXSWRVRPHSRLQWLQWLPH

$'''2:1/2$'72&$57 
:LWFKROORZ*HQHVLV HERRN 

'RZQORDG
7KH(ULGDQXVVXSHUYRLGH[SRVLQJ-RKQ&UDLJ9HQWHU:KDWGRHVWKHVXSHUYRLGUHYHDOIRURXUJHQHWLFIXWXUH"7KHFORQH
ZDUVKDYHRQO\MXVWEHJXQ$[LVRI(YLOLQVLGH

$'''2:1/2$'72&$57 

0DUULDJH5HQGHULQJ7RROV HERRN 

'RZQORDG
+HOS\RXUVHOIWR\RXULGHDOPDUULDJHSDUWQHU(DWWKHZLWFKZKLOHUHQGHULQJ\RXUSHUIHFWPDUULDJH7KH0DUULDJH
5HQGHULQJ:L]DUGLVDIXUWKHUVWHSDQGDSSOLFDWLRQZLWKLQWKH57557V\VWHPRILQVWDQWPDJLFNIRUHYHU\RQH*HWULGRI
WKH:LWFKWKDWZLOOWU\DQGVSRLOWKH0DUULDJHDQGOLYHKDSSLO\HYHUDIWHU7KH57557ZLOOHQDEOHWKHGLVFUHDWLRQRIIDOVH
HJRZKLFKLVDWWKHFRUHRIODFNRIVXFFHVVLQOLIH)UHXGGLGQRWNQRZLWQRZ\RXGR)UHXGWKRXJKWRUKLVRZQ
SV\FKH ZKLFKZLOOURYHWREHQRWDWDOOKLVRZQ WKRXJKWVR)UHXG
VSV\FKHWKRXJKWLWFDQH[SORUHLWVHOI7KHSV\FKH
FDQQRWGRVRDQGHYHQLILWFRXOGZHZRXOGQRWSURILWDVWKHSV\FKHLVDOLHQWRPDQDQGQRWSDUWRILWVPDMLNDOEHLQJDWDOO 
7KHSDFNDJHFRQWDLQVWKHFRPSOHWH220DVWHU&DVFDGH0DMLN:DQGDQG3HUVRQDO&RVPLF6HFUHWDU\LQLWLDWLRQ
57557LQVLGH

$'''2:1/2$'72&$57 

,QVWDQW0DJLFN)RU&KULVWLDQV HERRN 

'RZQORDG
1RZWKDW\RXVDWLVILHG\RXUZRUOGO\ZLVKHV\RXFDQVHW\RXUVRXOIUHH$GGUHVVLQJ*RGLVDSHUVRQDOQHHG7KH5HDO
7LPH5HDOLW\5HQGHULQJ7RROVSURYHWREHPRUHWKDQPHUHLQVWDQWPDJLFNIRUHYHU\RQHDVGDLO\SUDFWLFHRIIHUVGHHS
IXOILOOPHQWWRWKHVRXODVZHOODVOLEHUDWLRQIURPPDWHULDOERQGDJH7KLVHGLWLRQFRQWDLQVWKHFRPSOHWH&KULVWLDQ
$VWURORJ\IRUWKH\HDUDQGWRZDUGVWKH1HZ$JH,QWUDXWHULQHEDSWLVPLQVLGHDORQJZLWKDFRPPHQWRQWKH-HVXV
7RPE5DLGHUV

$'''2:1/2$'72&$57 

7KH6HFUHW0DQVLRQVRIWKH0RRQ HERRN 

'RZQORDG
RXWRI]RGLDFDOFRQVWHOODWLRQVDVRFFXSLHGE\WKH0RRQZHUHFRPSOHWHO\REVFXUHWRDVWURORJHUVXQWLOWKLV
SXEOLFDWLRQGLVFORVHGWKHGHOLQHDWLRQIRUWKHVHFUHWSRVLWLRQVRIWKH0RRQ 7KH0RRQFDQUHVLGHLQSHFXOLDUSRVLWLRQV
DFFRUGLQJWRWKH,$8VWDQGDUGVWKDWUHJXODWHRXUFXUUHQWDVWURQRPLFDOFDOFXODWLRQV7KXV0RRQLQ$XULJDGHILQHVWKH
QGFRQVWHOODWLRQRIWKH]RGLDF7KHIROORZLQJSXEOLFDWLRQUHVXPHVDOOWKDWZHKDYHOHDUQHGLQWKHSDVWDERXWWKH
VSHFLDOSRVLWLRQVRIWKH0RRQ7KHH[DPSOHVLQFOXGH ZLWK0RRQLQ2ULRQ$VSHFLDOFKDSWHUKDVEHHQGHGLFDWHGWR
WKHOXQDWLRQVLQWKH\HDURIWKH$QWLFKULVWZLWK9HQXVLQ+\GUDDQGYDULRXVO\RPLQRXVDVVFDQQHGRQFH
DJDLQIRU1<&

$'''2:1/2$'72&$57 

0RRQ(SKHPHULV HERRN 

'RZQORDG
0RRQHSKHPHULGHVWKURXJKWKH,$8FRQVWHOODWLRQVRQHGD\VWHSRQHKRXUVWHS0RYHZLWK
0RRQLQ$XULJDEXWVHWWOHZLWK0RRQLQ6H[WDQV,GHDOIRUUHDOHVWDWHDVWURORJHUV

$'''2:1/2$'72&$57 

0HUFXU\(SKHPHULV HERRN 

'RZQORDG
7KHVFLHQWLILFHSKHPHULVIRU0HUFXU\LQFOXGHV]RGLDFDOSRVLWLRQVVXFKDV0HUFXU\LQ2ULRQ

$'''2:1/2$'72&$57 

7KH6HFUHW0HUFXULDO=RGLDF HERRN 

'RZQORDG
9HQXVZDOORZVWKURXJKFRQVWHOODWLRQVZKLOHWKH0RRQVSDQVWKURXJK,$8PDQVLRQV%XWZKDWDERXW0HUFXU\"
0HUFXU\VSHQGVLWVVXPPHUKROLGD\VLQWKH]RGLDFDOFRQVWHOODWLRQRI2ULRQ 0HUFXU\LQ2ULRQ2QHWKURZVDVLOYHUFRLQLQ
WKHDOFKHPLFDOZHOODQGDOOGUHDPVFRPHWUXH6RPHWLPHVDIURJMXPSVRXWRIWKHZHOOLQRUGHUIRUWKHSULQFHVVWRNLVVLW
VXFKDVLQWKHFDVHRI/DG\'LDQD)UDQFHV6SHQFHUZKRKDG0HUFXU\LQ2ULRQ
$'''2:1/2$'72&$57 

5HSWLOLDQ$VWURORJ\,, HERRN 

'RZQORDG
5HSWLOLDQFRXSOHVDUHFRRO6KHKDV9HQXVULVLQJLQ+\GUDZKLOHKLVRZQ9HQXVVHWVLQ2SKLXFKXV$UH\RXUHSWLOLDQOLNH
WKH86$"7KH86$KDVWKH7DLORIWKH6QDNH 6HUSHQV&DXGD DVFHQGLQJLQWKHKRURVFRSHRIWKHQDWLRQ

$'''2:1/2$'72&$57 

$VFHQGDQWVLQ$VWURORJ\ HERRN 

'RZQORDG
7KH,$8DVFHQGDQWVDUHDOVRFDOOHGWKHSUHFHVVHGRUGXHHDVWHUQDVFHQGDQWV

$'''2:1/2$'72&$57 

*HQHVLV$VFHQGDQW HERRN 

'RZQORDG
7KHWUXHDVWURQRPLFDVFHQGDQWRIWKH86$LVWKHVDPHDVWKHDVFHQGDQWRI*RG
VFUHDWLRQ 7KHFRQVWHOODWLRQRI$TXLOD
LVULVLQJLQWKHKRURVFRSHRIWKH&UHDWLRQRI<DKZHK:KDWDVXEOLPHWLPHWRFHOHEUDWHWKHELUWKRIDQHZQDWLRQZLWKWKH
RULJLQDODVFHQGDQWRIWKH*HQHVLV$TXLODWKHUHIRUHFRLQFLGHVZLWKWKHWUDGLWLRQDO+HEUHZDVFHQGDQWRIWKHORFDO
XQLYHUVHRI%UDKPDRU,+9+

$'''2:1/2$'72&$57 

5HDO7LPH5HDOLW\5HQGHULQJ7RROV HERRN 

'RZQORDG
:KHUHKDYHWKHLQVWDQWPDJLFNWRROVEHHQWHVWHGDQGSURYHQDVIDVWDQGUHOLDEOHPDJLFN"  2KDVFKDQJHGPDQ\D
VLWXDWLRQLQWRIDYRUDEOHLQUHFRUGWLPH 3HRSOHKDYHIRXQGMREVZLWK2LQVSLWHRIPHUFLOHVVFRPSHWLWLRQ  2KDV
VDYHGDFRPPDQGRLQZDU  2KDVFXUHGFDQFHU 2KHOSHGZLWKH[DPV 2KHOSHGZLWKWUXHORYH:KDWDUHWKH
OLPLWVRIWKHUHDOLW\UHQGHULQJWRROV" :HGRQ
WNQRZLW\HW:HH[SHULPHQWHGWKURXJK\HDUVDQGQROLPLWZDVVHWDV\HW
7KLVPHDQVWKDWWKHUHDUHQROLPLWVWRZKDW\RXFDQGRZLWKWKH57557LQUHFRUGWLPHZKHUHUHFRUGWLPHXVXDOO\
VWDQGVIRUPLQXWHVKRXUVRUGD\V7LPLQJPD\RUPD\QRWGHSHQGRQKRZFOHDU\RXDUH5HDVRQDEO\IDVWUHVXOWVFDQ
EHSURGXFHGE\PRVWO\HYHU\RQH

$'''2:1/2$'72&$57 

1HZ=RGLDFIRUWKH1HZ$JH HERRN 

'RZQORDG
7KH]RGLDFKDVFRQVWHOODWLRQV7KHUHDUHHDVWHUQDVFHQGDQWV7KH\HDUVXUSULVHVWKHDVWURORJHUZLWKWKH
UDUHSKHQRPHQRQRI9HQXVLQ+\GUDDORQJZLWKGRPLQDQW-XSLWHULQ2SKLXFKXVDVUHSUHVHQWLQJWKHPHVVLDKDQGWKH
$QWLFKULVWILJKWLQJWKHLUILQDOEDWWOHIRUWKHSODQHW%RQXV5HDO7LPH5HDOLW\5HQGHULQJ7RROVDJDLQVWDQ\EDGWUDQVLWVDQG
WRZDUGVWKHIXWXUHRI\RXUGUHDPV6WDWHRIDUWVFLHQWLILFDVWURORJ\IRUWKH\HDU(ULVLQVLGH

$'''2:1/2$'72&$57 

6XEFRQVFLRXV$VFHQGDQWV HERRN 

'RZQORDG
7KHSUHVHQWDVFHQGDQWVHWVSHDNVODQJXDJHV6RPHRIWKRVHDUHVXEOLPLQDOPHVVDJHV6XEPHUJHLQWRWKHVHFUHWV
RIWKHVXEOLPLQDODVFHQGDQWVDQGVXEFRQVFLRXV]RGLDFDOVWDWLRQV7KLVSXEOLFDWLRQLVDIXUWKHULQYLWDWLRQLQWRWKH
DFDGHPLF]RGLDFDVZHOODVWKHILQDOUHILQHPHQWRIWKHDVFHQGDQWVHWIRUWKHFXUUHQWHSRFK$OLFHKDVPRRQULVLQJLQ
&HWXV0HUFXU\LQ6H[WDQV9HQXVLQ2ULRQ-XQRLQ6FXWXPDQG3OXWRLQ6HUSHQV&DXGD:KDWDUH\RXUWUXHSODQHWDU\
SRVLWLRQVLQWKHKRURVFRSH",V\RXUDVFHQGDQWVXEFRQVFLRXVWRR"

$'''2:1/2$'72&$57 

5HDO7LPH5HDOLW\5HQGHULQJ7RROV PXOWLPHGLDGRZQORDG

'RZQORDG
7KHLGHDOUHDGLQJIRUWKHDSRFDO\SVH:HNQRZ\RXZLOOGLJWKLV7KH5($/7,0(5($/,7<5(1'(5,1*722/6FRPH
HTXLSSHGZLWK%LEOHDEVWUDFWVDQG ,167$170$*,&.IRUHYHU\RQH:HNQRZZKDW\RX
OOEHUHDGLQJRQWKH/DWWHU'D\

$'''2:1/2$'72&$57 
3HUVRQDO0DJLFN HERRN 

'RZQORDG
$OOZLVKHVFRPHLQVWDQWO\WUXHLQDFTXLULQJDQHZLGHQWLW\DVEDVHGRQ5($/,7<5(1'(5,1*DQGWKH$&$'(0,&
=2',$&

$'''2:1/2$'72&$57 

(ULV PXOWLPHGLDGRZQORDG

'RZQORDG
%DVLF3')SSZHEVLWH2XU8%DQGWKH³;=RGLDF´VROGDVHDUO\DV$XJXVWVWDQDEVROXWH
UHFRUGDVFRQFHUQDVWURORJLFDOLQGXVWU\7KHGRZQORDGKHUHSUHVHQWHGLVWKHRULJLQDO(ULVZHEVLWHZLWK3')PDWHULDO$W
WKHWLPHZHDVVXPHGWKDWRXUUHDGHUVWUDQVFHQG+70/IRUPDW7KLVHGLWLRQXSGDWHGIRU'XUJDDYDWDUDEDE\ZLWKWZR
IDFHVERUQZLWK(ULVVXQFRQMXQFWLRQ%RQXV(ULVLQFRQMXQFWLRQ7;DQG1,%,585(6($5&+7KHRXWHU
JXDUGLDQVDUHREMHFWVZLWKH[WUHPHO\ORQJSHULRGEXWVWLOOSHUWDLQLQJWRRXUVRODUV\VWHP

$'''2:1/2$'72&$57 

(ULV&RQVWHOODWLRQV HERRN

'RZQORDG
(ULVWKURXJK,$8&RQVWHOODWLRQVZLWK1$6$(SKHPHULGHV7KHSUHVHQWGRFXPHQWLVDUHPLQGHUDVZHOODVPDSIRUWKRVH
ZKRDUHQHZWR(ULVDQGWKH;]RGLDF'HDOLQJZLWK(ULVLQ3KRHQL[6FXOSWRURU7XFDQDLVKDUGO\DQHDV\WDVNIRUD
QRYLFH:HKRSHRXUSXEOLFDWLRQVKHOSGHWHUPLQLQJWKHUHDOSRVLWLRQRI(ULVLQDQ\KRURVFRSH$OORXUSXEOLFDWLRQV
FRQWDLQ8%(ULVDQGFDQEHXVHGDVUHIHUHQFHLQFDVHRIGRXEWDVWRWKHSRVLWLRQRI(ULVLQWKHKRURVFRSHRI
WKH86$RUDWWKHWLPHRI-HVXV&KULVW2QHZLOOQRWLFHWKDW(ULVLVQRWDWDOOLQ$ULHVEXWLQ&HWXV7KHSDVWJHQHUDWLRQV
KDG(ULVLQ6FXOSWRURU3KRHQL[(ULVFRYHUVERWKFLUFXPSRODUUHJLRQVDQGFDQWKXVEHIRXQGLQH[RWLFFRQVWHOODWLRQV
VXFKDV,QGXV:HDUHVXUHWKDWWKH$XVWUDOLDQDVWURORJHUZLOOJUHHW(ULVDVWKHLURZQGZDUISODQHWVLQFHLWPRYHV
WKURXJKWKHIDPLOLDUFRQVWHOODWLRQVOLNH7XFDQDRU*UXV

$'''2:1/2$'72&$57 

6OD\LQJWKH'UDJRQ PXOWLPHGLDGRZQORDG

'RZQORDG
7KHVHFUHWKRURVFRSHVIRU*HRUJLD,UDQ5XVVLDDQGWKH86$ 3') $FWXDO&KLURQFORVHXSPDSIRUWKH86$:KDWLV
UHDOO\JRLQJRQLQWKHSROLWLFDOVN\EHKLQGWKHEDFNRI\RXUIDYRULWHDVWURORJHU"

$'''2:1/2$'72&$57 

(ULVLQ/RYHDQG:DU,, HERRN

'RZQORDG
(ULVFRPHVLQKHDY\GRVHV7KLVKXJHFROOHFWLRQUHVXPHVDOOWKDWZDVHYHUSXEOLVKHGDERXW(ULV'ZDUISODQHWV
DVWURQRPLF]RGLDF;]RGLDFDVZHOODVSUHFHVVHGDVFHQGDQWLQVLGH'LVSHORPLQRXVWUDQVLWVDQGFKDQJH\RXUIXWXUH
ZLWKERQXV5HDO7LPH5HDOLW\5HQGHULQJ7RROV

$'''2:1/2$'72&$57 

:LVKZKHHO HERRN

'RZQORDG
:LVKZHOOZLWK\RXUZLVKZKHHO(YHUKDGDZLVKFRPHWUXHLQUHFRUGWLPH"7XUQWKHZKHHORIIRUWXQH\RXUZD\ZLWKWKH
5HDO7LPH5HDOLW\5HQGHULQJ7RROV7KHSDFNDJHFRQWDLQVDOOWKH57557DORQJZLWKWKH:,6+:+((/WKDWKHOSV
RUJDQL]LQJ\RXUZLVKHVHVSHFLDOO\DVSURFHVVHGE\\RXURZQ3HUVRQDO&RVPLF6HFUHWDU\2)XWXUHFKDQJHUDQG
&DVFDGHLQVLGH *HQ$QGWKHVHUSHQWVDLGXQWRWKHZRPDQ<HVKDOOQRWVXUHO\GLH 7KHHLJKWKRXVHLVH[HUWLQJ
RQH
VHQHUJLHVWRWKHH[WUHPHLQORYHZDUDQGVSRUW

$'''2:1/2$'72&$57 

:DWHU:DUV  PXOWLPHGLDGRZQORDG

'RZQORDG
:DWHUZDULVVXHVZRXOGVRXQGH[DJJHUDWHGWRZDUGV\HDUZKHQZHVWDUWHGRXU9DUXQDGHOLQHDWLRQSUHFLVHO\ZLWK
³ZDWHUZDUV´9DUXQDZDVVWLOODQXQQDPHGREMHFWEH\RQG1HSWXQHWKDWFRXOGQRWSRVVLEO\DFFRXQWIRU³MLKDG ´RU³ZDWHU
ZDUV´,QVWHDGWKH:7&KDSSHQHGWKHQ,UDTDQGDVFRQFHUQZDWHUWKHUHLVDOUHDG\KD]DUGIRURYHUPLOOLRQ
$PHULFDQV%DFNLQWKH\HDUWKH³ZDWHUHFRORJ\RIWKHVRODUV\VWHP´ZDVKDUGO\DQLVVXHEXWLQWKH\HDUZH
KDYHWKHZKROHHFRORJLFSLFWXUHLQIRFXVWKURXJKRXUZDWHUOHQV2RURLOOHQVFDQNHHSRXU$FDGHPLF=RGLDFIRFXVHGRQ
WKHWKLUGVLJLORIWKHDSRFDO\SVHDQG0LGGOH(DVWLVVXHVEXWLWLVWKURXJKWKHZDWHUOHQVWKDWWKHIXWXUHRIWKHSODQHWLV
GHWHUPLQHG:HGRQ
WNQRZWKHH[DFWSHUFHQWDJHRIKD]DUGEHFDXVHQRWDOOZDWHUVKDYHEHHQWHVWHGDJDLQVWGUXJ
SROOXWLRQ
$'''2:1/2$'72&$57 

7KH$[LVRI(YLO HERRN 

'RZQORDG
$VWKHVXSHUYRLGVKDXQWDVWURORJ\DORQJWKH$[LVRI(YLOWKHUHDGHULVWRVVHGIURP(ULGDQXVWR%RRWHVIURP,UDQWRWKH
86$DQGIURPIORZHUSRZHUWRSXQN([SORUHWKH%RRWHVVXSHUYRLGDVJXLGHGE\3OXWRLQ%RRWHVLQVSHFWWKHGHSWKRI
WKHFRVPLFUDEELWKROH*HWDUHYLHZRIWKHVXESULPHPRUWJDJHFULVLVDVVFUXWLQL]HGE\WKH$FDGHPLF=RGLDFZKLOH\RX
WUXHPLQGLVGLVWLOOHGWKURXJKE\SHUVRQDOPDJLFLQLWLDWLRQ7KHSRVLWLYHPLQGYRLGFUHDWHVDQXQLYHUVHDFFRUGLQJWR\RXU
GHHSHVWZLVKHV'RZQORDGWKHUHDOOLIHVWRU\RI\RXUFKRLFHIURPWKHFRVPLFUDEELWKROHDQGOLYH\RXUOLIHWRWKHIXOOHVW 

$'''2:1/2$'72&$57 

:RUPZRRG PXOWLPHGLDGRZQORDG

'RZQORDG
9DUXQDDQGWKH:DWHU:DUV*LDQWFRPHWVWKHJUHDWKROHLQWKHVN\DQGELEOLFDO7KHILQDQFLDODQG
HFRQRPLFDODSRFDO\SVHPHHWZLWKWKH0D\DQDVWKHVXESULPHPRUWJDJHFULVLVFRXSOHVZLWKJOREDOZDWHUZDUV$
VHULHVRIDEVWUDFWVLVGHGLFDWHGWRWKH57557WKH$FDGHPLF=RGLDFDQGSUHFHVVHGDVFHQGDQWVHW7KHERQXVLQLWLDWLRQ
LQWR\RXURZQ3HUVRQDO&RVPLF$YDWDUZLOOKHOS\RXGLVFUHDWHEDGDVWURORJ\ZKLOHFKDQJLQJHYHQWKHZRUVWLPDJLQDEOH
SHUVRQDOIXWXUHLQWRKHDYHQ&RPSOHWH57557LQVLGH 3')

$'''2:1/2$'72&$57 

 PXOWLPHGLDGRZQORDG

'RZQORDG
<RXURZQSUDFWLFDORPQLSRWHQFHLVMXVWDSDUWRIWKHUHSRUWWRHQMR\6LWEDFNDQGIHHOXSGDWHGIRUHYHUZLWKWKLVYROXPH
<RXDUHUHDGLQJWKHPDLQUHIHUHQFHIRUWKHJOREDOHYHQWVWRFRPH:KDWGRHVWKHZLPPHGLDWHIXWXUHKROG":KDWGRHVLW
PHDQWR\RX"+RZGR\RXHYROYHLQRUGHUWRPHHWWKH\HDU"ZLWK8UDQXVLQ&HWXVDQG&KDULNORLQ/XSXVLV
RXUVHOHFWHG\HDUIRUWKHJUHDWHYHQWVWRKDSSHQDFFRUGLQJWRWKH0D\DQFDOFXOXVDQGWKH$SRFDO\SVH7KHSLYRW\HDUV
WKDWKDYHWKHPD[LPXPSRWHQWLDOIRUWKHVHDOVWRRSHQDUHDQG6FLHQWLILFDVWURORJ\NQRZV
ZK\DQGWKH$&$'(0,&=2',$&PDNHVLWSODLQ8UDQXVLQ&HWXV1$6$EDVHGDVWURORJ\:0$3FROGVSRW:LWFKDOORZ
57557*UDSKVDEVWUDFWVDQLPDWHGHSKHPHULVIDFWV1$6$OLVWLQJDQGUHDOLW\PDJLFNIRUWKH7RH[SHULHQFHWKH
SRVLWLYHVLGHRIWKHDSRFDO\SVHLVSHUXVLQJWKHGRFXPHQWVWKDW\RXKDYHMXVWGRZQORDGHG

$'''2:1/2$'72&$57 

7KH$JHRI&HWXV PXOWLPHGLDGRZQORDG

'RZQORDG
7KH$JHRI&HWXVLVDWLWVSHDNDVGHILQHGE\SUHFHVVLRQ:KDWLVLQVWRFNIRUWKH\HDUVDKHDGDVEDVHGRQWKH
DVWURQRPLFDVZHOODVELEOLFDORPHQV"&HWXVLVRQHRIWKHODUJHVWIURPWKHFRQVWHOODWLRQVRIWKH$&$'(0,&=2',$&
EHVLGHVEHLQJDQ($67(51$6&(1'$17RQHRIWKHIRUWKHSUHVHQWHSRFK

$'''2:1/2$'72&$57 

6FDUOHW PXOWLPHGLDGRZQORDG

'RZQORDG
5HGDOHUWIRU9DWLFDQ&LW\

$'''2:1/2$'72&$57 

:DUKHDGV2YHUKHDG PXOWLPHGLDGRZQORDG

'RZQORDG
,QVXPPHUZLWK9HQXVLQ+\GUDZHKDGVL[ZDUKHDGVIO\LQJLQFRJQLWRRYHURXUKHDGV,VVXPPHUEHWWHUDQG
ZKDWDUHWKHSURVSHFWVIRU::"

$'''2:1/2$'72&$57 

2O\PSLF:DUV PXOWLPHGLDGRZQORDG

'RZQORDG
7KH2O\PSLDGDVLQWHUOXGHWR::"$QDVWURORJLFDOSXUSRUWWRWKHVHHGHYHQWVDFFRPSDQ\LQJWKH2O\PSLDG
3URIHVVLRQDO&KLURQFORVH XSPDSVDVDSSOLHGWR2O\PSLF:DUV1DYDOEORFNDGHRI,UDQ&KLURQDSSURDFKPDSV
1HSWXQHDQGGDUNSODQHWV2NHDQ2O\PSDQG
$'''2:1/2$'72&$57 

'ZDUI3ODQHWVLQWKH+RXVHV(ULVLQVLGH HERRN 

'RZQORDG
:KDWHYHUDIIHFWV\RXUKRXVHRIPDUULDJHLVGHOLQHDWHGLQWKLVWUHDWLVH%RQXV(ULVLQ/RYHDQG:DU2EMHFWVODUJHUWKDQ
3OXWRRU&HUHVVXUHO\LQIOXHQFHWKHWKKRXVHLQWKHKRURVFRSH$OOWKRVHREMHFWVFRPHDVGHOLQHDWHGLQWKHWKKRXVH
IRUWKHEHQHILWRIWKHDGYDQFHGDVWURORJHU

$'''2:1/2$'72&$57 

$FDGHPLF=RGLDFIRU%ORQGHV PXOWLPHGLDGRZQORDG

'RZQORDG
%ORQGVQRZNQRZPRUH EXWQRWWRRPXFK DERXWWKH]RGLDF%ORQGVKDYHPRUHIXQZLWKWKH$&$'(0,&=2',$&WKDWQR
PDQDQGDVWURORJHUNQHZXQWLOUHFHQW%ORQGVKDYHPRUH  ]RGLDFDOVLJQVZLWKDVFHQGDQWV 7KHVXQLVLQ9LUJR
IRUDOORIWKHPRQWKRI2FWREHUSOXVWZRZHHNVRUVRLQ6HSWHPEHU7KDWPDNHVWKHVXQWUDYHOWKURXJK9LUJRURXJKO\
GD\V DORQJWLPH HYHU\\HDU9LUJRZDVDOZD\VDORQJFRQVWHOODWLRQ EHLQJIHPLQLQH DPRQJWKHORQJHVWWKDWLV7KH
SDUWRIWKHVN\ZKHUH9LUJRUXOHVLVIXOORIORQJ DQGIHPLQLQH FRQVWHOODWLRQVOLNH+\GUDWKHORQJHVW]RGLDFDO
FRQVWHOODWLRQRIWKHPDOO!!0HQKDYHPDGHPHQPDGHHUURULQWKHFDOFXODWLRQRIWKHDVWURORJLFDOKRXVHV2XU1LJKW 
'D\KRXVHV\VWHPKDVFRUUHFWHGWKLVIRUWKHSXUSRVHRISHWDQGPDUULDJHDVWURORJ\7KHWKKRXVHSHUWDLQVWRSHWV
ZKLOHEDGSHWVWKDWLVPHQJRWRWKHWKKRXVH%RQXVLQVWDQWPDJLFNIRUEORQGV/RYH 0RQH\

$'''2:1/2$'72&$57 

2,5,6 HERRN 

'RZQORDG
2,5,6LQLWLDWLRQLVDIXUWKHUVWHSIURPLQVWDQW5755PDJLFNWRZDUGVSHUVRQDOLPPRUWDOLW\7DNH\RXUILUVWVWHSWRZDUGV
WKHUHDOPRIWKHLPPRUWDOVZLWK2,5,6DQGWKH57557&RPSOHWH57557LQLWLDWLRQZLWKSXUSRUWLQVLGH6WDUWFUHDWLQJ
\RXUQHZOLIHULJKWQRZ

$'''2:1/2$'72&$57 

,UDQWKH+RURVFRSH HERRN 

'RZQORDG
+\GURJHQDOHUWZLWK9HQXVLQ+\GUDLQWKH\HDU"7KHQHZSUHGLFWLRQIRU,UDQLQFOXGHVWKHSRVVLEOHFRQIOLFWZLWKWKH
86$:LWK6DWXUQLQDVSHFW3OXWRLQ%RRWHVLVQRWDFWXDOO\SXVVLQERRWV$V9HQXVHQWHUV+\GUDZHWHQGWR
FRQFHQWUDWHRQWKHK\GURJHQDVSHFWRIWKLVVSHFLDOSRVLWLRQRI9HQXVIRUWKH\HDU7KHGHWDLOHGPDSVVKRZWKH
SRVLWLRQRIWKHSODQHWVZLWKLQWKHFRQVWHOODWLRQ]RGLDF:KDWGRDVWURORJHUVNQRZRIDFRXQWU\OLNH3HUVLDUHERUQZLWK
0RRQLQ&HWXVDVSOXQJLQJLQWRK\GURJHQH[SHULPHQWVZLWK9HQXVLQ+\GUD":KLOHRXURZQQDWLRQKDVDUHSWLOLDQ
DVFHQGDQW6HUSHQV&DXGDWKHUHLVVWLOODQRWKHUVLGHWRWKHGUDJRQHQHUJ\DFURVVWKHSODQHW&RPHWVGZDUISODQHWV
DQGVSHFLDOSODQHWDU\SRVLWLRQVHQULFK3HUVLDQUHSWLOLDQDVWURORJ\LQWKH\HDU

$'''2:1/2$'72&$57 

*RJ 0DJRJ HERRN 

'RZQORDG
7KHILUVWYLFWLPVPDUNWKHHQWUDQFHRI9HQXVLQWR+\GUD$V9HQXVHQWHUV+\GUDSURSKHFLHVVFUROODQGLQWHUODFH
DV*RJ0DJRJ3XWLQHDUWKTXDNHVFKXUFKPDVVDFUHDQGWKH$QWLFKULVWUHYHDOWKHUHJUHVVLYHSDWWHUQRIWKHDSRFDO\SVH
(]H3HUVLD(WKLRSLDDQG/LE\DZLWKWKHPDOORIWKHPZLWKVKLHOGDQGKHOPHW%RWK0RRQDQG9HQXVVHWWOHLQ
0DVRQLF6H[WDQV WKHDVFHQGDQWRI9DWLFDQ&LW\ EHIRUH9HQXVHQWHUV+\GUD$V9HQXVFURVVHVIURP6H[WDQVLQWRWKH
FRQVWHOODWLRQRI7LDPXWDPDVVDFUHKDSSHQVLQDFKXUFKLQ0LVVRXULDQQRXQFLQJWKHYLVLWRIWKH$QWLFKULVW5LGLQJRQ
WKH+LOOVRI+\GUDVFLHQWLILFDVWURORJ\WHOOV\RXZKLFKFRQVWHOODWLRQURVHDWHDVWLQ\RXUQDWLYLW\\HDUVRI

(XURSHDQDVWURORJ\
FDQQRWSRVVLEO\WHOO\RXWKDW(ULVLQVLGH

$'''2:1/2$'72&$57 

$UPDJHGGRQ HERRN 

'RZQORDG
/RRNLQJIRUDQHZSHUVSHFWLYHDVFRQFHUQILQDQFLDODVWURORJ\LQWKHDSRFDO\SWLF\HDUVWRFRPH"2LOFULVLV8UDQXVLQ
&HWXV,OOXPLQDWL:LWFKROORZ$:9HQXVLQ+\GUDDQG-XSLWHULQ2SKLXFKXVZLOOH[SDQG\RXUSHUVSHFWLYH
WRZDUGVWKHILVFDOVWDUVIRUWKHSUHVHQWHSRFK$WZROHJJHGVQDNHZDONHGLQ/HEDQRQ 

$'''2:1/2$'72&$57 

*RJ 0DJRJ HERRN 


'RZQORDG
7KHILUVWYLFWLPVPDUNWKHHQWUDQFHRI9HQXVLQWR+\GUD$V9HQXVHQWHUV+\GUDSURSKHFLHVVFUROODQGLQWHUODFH
DV*RJ0DJRJ3XWLQHDUWKTXDNHVFKXUFKPDVVDFUHDQGWKH$QWLFKULVWUHYHDOWKHUHJUHVVLYHSDWWHUQRIWKHDSRFDO\SVH
(]H3HUVLD(WKLRSLDDQG/LE\DZLWKWKHPDOORIWKHPZLWKVKLHOGDQGKHOPHW %RWK0RRQDQG9HQXVVHWWOHLQ
0DVRQLF6H[WDQV WKHDVFHQGDQWRI9DWLFDQ&LW\ EHIRUH9HQXVHQWHUV+\GUD$V9HQXVFURVVHVIURP6H[WDQVLQWRWKH
FRQVWHOODWLRQRI7LDPXWDPDVVDFUHKDSSHQVLQDFKXUFKLQ0LVVRXULDQQRXQFLQJWKHYLVLWRIWKH$QWLFKULVW5LGLQJRQ
WKH+LOOVRI+\GUDVFLHQWLILFDVWURORJ\WHOOV\RXZKLFKFRQVWHOODWLRQURVHDWHDVWLQ\RXUQDWLYLW\\HDUVRI

(XURSHDQDVWURORJ\
FDQQRWSRVVLEO\WHOO\RXWKDW

$'''2:1/2$'72&$57 

$XVWUDOLD PXOWLPHGLDGRZQORDG

'RZQORDG
$XVWUDOLDQVNLHVVKRZFRPSOHWHO\GLIIHUHQWFRQVWHOODWLRQVIURPWKRVHYLVLEOHIURPWKHQRUWKHUQKHPLVSKHUH:HPD\VD\
WKDW$XVWUDOLDQSHRSOHDUHERUQXQGHUDFRPSOHWHO\GLIIHUHQWVN\%HLQJGLIIHUHQWWKHLUKRURVFRSHVDUHGLIIHUHQWDQGLQ
IDFWUHTXLULQJVSHFLDOVNLOODQGWHFKQLTXHV ,WLVDOZD\VH[FLWLQJWRGRKRURVFRSHVGRZQXQGHUWKXVHJ$XVWUDOLDKDV
WKHVDPHDVFHQGDQWDVWKH86$ $TXLOD RQO\XSVLGHGRZQ $PRQJWKHSHFXOLDULWLHVERWK$XVWUDOLDQFKDUWVKDYH/LOLWK
LQ6H[WDQV 3') 0DSVIRUSURIHVVLRQDODVWURORJHUV

$'''2:1/2$'72&$57 

'HDWK'LVFUHDWLRQ PXOWLPHGLDGRZQORDG

'RZQORDG
:KHUHGRDOOLPPRUWDOVGR"7KH\SDVVHGWKLVZD\*HWRXWRI'DY\-RQHV
/RFNHUDQGIROORZWKHTXHVWIRULPPRUWDOLW\

$'''2:1/2$'72&$57 

'HDWK'LVFUHDWLRQ HERRN 

'RZQORDG
555HLNLGREH\RQGWKHJUDYH

$'''2:1/2$'72&$57 

2,5,6 HERRN 

'RZQORDG
2,5,6LQLWLDWLRQLVDIXUWKHUVWHSIURPLQVWDQW5755PDJLFNWRZDUGVSHUVRQDOLPPRUWDOLW\7DNH\RXUILUVWVWHSWRZDUGV
WKHUHDOPRIWKHLPPRUWDOVZLWK2,5,6DQGWKH575577UXH0LQG'LVWLOOHUIRU20DVWHUVLQVLGH,QFOXGHVERQXV
575570DUULDJHUHQGHULQJWRROVWRDWWUDFW\RXUVWHOODUWZLQ

$'''2:1/2$'72&$57 

555HLNLGR HERRN 

'RZQORDG
&OHDU\RXUFKDNUDVDQGSHUIRUPLQVWDQWPLUDFOHV

$'''2:1/2$'72&$57 

555HLNLGR HERRN 

'RZQORDG
<RXGHFLGHKRZWKLQJVJR)RUHYHU

$'''2:1/2$'72&$57 

555HLNL HERRN 

'RZQORDG
0DNHLWKDSSHQULJKWQRZ

$'''2:1/2$'72&$57 

555HLNL HERRN 
'RZQORDG
5HDOLW\5HQGHULQJ5HLNL

$'''2:1/2$'72&$57 

9HQXVLQ6SHFLDO&RQVWHOODWLRQV HERRN 

'RZQORDG
'R\RXKDYH9HQXVLQ2ULRQ",VKHU9HQXVLQ6H[WDQV"9HQXVVSDQVWKURXJK]RGLDFDOFRQVWHOODWLRQV'LVFRYHU\RXU
RZQQDWDO9HQXV([DPSOHVIRUWKHV9HQXVHSKHPHULVLQVLGH9HQXVLQ6SHFLDO&RQVWHOODWLRQVLVD
QHZUHQGHULQJRIDFODVVLFPDQXDOLQHURWLFDVWURORJ\

$'''2:1/2$'72&$57 

&HQWDXUVLQ/RYH PXOWLPHGLDGRZQORDG

'RZQORDG
&KDULNORLVWKHFHQWDXUHVV Q\PSKRIORYHDQGJUDFH/HDUQWKHVHFUHWVRIWKHPDMRUFHQWDXUREMHFWVLQDVWURORJ\DQG
PDJLFN([FOXVLYHVFDQVDQGSRVLWLRQVIRUDOOFHQWDXUV,QWKH\HDU$/,(1/,)(ZDVILQDOO\DQQRXQFHGE\WKH
VFLHQWLVWV,WKDSSHQVWKDWDVWURORJLFDOO\VSHDNLQJWKH&(17$856KDYHHYHU\WKLQJWRGRZLWKWKHILQGLQJ$WULEXWHWR
WKHP&(17$856LQDVWURORJ\ZLWKDVSHFLDOVHUYLFHGHGLFDWHGWRWKH5,1*2)/,)(DQG&KDULNORLQ&HQWDXUXV
$FDGHPLF=RGLDFSUHFHVVHGDVFHQGDQWV&KLURQ3KROXVDQG$VEROXVLQVLGH

$'''2:1/2$'72&$57 

6HFUHW=RGLDF PXOWLPHGLDGRZQORDG

'RZQORDG
$VDERYHVREHORZWKHVNLHVDUHFKDQJLQJDQGVRGRWKHDVFHQGDQWV8SGDWH\RXUORFDO]RGLDFZLWKWKLVEDVLF
UHIHUHQFHERRNIRUHYHU\DVWURORJHU57557LQVLGH

$'''2:1/2$'72&$57 

/,/,79(5$ HERRN 

'RZQORDG
$QROGSKDQWRPIRURXULQWHUHVWLQJWLPHV/,/,79(5$DVXSJUDGHGIRUWKHDSRFDO\SWLF\HDUV:KDWKDSSHQV
ZKHQRXUDX[LOLDU\VDWHOOLWHVPHHWWKHRXWHUJXDUGLDQVRIRXUVRODUV\VWHP"$SRKHOHVDQG(DUWKFR RUELWDODVWHURLGV
DORQJZLWKH[WUHPHSHULRGREMHFWV0DWUL[KDFNLQJLQVLGH

$'''2:1/2$'72&$57 

7KH6HFUHW=RGLDFRIWKH86$ PXOWLPHGLDGRZQORDG

'RZQORDG
7KHUHSWLOLDQKRURVFRSHIRUWKH86$

$'''2:1/2$'72&$57 

8QEXFRQHOFLHOR HERRN

'RZQORDG
/DVFRSHUWDG
XQEXFRQHOFLHORVSDYHQWDPDDQFKHHQWXVLDVWDJOLVFLHQ]LDWL,O:0$3FROGVSRWHVWDWRVFRSHUWRLQ
VLQWRQLDFRQO
HQWUDWDGL9HQHUHLQ+\GUD&RPHLQWHUSUHWLDPRLOEXFRQHURLQXQFLHORVWHOODWRSURSULRLQTXHVWDHUD
DSRFDOLWWLFDQHOODTXDOHYLYLDPR"8QLYHUVLSDUDOOHOLOR]RGLDFRDFFDGHPLFRFULVLLPPRELOLDUHO
DQWLFULVWRODFDGXWDGHO
9DWLFDQRHPDJLDSHUVRQDOHLQWHPSRUHDOH%RQXVLOFURFLILVVRHFOLVVDWRODSXEEOLFD]LRQHLQJOHVHGL³&UXFLILFWLRQ´
O
HFOLVVDPHQWRDEELQDWDDOFURFLILVVRGL*HV Ĥ&ULVWRQRQULSRUWDWRGDLYDQJHOL

$'''2:1/2$'72&$57 

7KH$VFHQGDQWRIWKH86$ HERRN

'RZQORDG
7KHHDUO\SUHVHQWDWLRQRIWKHWUXHDVFHQGDQWRIWKH86$DORQJZLWKWKHQHZLQWHUSUHWDWLRQRIWKH*HQHVLV$VFHQGDQW

$'''2:1/2$'72&$57 
3OXWRLG*HQHUDWLRQV PXOWLPHGLDGRZQORDG

'RZQORDG
,QGLJRDVWURORJ\IRUVSHFLDOJHQHUDWLRQV:KHWKHUUHVRQDWLQJZLWKWKHKLSSLHSXQNRUEHOO\GDQFLQJJHQHUDWLRQWKLV
H[WHQVLYHPDQXDOLVIRU\RX$V3OXWRFURVVHVIURP&RPD%HUHQLFHVLQWR%RRWHVDQG6HUSHQVWKHJHQHUDWLRQVFKDQJH
ZLWKWKHLURZQIODYRUIRUUHEHOOLRQ3=RGLDF$FDGHPLF=RGLDF3UHFHVVHG$VFHQGDQW&DUWHVLDQKRXVHV\VWHP%RRWHV
VXSHUYRLG:0$3FROGVSRW3OXWRDQLPDWLRQVWKH$[LVRI(YLO57557DQGFRSLRXVUHIHUHQFHLQWKHIRUPRIPDSVDQG
1$6$HSKHPHULGHVDOOWKDW\RXHYHUZDQWHGWRNQRZDERXWWKHWUXHDVWURORJLFDOSRVLWLRQVIRU\RXURZQJHQHUDWLRQ

$'''2:1/2$'72&$57 

... PXOWLPHGLDGRZQORDG

'RZQORDG
...DQGWKH$PHULFDQDSRFDO\SVH

$'''2:1/2$'72&$57 

2EDPD PXOWLPHGLDGRZQORDG

'RZQORDG
IRUWKH86$<DQNHHFLYLOZDUWKUHH\HDUV...LOODU\DJDLQVW2EDPD"$QDSSDUHQWO\DPXVLQJKRD[DV
EDVHGRQVROLGDFDGHPLFEDVLV7KHFLYLOZDUSUHGLFWLRQVIRU2EDPDXQUROODQGFROOLGHDJDLQVWWKHWDSHVWU\RIWKH
$FDGHPLF=RGLDF$VWURORJLFDOUHIHUHQFHILOHVLQ3')DQGDQLPDWHGIRUPDW

$'''2:1/2$'72&$57 

+HDOLQJ$VWURORJ\ HERRN 

'RZQORDG
0RUHWKDQ\RXDVWURORJHUDQG5HLNLPDVWHUHYHUZDQWHGWRNQRZDERXWWKHZD\\RXDUHDERXWWRKHDOWKHPLQWKH
LUUHYHUVLEOHSURFHVVRISODQHWDU\H[RUFLVP<RXUVHFUHWPDQXDOIRUWKHDQGEH\RQGWLPH<RXKDGEHHQWULFNHGE\
WURSLFDODVWURORJ\DQG5HLNLEXWQRZ\RXDUHKHDOLQJ\RXUVZLQGOHUVDVVHOIDZDUHFRVPLFDOHQWLW\$EVWUDFWV
WHFKQLTXHVH[RUFLVPUHDOLW\PDJLFNLQVWDQWPLUDFOHVWUXHQDWDOVNLHV$FDGHPLF=RGLDFDQGPRUH:LWKWKLVUHDGLQJ
\RXZLOOQHYHUHYHUZDQWWRSD\DFODVVRUOHFWXUHWRDQ\RQHIURPWKLVSODQHWWR8UDQXV&RPHRYHUWKHHGJHRIWKHZRUOG
ZKLOHHQMR\LQJ\RXURZQGDULQJEXWORYLQJRPQLSRWHQFHQRZ

$'''2:1/2$'72&$57 

2,QLWLDWLRQ HERRN 

'RZQORDG
+HDOORYHDQGEOHVVHYHU\ERG\
VOLIHZLWK2+HDO\RXU5HLNLPDVWHUDQGERRV\RXJXUXFRQQHFWLRQIURP\RXUWUXHPLQG
2PQLSRWHQFHLV\RXUVIRUWKHWDNLQJ

$'''2:1/2$'72&$57 

20DVWHU HERRN 

'RZQORDG
0DVWHU2DQGEHFRPHRPQLSRWHQWKHDO5HLNLPDVWHUVSUHGLFWDQGDYHUWFDQFHUUHWXUQ!!7KHORQJH[SHFWHG
XSGDWHRIDQDQFLHQWLQLWLDWLRQ

$'''2:1/2$'72&$57 

5HERRW HERRN 

'RZQORDG
7KH575575HDO7LPH5HDOLW\5HQGHULQJ7RROVQDWXUDOO\GHYHORSIURPWHFKQLTXHWRWHFKQLTXHDVWKHVSLULWRIWKHWLPH
UHTXLUHV:KDWDUHWKHUHOLJLRXVLPSOLFDWLRQVRIRPQLSRWHQFHRQWKHSDUWRIWKHLQGLYLGXDO"7KHDSSOLFDWLRQVIRFXVRQ
KHDOLQJFDQFHUZLQQLQJDWORWWHU\JHWWLQJDXGLHQFHSDVVLQJDQH[DPPDUU\LQJWKHLGHDOSDUWQHU7KHPHFKDQLFDO
WRROVDUHTXLWHLQFDSDEOHRIFRQWDFWLQJWKH63,5,7DVQRWHOHSKRQHFDQUHDFKLW$IXUWKHULQLWLDWLRQLQ,167$170$*,&.
HODERUDWHVRQWKHPRUDOSUREOHPRI\RXUQHZO\DFTXLUHG201,327(1&(DVZHOODVWKHODZIXOQHVVRILQVWDQWPDJLFN
ZLWKLQWKH-XGHR&KULVWLDQIUDPHZRUN&DQRQHEULQJDERXW,167$17(9,/LQVWHDGRIJRRGDQGZK\QRW"'RHVWUXH
PLQGKDYHDQ\ZLVKDWDOO",VLWULJKWWRPHGGOHLQWR*RG
VRZQZRUNVKRS"VFLHQWLILFDVWURORJ\LQVLGH

$'''2:1/2$'72&$57 

,QVWDQW+HDOLQJ HERRN 
'RZQORDG
,QVWDQWDQGFRPPRQSODFHKHDOLQJGHSHQGRQVLPSOHLPDJLQDWLRQ([RUFLVHDQ\GLVHDVHZLWKVLPSOH\HWSRZHUIXO
PHQWDOWHFKQRORJ\2ULHQWDOWHFKQLTXHVVLPSOLILHGIRUZHVWHUQXVHUV7KHLQLWLDWLRQQRWRQO\HQDEOHVSHUVRQDOKHDOLQJ
EXWDOVRXQOLPLWHGUHVXOWVLQWKHDUHDRI\RXUFKRLFH7KHLQVWDQWFOHDULQJWHFKQLTXHVUHQGHUDPD]LQJUHVXOWVLQKHDOLQJ
DQGGDLO\OLIHDVZHOO

$'''2:1/2$'72&$57 

)XWXUH&KDQJLQJIRU$VWURORJHUV HERRN 

'RZQORDG
/HW
VFKDQJHVRPHRI\RXUIXWXUHIRUJRRGQRPDWWHUEDGWUDQVLWVRUHYLOH\HZLWKWKHUHDOWLPHUHDOLW\UHQGHULQJWRROV
FRPSOHWH$VWURORJHUVIHDUEDGWUDQVLWVOLNHEDGGD\VEXWZHFDQFOHDUWKHDWPRVSKHUHDWWKLVPRPHQWZKLOHSHUIRUPLQJ
LQVWDQWPDJLFNLQUHDOWLPH :KRVDLGLWFRXOGQ
WKDSSHQ"KWWSZZZOXOXFRPDVWURORJ\

$'''2:1/2$'72&$57 

:RQGHU+HDOWK HERRN 

'RZQORDG
:RQGHUZRUNLQJKDVQROLPLWV:HFDQFUHDWHKHDOWKDVZHOODVGLVFUHDWHLOOQHVVIURPRXUOLIH:HFDQFXUHZKHUH
WKHUH
VQRFXUHDQGGRVRDWGLVWDQFHLQWLPHDQGVSDFH6LQFHRXURSHUDWLRQVSHUWDLQWRWKHWLPHOHVVGRPDLQZHFDQ
RSHUDWHWKURXJKWLPHDQGVSDFHHJEHIRUHDIDWDOFDQFHURXVVDWXUQLQHWUDQVLWDIIOLFWVWKHSRVLWLRQRIWKHQDWDOPRRQLQD
FOLHQW
VKRURVFRSH

$'''2:1/2$'72&$57 

5HDO7LPH5HDOLW\5HQGHULQJ7RROV HERRN 

'RZQORDG
7KH57557QDWXUDOO\GHYHORSIURPWHFKQLTXHWRWHFKQLTXHDVWKHVSLULWRIWKHWLPHUHTXLUHV7KHODWHVWLQWURGXFWLRQE\
WKH]HLWJHLVWIRFXVHVRQWKHUHOLJLRXVLPSOLFDWLRQVRIRPQLSRWHQFHRQWKHSDUWRIWKHLQGLYLGXDO7KHDSSOLFDWLRQVIRFXV
RQKHDOLQJFDQFHUZLQQLQJDWORWWHU\JHWWLQJDXGLHQFHSDVVLQJDQH[DPPDUU\LQJWKHLGHDOSDUWQHU7KHPHFKDQLFDO
WRROVDUHTXLWHLQFDSDEOHRIFRQWDFWLQJWKH63,5,7DVQRWHOHSKRQHFDQUHDFKLW$IXUWKHULQLWLDWLRQLQ,167$170$*,&.
HODERUDWHVRQWKHPRUDOSUREOHPRI\RXUQHZO\DFTXLUHG201,327(1&(DVZHOODVWKHODZIXOQHVVRILQVWDQWPDJLFN
ZLWKLQWKH-XGHR&KULVWLDQIUDPHZRUN&DQRQHEULQJDERXW,167$17(9,/LQVWHDGRIJRRGDQGZK\QRW"'RHVWUXH
PLQGKDYHDQ\ZLVKDWDOO",VLWULJKWWRPHGGOHLQWR*RG
VRZQZRUNVKRS",QRUGHUWRPDNHLQVWDQWPDJLFN675((7
/(*$/ZHKDYHDQVZHUHGWKHKRWTXHVWLRQVE\RXULQTXLVLWLYHLQLWLDWHV%RQXV2,5,6ZLWKFRPSOHWH57557 5HDO
7LPH5HDOLW\5HQGHULQJ7RROV ,QVWDQW3HUVRQDO0DJLFN LQLWLDWLRQLQVLGH

$'''2:1/2$'72&$57 

3HUVRQDO&RVPLF$YDWDU HERRN 

'RZQORDG
,QVWDQWPDJLFNLQLWLDWLRQWDNHVDIXUWKHUVWHS/HDUQKRZWRSURGXFHHIIHFWVLQWKHUHDOZRUOGLQUHDOWLPHQRZ&RPSOHWH
2,5,6DQG57557LQLWLDWLRQLQVLGH

$'''2:1/2$'72&$57 

&UHDWLQJ*RGLQ2QH
V2ZQ,PDJH57557WKH)LQDO&XW HERRN 

'RZQORDG
,WLVHDV\WRSURGXFHPDJLFDOHIIHFWVLQPLQXWHVZLWKWKH5HDO7LPH5HDOLW\5HQGHULQJ7RROV7KHILQDOFXWWDNHVWKH
LQLWLDWHWRZDUGVSHUVRQDOUHOLJLRQWRZDUGVWKHGLVFRYHU\RIWKHVRXUFHRIDOOPDJLFN7KH57557ZHUHGHVLJQHGERWKDV
VSLULWXDOWHFKQLTXHVDQGVHFXODUWRROV2QH
VLGHQWLILFDWLRQZLWKIDOVHHJRHQWUDSVRQHLQWRWKHPDWHULDOZRUOGZLWKLWV
SUHVVLQJZLVKHV2QWKHPDWHULDOSODQHWKH57557DFWDVLQVWDQWPDJLFNLQUHDOWLPHEXWRQWKHVSLULWXDOSODQHIDOVH
HJRLVGLVFUHDWHGLQWKHSURFHVV*UHHGLVFDSWXUHGDQGGLVFUHDWHGE\LWVRZQJUHHG7KXVHYHQIDOVHHJRZRUNVRXW
OLEHUDWLRQ7KHLGHDZDVWRXVHWKHHQHP\LQRUGHUWRGHVWUR\WKHHQHP\QHYHUWKHOHVVHQMR\LQJWKHUHVXOWVRIERWK
VSLULWXDODQGVHFXODUILJKW,QVWDQWPDJLFNLVWKXVQRWRQO\ZLVKJUDQWLQJLQUHFRUGWLPHEXWDOVRUHZDUGLQJDQGKLJKO\
OLEHUDWLQJGHFRPSRVLWLRQRIWKHIDOVHHJR,WLVXSWRWKHLQLWLDWHWRGHGXFHLIZHKDYHVDWHGWKHZROIZKLOHVDYLQJWKH
VKHHS(QMR\LQVWDQWPDJLFNZKLOHKHDGLQJWRZDUGVOLEHUDWLRQ

$'''2:1/2$'72&$57 

0DWUL[+DFNLQJ HERRN 

'RZQORDG
7KH\OLHGWR\RX+DFNWKHHYHQWKRUL]RQZLWKWKH5HDO7LPH5HDOLW\5HQGHULQJ7RROVZKLOHGLVFRYHULQJ\RXUWUXHVHOI
7UXHVHOILVLQVWDQWPDJLFNDVIDOVHLGHQWLILFDWLRQVGLVVROYHIRUHYHU:HDUHQRWRQO\FUHDWLQJHYHQWVEXWDOVRKDYLQJIXQ
,QVWDQWPDJLFNJHWVSHUVRQDOZLWKWKH0DWUL[+DFNLQJ7RROV5HDGHU
VFKRLFHDQGRXUEHVWVHOOHU
$'''2:1/2$'72&$57 

&HQWDXUHDQ'\QDVW\ PXOWLPHGLDGRZQORDG

'RZQORDG
$VDOLHQOLIHLVDQQRXQFHGLQWKHFRQVWHOODWLRQRI&HQWDXUXVZHILQGDQDGMDFHQWFHQWDXUHVVQ\PSKLQWKHFRQVWHOODWLRQ
RIKHUORYHU&KLURQ7KLVEULQJVWKHWRSLFRIFHQWDXUVWRIURQW:KRDUHWKH\":KDWLVWKHLUDVWURORJLFDOPHDQLQJ":KHUH
GRWKH\UHDOO\URDP"0HHW&KDULNORLQ/XSXV1HVVXVLQ0LFURVFRSLXPDQG3KROXVLQ2SKLXFKXVDV\RXHQMR\WKLV
UHDGLQJWRWKH/$67'$<:LWKDSRFDO\SVHEHKLQGRXUEDFNZHDUHIDFLQJWKH\HDUZKHQQRWKLQJZLOOEHWKHVDPH
$&$'(0,&=2',$&%,%/(LQVLGH8SGDWHGIRU1HSWXQH&KLURQG\QDPLFV

$'''2:1/2$'72&$57 

&KDULNOR WKH5LQJRI/LIH PXOWLPHGLDGRZQORDG

'RZQORDG
,QWKH\HDU$/,(1/,)(ZDVILQDOO\DQQRXQFHGE\WKHVFLHQWLVWV,WKDSSHQVWKDWDVWURORJLFDOO\VSHDNLQJWKH
&(17$856KDYHHYHU\WKLQJWRGRZLWKWKHILQGLQJ$WULEXWHWR&(17$856LQDVWURORJ\ZLWKDVSHFLDOVHUYLFHGHGLFDWHG
WRWKH5,1*2)/,)(DQG&KDULNORLQ&HQWDXUXV&KLURQ3KROXVDQG$VEROXVLQVLGH

$'''2:1/2$'72&$57 

(ULVLQ6\QDVWU\ HERRN 

'RZQORDG
(ULVXQOHDVKHGLQWKHKRXVHVRI\RXUORYHU
VKRURVFRSH(ULVLQV\QDVWU\WKHRULJLQDOGHOLQHDWLRQZLWK(ULVLQ6H[
WKURXJKWKHKRXVHVLQDVWURORJ\

$'''2:1/2$'72&$57 

(ULVLQ:RQGHUODQG HERRN 

'RZQORDG
(ULVLQWKHKRXVHV'ZDUI3ODQHWVLQWKHWK+RXVHRI\RXUKRURVFRSH$QWLFKULVW<HDUPDQXDO9HQXVLQ6SHFLDO
&RQVWHOODWLRQV9HQXVLQ+\GUD5HDO7LPH5HDOLW\5HQGHULQJ7RROV &DWFKWKHSDUDGLVDLFDSSOHRI(ULVEHIRUH
9HQXVHQWHUV+\GUD(ULVDVWURORJ\FRXSOHGZLWKSHUVRQDOPDJLFNLQRQHSDFNDJHIRUWKH\HDURIWKH$QWLFKULVW

$'''2:1/2$'72&$57 

7UDQVQHSWXQLDQ2EMHFWVLQ)LQDQFLDO$VWURORJ\ HERRN 

'RZQORDG
6RPHJLDQWREMHFWVEH\RQG1HSWXQHLQIOXHQFH\RXUILQDQFLDOJHQLXV

$'''2:1/2$'72&$57 

/RYH 0RQH\6HGXFLQJ3DUWQHU,PSRVVLEOH HERRN 

'RZQORDG
$VWKHZLWFKGLVVROYHVWKHXQZDQWHGQHJDWLYLW\WKHHQHUJ\WKDWZDVHQWUDSSHGZLWKLQWKDWEDGHQFORVXUHZLOO
LPPHGLDWHO\EHXVHGLQFUHDWLQJWKHSRVLWLYHPDUULDJHHYHQW!!$WWKHWLPH\RXOLNHGEORQGVQRZ\RXOLNHH[RWLFQDWXUDO
IHPDOHVDIWHUZDUGV\RXZLOOOLNHQXQV7DVWHLVPDQLSXODWHGE\WKHPHGLDEXWFRXQWHUIDWHLVOHGE\WUXHPLQGLQDVHFUHW
SURFHVVRILQLWLDWLRQ$IWHUDOOWKHSDUWQHULVQRWLPSRUWDQWRUWKHSDUWQHULVWKHRQO\LPSRUWDQWWKLQJWKDWLV\RX

$'''2:1/2$'72&$57 

$OLFHLQ0DWUL[ODQG HERRN 

'RZQORDG
$OLFHKDVKHUQDWDO0RRQDVFHQGLQJLQ&HWXV(ULVLQ&HWXV0HUFXU\LQ6H[WDQV9HQXVLQ2ULRQDQG3OXWRLQ6HUSHQV
&DXGD:KDWLV\RXUWUXHKRURVFRSH"&KDQJH\RXUIXWXUHDFFRUGLQJWR\RXUWUXHKRURVFRSH

$'''2:1/2$'72&$57 

2,5,6 HERRN 

'RZQORDG
2,5,6LQLWLDWLRQLVDIXUWKHUVWHSIURPLQVWDQW5755PDJLFNWRZDUGVSHUVRQDOLPPRUWDOLW\7DNH\RXUILUVWVWHSWRZDUGV
WKHUHDOPRIWKHLPPRUWDOVZLWK2,5,6DQGWKH575577UXH0LQG'LVWLOOHUIRU20DVWHUVLQVLGH,QFOXGHVERQXV
575570DUULDJHUHQGHULQJWRROVWRDWWUDFW\RXUVWHOODUWZLQ

$'''2:1/2$'72&$57 

$VWURORJ\8QSOXJJHG PXOWLPHGLDGRZQORDG

'RZQORDG
8QSOXJ\RXUDVWURORJLFDOH[SHULHQFHIURPWKH PDWUL[DQGIUHH\RXUNDUPDIURPSUHGHILQHGVXSHUVWLWLRQ 

$'''2:1/2$'72&$57 

$VWURORJLFDO&RGH[ PXOWLPHGLDGRZQORDG

'RZQORDG
7KH$VWURORJLFDO&RGH[UHJXODWHVDVZHOODVXSGDWHVWKHVWDQGDUGVDVXVHGE\DVWURORJHUV$FDGHPLF=RGLDF
3UHFHVVHG$VFHQGDQWVHW&DUWHVLDQKRXVHV\VWHP$QLPDWHG]RGLDFDQG57557LQVLGH

$'''2:1/2$'72&$57 

,QGLJR.LGV PXOWLPHGLDGRZQORDG

'RZQORDG
6HUPRQRIWKH,QGLJR*HQHUDWLRQ57557LQVLGH

$'''2:1/2$'72&$57 

,QGLJR*HQHVLV HERRN 

'RZQORDG
7KHUHLVDQLQGLJRNLGLQDOORIXVDVDZDNHQHGE\WKHH[WUHPHSRVLWLRQRI3OXWRLQ&RPD%HUHQLFHV

$'''2:1/2$'72&$57 

,QGLJR$VWURORJ\ PXOWLPHGLDGRZQORDG

'RZQORDG
$V3OXWRFOLPEVLQWR&RPD%HUHQLFHVDQHZJHQHUDWLRQLVERUQ,QGLJRKRURVFRSHVDQGDQLPDWLRQVIRUWKHVSHFLDO
JHQHUDWLRQV

$'''2:1/2$'72&$57 

3OXWRLG*HQHUDWLRQV HERRN

'RZQORDG
,QGLJR$VWURORJ\IRUVSHFLDOJHQHUDWLRQV$Q$FDGHPLF=RGLDFVHVVLRQIRUDVWURORJ\ORYHUVZLWK3OXWRLQ&RPD
%HUHQLFHV%RRWHVDQG6HUSHQV1RPDWWHUZKLFKJHQHUDWLRQ\RXVKDUHZLWKWKHVHSRVLWLRQVRI3OXWR\RXUDVWURORJLFDO
UHIHUHQFHLVWKLVERRN$WWKHWLPHZKHQ\RXZHUHERUQWKH$FDGHPLF=RGLDFKDGPRUHFRQVWHOODWLRQVGXHWR3OXWREHLQJ
DSODQHW1RZ\RXNQRZZK\

$'''2:1/2$'72&$57 

6XESULPH0RUWJDJH&ULVLV PXOWLPHGLDGRZQORDG

'RZQORDG
:RUOGHFRQRPLFFULVLVXSGDWHGIRUWKHSHDNVLQWKLVHGLWLRQZLWKDSHDNSHU\HDUDQDO\VLVWKURXJKWKH
SHULRG6XESULPHPRUWJDJHFULVLVDVFHQWHUHGRQWKH³GHYLDQW´DVWURQRPLFSKHQRPHQRQRI9HQXVLQ+\GUD
)XUWKHUVWRFNPDUNHWFUDVKSUHGLFWLRQVIRUWKH\HDUDQGWKHGHFDGH VLF DKHDG7KHLVVXHVRIWKHUHDOHVWDWHFULVLV
LQWKHSHUVSHFWLYHRIWKHHQGRIWKHSUHVHQWF\FOHWRZDUGVWKH0D\DQ\HDU VLF 7KHIDOORI9DWLFDQ$,21
5HSRUW:0$3FROGVSRW:LWFKDOORZ7KH0D\DQDQGWKHQHZELEOLFDOVNLHVDSRFDO\SWLFDVWURORJ\7KHUHSRUWLVD
SXUSRUWWRRXUSXEOLFDWLRQVDVFHQWHUHGRQ9HQXVDQG$:LQ+\GUDDFFRUGLQJWRWKHSUHYLRXVO\SUHGLFWHG
PDUNHWFUDVK)LQGHVLþFOHLQLWVDSRFDO\SWLFDVWURQRPLFDVZHOODVHFRQRPLFDOFRPSRQHQW 3ULQWDEOH3')
DQLPDWLRQ

$'''2:1/2$'72&$57 

*ROGHQ5DLQ PXOWLPHGLDGRZQORDG
'RZQORDG
7KHJROGHQVKRZHUDWWKHHQGRIVXESULPHPRUWJDJHFULVLV"

$'''2:1/2$'72&$57 

2EDPDLQWKH6WDUV PXOWLPHGLDGRZQORDG

'RZQORDG
'DQJHURXVJLIWVLQGDQJHURXVWLPHV:K\LV2EDPDULVNLQJKLVOLIHDQGZKHQ"8SGDWHGDQDO\VLVRIWKHKRURVFRSHIRU
%DUDFN2EDPD7KHIXOOSRZHURIWKH$FDGHPLF=RGLDFDVFRPELQHGZLWKSUHGLFWLYHWHFKQLTXHV3ULQWDEOH3')ZLWK
DQLPDWLRQV

$'''2:1/2$'72&$57 

2EVHUYHURI7LPHV HERRN 

'RZQORDG
7DNHPHWRWKHFKXUFKRQ7,0(7KH$&$'(0,&=2',$&HQDEOHVWKHSUHFLVHGHWHUPLQDWLRQRI\RXUORYLQJIXWXUHEXWWKH
57557DOORZRQHWR&+$1*(WKH&2856(RI(9(1767KHWUHDWLVHV\QFKURQL]HV)8785(&+$1*,1*ZLWK)8785(
6&$11,1*DFFRUGLQJWRRQH
VRZQUHOLJLRQDQGURRWV:KHQLWLVLPPHGLDWHO\SRVVLEOHRUHYHQHDV\WRSURGXFH
,167$170,5$&/(RUVFDQWKHIXWXUHLQVHFRQGVLVLWDOVROHJDOWRGRVR"7KH5($/7,0(5($/,7<5(1'(5,1*
722/6IHDWXUHWKH0$55,$*(5(1'(5,1*:,=$5'3HUVRQDO&RVPLF6HFUHWDU\2,QLWLDWLRQ0RQH\+RQH\
:LVKZKHHO&DVFDGH,QWHJHU0DJLF:DQG0DWUL[3URJUDPPLQJ&RPSXWHU,QWHUIDFHDQG7UXH0LQG'LVWLOOHU,WLV
GLIILFXOWWRGLIIHUHQWLDWHEHWZHHQSUHGLFWLRQDQGHOHFWLRQDVWKH\ILQDOO\FRQYHUJHWRZDUGVHDFKRWKHUWKURXJKWKHWXQQHORI
WLPH!!57557LQVLGH

$'''2:1/2$'72&$57 

(7(5 HERRN 

'RZQORDG
7LPHPRQH\HQHUJ\DQGHPRWLRQFDQEHUHWULHYHGHYHQLIORVWIRUDJHV,VLWSRVVLEOHWRPDNHXSIRUORVWWLPHRUHYHQ
UHWULHYHLW",QRUGHUWRH[SHULHQFHWLPHWKHUHDGHULVDGYLVHGWRFRQVXOWWUXHPLQGGLVWLOOLQJDVLQFOXGHGLQRXU5755
LQLWLDWLRQ!!,QVWDQW57557PDJLFNLQVLGH(7(5PLQGWHFKQRORJ\VSHFLDOLVHVLQWKHUHWULHYDORIORVWHPRWLRQWLPH
HQHUJ\PRQH\RUZKDWHYHULQYHVWPHQWZDVORVW$EDQNZDVGLVKRQHVWZLWKPHVR,',6&5($7('7+(%$1. WDNHV
PLQXWHV XVLQJ2LWZDVVROGIRUDIWHUEDQNUXSWF\DPRQWKODWHU6RPHWKLQJFUDFNHGLQWKHEDQNVWUXFWXUHDW
GLVFUHDWLRQWLPH2IFRXUVHVRPHWKLQJZDVDOUHDG\ZURQJEXW,FRXOGQRWSRVVLEO\NQRZWKDWLQUHDOOLIH(7(5DFWVOLNH
DQHQHUJ\JUDEEHUUHWULHYLQJORVWHQHUJ\ZLWKDKLJKSHUFHQWDJHRILQWHUHVW8QDZDUHVWKHEDQNZDV³IRUFHG´WRUHWXUQ
WKHPRQH\LQWKHIRUPRIFRPSXWHUHTXLSPHQW!!

$'''2:1/2$'72&$57 

5HDOLW\0DJLFN PXOWLPHGLDGRZQORDG

'RZQORDG
&DQWKHSXUVXLWRIEDGOXFNXOWLPDWHO\OHDGWRJRRGUHVXOWV"7KH5($/7,0(5($/,7<5(1'(5,1*722/6XSJUDGH
IHDWXUHVDQDYLDU\RI,167$170$*,&.WHFKQLTXHVIRU\RXWRWU\5,*+712:$VHQOLVWHGLQWKH35(9,(:DUHWKH
3(5621$/&260,&6(&5(7$5<2%(521&$6&$'(DQGHYHQ&$/$0,7<38568,77U\DQGIROORZWKHSDUDGR[WR
HQOLJKWHQPHQW+RZFRPHWKDWWKHUHDUHVROLWWOHJRRGUHVXOWVRQDSODQHWZKHUHHYHU\ERG\LVORRNLQJIRUJRRGOXFN"
!!7KHLPSUREDEOHLVVXHVRIDK\SRWKHWLFDOVHDUFKIRUEDGOXFNDVORFNHGZLWKLQWKHDSRFDO\SWLFSHUVSHFWLYH
1DJJLQJLVPRUHIXQZKHQRQHWDONVWRWKHZLQGWRWKHIRXUZLQGVRIDVWURORJ\!!$VFRQILGHQFHGULYHVWKHFKDULRWRQH
LVVXUHQRWWRHQJDJHLQWKHSXUVXLWRIEDGOXFN:HMXVWZDQWHGWRPDNHLWVXUH 3')/HWWHUIRUPDWSS

$'''2:1/2$'72&$57 

$VWURORJ\LQWKH5HDO6N\ PXOWLPHGLDGRZQORDG

'RZQORDG
$FRPSUHKHQVLYHFRPSDULVRQEHWZHHQWKHUHDOVN\DVVHHQE\WKH$FDGHPLF=RGLDFDQGKRURVFRSHVDVPDGHE\
SRSXODUSURJUDPV$VWKHWUXHQDWDOVN\EULQJVLQIUHVKDQGUHOLDEOHLQIRUPDWLRQLQWR\RXUKRURVFRSHZHWDNH\RXRQD
WULSWR&UXLWKQHZKHUHWKHILUVWFRORQVKDYHDGLIIHUHQWVN\WRGHDOZLWK3ODQHWRFHQWULFDVWURORJ\$FDGHPLF=RGLDFDQG
5HDO7LPH5HDOLW\5HQGHULQJ7RROVDVYDOXDEOHLQIRUPDWLRQFRQFHUQLQJ\RXUWUXHQDWDOVNLHVGHVWLQDWLRQDQGIXWXUHDW
ZLOO,QGLJRDVWURORJ\LQVLGH

$'''2:1/2$'72&$57 

+RXVHRIWKH6HWWLQJ6XQ PXOWLPHGLDGRZQORDG

'RZQORDG
6XESULPHPRUWJDJHFULVLV":HSUHGLFWHGWKHSUHVHQWUHDOHVWDWHFULVLVLQWKH\HDU7KHSUHGLFWLRQZDVSXEOLVKHG
RQ86(1(7+HUHLVWKHUHQGLWLRQRIWKHRULJLQDOSUHGLFWLRQ6XESULPHPRUWJDJHFULVLVDQDO\VLVZLWKSUHGLFWLRQV)XUWKHU
VWRFNPDUNHWFUDVKSUHGLFWLRQVIRUWKH\HDUDQGWKHGHFDGHDKHDG7KHLVVXHVRIWKHUHDOHVWDWHFULVLVLQWKH
SHUVSHFWLYHRIWKHHQGRIWKHSUHVHQWF\FOHWRZDUGVWKH\HDU7KHUHSRUWLVDSXUSRUWWRRXUSXEOLFDWLRQV
FHQWHUHGRQ9HQXVDQG$:LQ+\GUDDQGWKHDOUHDG\SUHGLFWHGUHDOHVWDWHPDUNHWFUDVK 3')

$'''2:1/2$'72&$57 

6FLHQWLILF$VWURORJ\$EVWUDFWV HERRN 

'RZQORDG
$FDGHPLF]RGLDFSUHFHVVHGDVFHQGDQWVHWDQGXQLYHUVDO&DUWHVLDQKRXVHV\VWHP7KHGHILQLWLRQRIDVWURORJ\IRUDOO
WLPHVLQRQHYROXPHIRUWKHVLQFHUHDVWURORJHU*HWDPLOOHQQLXPDKHDGIURPDQ\DVWURORJ\ZLWKWKLVSUHFLRXVYROXPH

$'''2:1/2$'72&$57 

3KDQWRPRIWKH2SHUD HERRN 

'RZQORDG
6XEFRQVFLRXVDVFHQGDQWVDQG]RGLDFDOFRQVWHOODWLRQVLQDVWURORJ\2ULRQ0RQRFHURVDQG+\GUDLQ\RXUKRURVFRSH

$'''2:1/2$'72&$57 

7UXH0LQG'LVWLOOHU HERRN 

'RZQORDG
7KHRQO\VRPHRQHHOVH\RXZDQWWREHLV\RXUWUXHVHOI5ROHSD\RIIWLPH$Q\RQHKDVDUROHWRVKDNHRII6HUYLQJWZR
PDVWHUVLVGRXEOHZRUNPHDQLQJPXFKHQHUJ\ZDVWHGLQUXQQLQJEDFNDQGIRUWK$VFKLOGUHQDUHERPEDUGHGZLWKUROH
SOD\LQJJDPHVIURPWKHLUHDUO\FKLOGKRRGWKH53*JHQHUDWLRQPRUHWKDQDQ\RWKHUKDVGHILQLWHGLIILFXOW\LQIRXQGLQJRXW
RQH
VRULJLQDOVHOI6LFNRIUROHSOD\LQJJDPHVLQ\RXUOLIH":DQWWRKHOS\RXUFKLOGRXWRI08'"*HWRXWRIWKDWGXQJHRQ
DQGGLVFUHDWHWKHGUDJRQRIIDOVHHJRIRUHYHUZLWK7UXH0LQG'LVWLOOHUDQGWKH57557*HW\RXUOLIHXQGHUFRQWUROLQVWHDG
RIMXPSLQJLQWR\HWDQRWKHUUROHSOD\LQJJDPH57557PHDQVLQVWDQWPDJLFNQRZ)HDWXUHVDQH[WHQGHG7UXH0LQG
'LVWLOOHUIRU5755PDVWHUV

$'''2:1/2$'72&$57 

(ULVDQGWKH=RGLDFDO&RQVSLUDF\ HERRN 

'RZQORDG
$FRPSOHWHPDQXDOIRUWKH(ULVDVWURORJHULQWKH\HDU7KHUHIRUPDWLRQRIWKH]RGLDFSUHFHVVHGDVFHQGDQW9HQXV
LQ+\GUD&HWXVLQDVWURORJ\(DUWKULVHLQ&HWXV(ULV &KLURQG\QDPLFVDQGERQXVPDWHULDO

$'''2:1/2$'72&$57 

WK6HDO HERRN 

'RZQORDG
8UDQXVPHHWV(ULVLQ&HWXVDVERXQGIRU0D\DQ57557LQVLGH

$'''2:1/2$'72&$57 

7KHUG6HDORIWKH$SRFDO\SVH HERRN 

'RZQORDG
7KHUG6HDORIWKH$SRFDO\SVH$OUHDG\+LSSDUFKXVZDUQHGWKH*UHHNDVWURORJHUVIRUWKHHSRFKEXWWKRVHEHDULQJWKH
PDUNRIWKHEHDVWFDQQRWKHDUNHQWRWUXWK+LSSDUFKXVKDVVXUHO\XSGDWHGWKHVWDUU\YDXOWIRUSUHFHVVLRQ$IWHU
+LSSDUFKXVRQO\WKHDVWURQRPHUVNHSWULJRURXVXSGDWH7KXVDVWURQRP\LVDUHOLDEOHVFLHQFHXSWRWKLVGD\ZKLOH
SVHXGR DVWURORJ\DPDVVHGHUURUWRZDUGVDQDPD]LQJTXDUWHURIWKHVN\IRURXUPRGHUQFRPSXWHUL]HGVRFLHW\1DPHO\
VRFDOOHGDVWURORJLFDOSURJUDPVVHH&DSULFRUQULVLQJZKHUH3LVFHVDUHDVFHQGLQJPXFKDV6XQLQ9LUJRLV
LQWHUSUHWHGDV6XQLQ6FRUSLR0XFKDVWKHVSHOOLQJIRU&DSULFRUQXVRU6FRUSLXVLVZURQJVRLVWKHUHVW:KLOHWKH
SUHVHQWSVHXGRDVWURORJLFDOHUURUPLJKWDPRXQWWRDTXDUWHURIWKHVN\WKHPLVFRQFHSWLRQLVXQSDUGRQDEOHDVWRPDNH
DOO(XURSHDQDVWURORJ\XVHOHVVDIWHU+LSSDUFKXV%XUQLQJDOOWKRVHERRNVZRXOGGRPXFKJRRGWR(XURSHDQGWKH
ZRUOG7KHSUHVHQWDSRFDO\SVHZLOODODVSXUJHPXFKPRUHWKDQPHUHERRNV

$'''2:1/2$'72&$57 

/DWWHU'D\V HERRN 

'RZQORDG
,I9HQXVLQ+\GUDVWDQGVIRUWKH$QWLFKULVWWKHQ9HQXVLQ6FXWXPLVWKHODG\RIWKHDSRFDO\SVH7KH/DWWHU'D\VUHVXPH
WKHRPHQVIURPWKHDSSHDUDQFHRIDVWDUOHVVKROHLQVSDFHWR$UPDJHGGRQ7KHUHLVDVQDNHRQWZROHJV
LQ/HEDQRQ
$'''2:1/2$'72&$57 

,&KLQJDQGWKH%LEOH HERRN 

'RZQORDG
,&KLQJWUDQVLWVIRUWKHDVWURORJHU/HDUQKRZWRXVH,&KLQJLQSUHGLFWLQJLVVXHVDORQJZLWKSRSXODUDVWURORJLFDO
GLUHFWLRQVDQGWUDQVLWV,&KLQJLVDQLQWHJUDOSDUWRIWKHUHIRUPHGDVWURORJLFDORSHUDWLQJV\VWHPIRUWKH$JHRI&HWXV
EDVLFOHVVRQVIRUWKHPRGHUQDVWURORJHU

$'''2:1/2$'72&$57 

/LOLWKWKH2EVHUYHG'DUN0RRQ PXOWLPHGLDGRZQORDG

'RZQORDG
'DUN3ODQHWVLQVLGH'DUNPRRQ/LOLWKDVREVHUYHGE\&DVVLQL$VWURORJLFDODQGRFFXOWLQWHUSUHWDWLRQRI&DVVLQL/LOLWKRU
/,/,79(5$WKH(XURSHDQGDUNPRRQSDUH[FHOOHQFH(GLWLRQZLWKERQXVPLQXWHE\PLQXWH0RRQHSKHPHULGHVIRU\RXU
VXPPHUWLPHORYHV'LJWKDWEHDFK0RRQLQ2ULRQ6SHFLDO/LOLWK &4 HSKHPHULVVHULHVLQWKHDSSHQGL[IRU
FRPSOHWHWUDFNLQJRIREVHUYDEOHVXPPHU/LOLWK

$'''2:1/2$'72&$57 

3HUVRQDO&RVPLF$YDWDUIRU&KULVWLDQV HERRN

'RZQORDG
:KHQLQQHHGRIDIDYRUIURPDERYHZKHUHFDQ\RXJR"3HRSOHEHOLHYHLQIDLULHVKROGRQWRWKHLUOXFN\FKDUPVRUWDONWR
WKHLUIDYRULWHPDVKLHDQGLWZRUNV,IDOXFN\FKDUPFDQJDLQPDMRUDGYDQWDJHIRU\RXLPDJLQHZKDW\RXFDQDFKLHYHLQ
DOOLDQFHZLWK*RG
VRZQVHFUHWDU\,WPXVWEHKDUGWRLPDJLQHRPQLSRWHQFHDVPDQ\FDQQRWHYHQLPDJLQHJHWWLQJRYHU
WKHZHHNHQGEXWWKDWLVZKDW\RXJHWZLWKXV7KHWKLQJVZHGRIRU\RXLQFOXGHRPQLSRWHQFHGLWWR7KH3&$LQLWLDWLRQ
LQFOXGHVWKHSUDFWLFDOWKHRORJ\RILQVWDQWPDJLFN'LVFRYHU\RXURZQEXUQLQJEXVKZLWKWKH3HUVRQDO&RVPLF$YDWDUIRU
&KULVWLDQV2WKHUUHOLJLRQVZHOFRPHDVLQFOXGHG

$'''2:1/2$'72&$57 

3ODQHWRFHQWULF$VWURORJ\ HERRN

'RZQORDG
$VFLHQWLILFDVWURORJ\FODVVLF+RZZLOODVWURORJ\ORRNOLNHLQWKHIXWXUH")XWXUHLVQRZZLWKWKHH[SHULPHQWDO
SODQHWRFHQWULFVFDQV'LVFRYHU6XQLQ&\JQXVRU$TXLODDVRXUERDUGFRPSXWHUWDNHVXVDURXQGWKHVRODUV\VWHPDQG
WKURXJKWKHORFDO]RGLDFV(ULVDQGWKH;]RGLDFLQVLGH$GYDQFHGLQVSLULQJPDWHULDOIRUWKHVFLHQWLILFDVWURORJHU

$'''2:1/2$'72&$57 

$FDGHPLF=RGLDF HERRN

'RZQORDG
1DYLJDWHWKHFRQVWHOODWLRQVRIWKHDFDGHPLF]RGLDFDORQJZLWKWKHHDVWHUQDVFHQGDQWVWRZDUGVWKHODWWHUGD\V
6XEPHUJHLQWR\RXUVXEFRQVFLRXVDVFHQGDQWV'LVFRYHUWKHPLVVLQJFKHUXELQ\RXUKRURVFRSH*RVVLSRQ ³G$LZDVV´
*HWDIXOOSLFWXUHRI(ULV:LWFKDOORZLVWKHVWDUOHVVKROHLQ\RXUKRURVFRSHWKH:0$3FROGVSRWLQDVWURORJ\7KHVWXG\
IHDWXUHVDGHWDLOHGUHSRUWRIWKH$UPDJHGGRQ

$'''2:1/2$'72&$57 

&DW:DUV PXOWLPHGLDGRZQORDG

'RZQORDG
... 2EDPD6XESULPH0RUWJDJH&ULVLV:DWHU:DUV:RUPZRRG$SRFDO\SVH 3') 
DQLPDWLRQV 3XVVLQ%RRWVWDNHVDJLDQWOHDSIRUZDUGV7KH0RRQREYLRXVO\VWDQGVIRUERRWVDQGPRYHPHQW7KLVLV
OLNHWKH1LQHRI:DQGV7KHKLQGOHJVRIWKHVSKLQ[DUHDFRPSDUDWLYHO\UDUHDVFHQGDQW7KHKLQGOHJVRI/HRDUHWKH
DVFHQGLQJSDUWRIWKLVFRQVWHOODWLRQ$OUHDG\LQWK3ODQHWIRU3HWVZHKDYHGHVFULEHGWKHLQIOXHQFHRIWUDQVQHSWXQLDQ
REMHFWVDVZHOODVSODQHWFDQGLGDWHVRQWKHQDWLYLW\RI\RXUSHW7KHUHLVVXHZDV$PHULFDQ3HW$VWURORJ\)HOLQH
DVWURORJ\KDVULFKIXWXUHDVEDVHGRQDQFLHQWFXOWV3HWVKDYHEHHQZRUVKLSHGFXUHGSDPSHUHGDQGKRURVFRSHGE\
WKH&KLQHVHDQG(J\SWLDQVDVZHOO7KHSHWGHVHUYHVLWVWUXHQDWDODVFHQGDQWDVZHOODVDFFXUDWHSUHGLFWLRQ7KHVWDUV
DUHFDWIRRGLIZHLQWHUYLHZ'LDQDRIWKH&DWV&DWVDVVLVWZLWFKHVDQGDOVRQDWLRQV

$'''2:1/2$'72&$57 

6HUSHQV PXOWLPHGLDGRZQORDG

'RZQORDG
:K\LV2EDPDGDQJHURXV"7KHZHVWHUQGHVFHQGDQWLVLQPDVRQLF6H[WDQV2EDPDLVFRQIURQWHGZLWKKLVPDVRQLF
DVWURORJHUDV6H[WDQVLVWKHEDVLF]RGLDFDOFRQVWHOODWLRQWKHFRUQHUVWRQHRIWKH$FDGHPLF=RGLDFDQGLQFLSLHQWVWHOODU
EDVLVRIWKH]RGLDFDOUHIRUPDWLRQ5HSWLOLDQDQDO\VLVRIWKHKRURVFRSHLQWHUSOD\EHWZHHQGLDEROLF,WDO\DQGPDVRQLF
86$ZLWKWKH0HVVLDKDVWRUQEHWZHHQWKHWZR(QJOLVKYV,WDOLDQHGLWLRQ$QLPDWHG9HQXVLQ2ULRQIRU2EDPD
DVWURORJHUV1$6$-3/PLQXWH9HQXVHSKHPHULV7KLVHGLWLRQIHDWXUHVDQDQLPDWHG0RRQLQ&HWXVDQJXODUVHFRQGDU\
GLUHFWLRQIRU+LOODU\&OLQWRQ

$'''2:1/2$'72&$57 

2EDPDLQWKH6WDUV PXOWLPHGLDGRZQORDG

'RZQORDG
2EDPDDVWURORJ\WDNHVDIXUWKHUVWHSZLWKWKLVUHIHUHQFHSXEOLFDWLRQ'HWDLOHGPDSVRIWKHUHDOVN\KLQWVSUHFLVH1$6$
HSKHPHULVIRU9HQXVLQ2ULRQDQGWKHVWDQGDUGREMHFWLYHQHVVRIWKH$FDGHPLF=RGLDF2XUGLJLWDOHGLWLRQVFRPELQH
SULQWDEOH3')ZLWKDQLPDWLRQV

$'''2:1/2$'72&$57 

$[LVRI(YLO PXOWLPHGLDGRZQORDG

'RZQORDG
7KHLQIOXHQFHRIWKH$[LVRI(YLODQGVXSHUYRLGVRQWKHJOREDODQGSHUVRQDOKRURVFRSH 3')

$'''2:1/2$'72&$57 

7ULQLW\ PXOWLPHGLDGRZQORDG

'RZQORDG
=RGLDFDOWULQLW\UHYHDOHG([SORUHWKHQRUWKHUQSDUWRIWKH]RGLDFZLWK9HQXVLQ3HJDVXV/HDUQWKHVHFUHWVRI9HQXVLQ
+\GUD7KH]RGLDFDVGHILQHGDJDLQVWLWVPXOWLGLPHQVLRQDOEDFNJURXQG

$'''2:1/2$'72&$57 

0RQNH\%XVLQHVV PXOWLPHGLDGRZQORDG

'RZQORDG
7KH)HGLVDERXWWRFROODSVHDVLQWLPDWHGE\RXUSUHYLRXVSUHGLFWLRQVDQGQRZSXUSRUWHGE\HFRQRPLVWVDOORYHUWKH
ZRUOG1RERG\H[SHFWHGVXFKDGLVDVWHUEXWWKHUH\RXKDYHLW$QLPDWHG$FDGHPLF=RGLDFLQVLGH

$'''2:1/2$'72&$57 

6XESULPH0RUWJDJH&ULVLV PXOWLPHGLDGRZQORDG

'RZQORDG
6XESULPHPRUWJDJHFULVLVDVVHHQE\WKHDQDO\WLFH\HRIVFLHQWLILFDVWURQRPLFDOSUHGLFWLRQ&ULVLVSHDNVIRUDQG
DVQHVWHGLQWKHPLGVWRIWKHDSRFDO\SWLFWLPHV ± SS3') 

$'''2:1/2$'72&$57 

:RUOG'LDU\ HERRN

'RZQORDG
$VWKHWKLUGVHDORIWKHDSRFDO\SVHOLHVEURNHQLQ*D]D:RUOG'LDU\IRFXVHVRQWKH$QDNLPJLDQWVIURPWKH%LEOHWKDW
KDGWKHLUODVWVWDQGLQ*D]DRQRFFDVLRQRIWKHFXUUHQWHYHQWVDVZHOODVWKH9HQXVDQG6DWXUQHFOLSVHV7KH:RUOGLDU\
LVDVHULHVRIHGLWRULDOORJVIRFXVLQJVFLHQWLILFDVWURORJ\RQVSHFLILFWKHPHV

$'''2:1/2$'72&$57 

6HUSHQV HERRN

'RZQORDG
+HZKRFRQWUROVWKHVQDNHLVWKH0HVVLDK,WDO\DQGWKH86$VKDUHWKHRSSRVLWHSDUWVRIWKHVDPHDVFHQGDQWDORQJ
ZLWKWKHPDUNRIWKHUHSWLOHWKDWVXUURXQGVWKHDFWXDO0HVVLDK

$'''2:1/2$'72&$57 

0DWUL[+DFNLQJ PXOWLPHGLDGRZQORDG
'RZQORDG
7KH\OLHGWR\RX+DFNWKHHYHQWKRUL]RQZLWKWKH5HDO7LPH5HDOLW\5HQGHULQJ7RROVZKLOHGLVFRYHULQJ\RXUWUXHVHOI
7UXHVHOILVLQVWDQWPDJLFNDVIDOVHLGHQWLILFDWLRQVGLVVROYHIRUHYHU

$'''2:1/2$'72&$57 

%LEOH:RUNV,,, HERRN 

'RZQORDG
7KH/25' *2' IRUEDGH&KDOGHDQDVWURORJ\WRKLVFKRVHQRQHVKRZHYHUDVWURQRP\ZDVDOZD\VDSOHDVXUHZLWKWKH
FKRVHQSHRSOH&DQZHQRWUHMRLFHLQRXU758(1$7$/6.,(6DVFUHDWXUHVRIOLJKW"3UHFHVVLRQSOD\VWKHPDLQUROHLQ
WKHUHGHPSWLRQRIDQROGVXSHUVWLWLRQDVLPSRVHGE\WKH'HYLOWKHIL[HGVN\WKDWQHYHUGLGH[LVWLQWKHILUVWSODFH 

$'''2:1/2$'72&$57 

6FLHQWLILF$VWURORJ\%LEOH HERRN 

'RZQORDG
7KH]RGLDFKDVFRQVWHOODWLRQVZKLOHWKHQXPEHURIDVFHQGDQWVLVIRUWKHHSRFK2SHQDQH[FLWLQJZRUOGPDGHRI
QHZ]RGLDFDOFRQVWHOODWLRQVH[RWLFDVFHQGDQWVJLDQWFRPHWVGZDUISODQHWVDQGIDVFLQDWLQJDVWURORJLFDOSHUVSHFWLYH
57557LQVLGH

$'''2:1/2$'72&$57 

+ROHRI'RRP HERRN 

'RZQORDG
7KH:0$3&ROG6SRWLVDVWDUOHVVDUHDLQWKHFRQVWHOODWLRQRI(ULGDQXVWKDWFKDOOHQJHVRXUWKHRULHVDERXWWKHXQLYHUVH
7KHH[DPSOHVLQFOXGHQDWDOKRURVFRSHVZLWKWKHVXSHUYRLGULVLQJLQ(ULGDQXV(ULGDQXVLVRQHRIWKHHDVWHUQ
FRQVWHOODWLRQVWKDWDUHDVFHQGLQJLQGXHHDVWDWWKHSUHVHQWHSRFK7KHILUVWSXEOLFDWLRQDERXWWKHJLDQWKROHLQVSDFH
GHDOVZLWKORFDWLQJDVZHOODVKRXVLQJWKHKROHLQWKH1LJKW 'D\KRXVHV\VWHP

$'''2:1/2$'72&$57 

$,21 HERRN 

'RZQORDG
'RHVWKH\HDUPDUNWKHPHVVLDQLFGHDGOLQH"$SDVVDJHIURPWKH+RO\%LEOHVHWVWKHODVWGD\VYHU\FORVHWRWKH
0D\DQSURSKHF\$,21LVDQXSGDWLQJSUHYLHZRIDZRUNLQSURJUHVVFRQWDLQLQJWKHFDOFXOXVDVZHOODVVFLHQWLILF
DVWURORJ\UDWLRQDOH7KH$JHRI&HWXVLVDWLWVSHDNZLWK$,21LQ

$'''2:1/2$'72&$57 

+RO\:DUV HERRN 

'RZQORDG
$QDVWURORJLFDOGLDU\RIWKHDSRFDO\SVHZLWKSHUSHWXDOXSGDWH&RPHWVVLJLOVRPHQVVFLHQWLILFDVWURORJ\PDSVZDU
SUHGLFWLRQV,VUDHO,UDT0RRQLQ$XULJDDQGWKHSRUWHQWVIRU3UHYLHZRIDIRUWKFRPLQJSXEOLFDWLRQ 7KHZRUNLQJ
ILOHVDOOXGHDWSROLWLFDODVZHOODVZDULVVXHVGXHWRSODQHWDU\PRWLRQ

$'''2:1/2$'72&$57 

&KDULNOR HERRN 

'RZQORDG
&KDULNOREHVWRZVORYHDQGEHDXW\LQ\RXUKRURVFRSH

$'''2:1/2$'72&$57 

$VWURORJLFDO/HJDF\,,, HERRN 

'RZQORDG
7KHFRPSOHWHVWHOODUHTXLSPHQWIRUWKH&KULVWLDQVFLHQWLVW

$'''2:1/2$'72&$57 

$VWURORJLFDO/HJDF\,, HERRN
'RZQORDG
7KHEDFNERQHRIPRGHUQDVWURORJ\FRQVLVWVRIWKUHHEDVLFSLOODUV  7KH$FDGHPLF=RGLDFŒZLWKLWV,$8
FRQVWHOODWLRQV 7KH3UHFHVVHG$VFHQGDQWŒVHWFRQWDLQLQJ,$8FRQVWHOODWLRQV 7KH1LJKW 'D\ŒKRXVH
V\VWHP

$'''2:1/2$'72&$57 

$VWURORJLFDO/HJDF\, HERRN

'RZQORDG
$FRPSOHWHPDQXDOLQVFLHQWLILFDVWURORJ\,$8]RGLDFDOVWDWLRQVSUHFHVVHGDVFHQGDQWV&DUWHVLDQKRXVH
V\VWHP%LEOLFDOSXUSRUW%RQXV3ODQHWRFHQWULF$VWURORJ\

$'''2:1/2$'72&$57 

$FDGHPLF=RGLDF HERRN

'RZQORDG
$QDGYHQWXUHKDXQWHGZLWKWKHFRQVWHOODWLRQVRIWKH$&$'(0,&=2',$&SURSRVHVWKHFKDOOHQJHRIWKH($67(51
$6&(1'$176$PXVWIRUWKHDFDGHPLFDVWURORJHU

$'''2:1/2$'72&$57 

3URIHVVLRQDO$VFHQGDQWV6HW HERRN

'RZQORDG
$VWURORJHUVWKDWDUHHDJHUWRJHWDKHDGRIWKHSDFNDORQJZLWKWKHXOWLPDWHVFLHQWLILFDVWURORJ\VWDQGDUGVZLOOXVHWKH
SUHVHQWHDVWHUQDVFHQGDQWVVHWLQSURGXFLQJYHULWDEOHKRURVFRSHVWRWKHGHWULPHQWRIVXSHUVWLWLRQWKDWKDVKDXQWHG
(XURSHDQDVWURORJ\IRURYHU\HDUV,QEHLQJSRVLWLYHWKDWHYHQ+LSSDUFKXVZRXOGFRPSOLPHQWVXFKDVWURORJHUVZH
SUHVHQW\RXZLWKWKHVLJLOVIRUWKHDVFHQGDQWVHWDVGHVLJQHGE\.ODXGLR=LFLQSHUVRQ%RQXV57557LQLWLDWLRQ

$'''2:1/2$'72&$57 

$FDGHPLF+RURVFRSH HERRN

'RZQORDG
7KHFRPSOHWHPDQXDOIRUWKHDFDGHPLFDVWURORJHUIHDWXUHVWKH]RGLDFDOFRQVWHOODWLRQVDVFHQGDQWVDQG1LJKW 
'D\KRXVHV\VWHP$FROOHFWRU
VLWHPWKDWZLOOPDNHDSDQRSWLFVWXG\IRUWKHDVWURORJ\HQWKXVLDVW'LG\RXNQRZWKDW
«RQHRIWKHFKHUXELFFRQVWHOODWLRQVLVPLVVLQJDWHDVW":KLFKFKHUXELFFRQVWHOODWLRQLVPLVVLQJDQGZK\"7KH
FKHUXELFFRQVWHOODWLRQVDUH/HR6FRUSLXV7DXUXVDQG$TXDULXV2QHRIWKHPLVPLVVLQJDWHDVWDQGZHDUHDERXWWR
LQVSHFWZKLFKRQHDQGZK\!!

$'''2:1/2$'72&$57 

6XEFRQVFLRXV=RGLDF7KH6HFUHWVRIWKH$FDGHPLF=RGLDF HERRN 

'RZQORDG
7KHPRVWLQIDPRXVH[DPSOHRI6WDU*DWHDVWURORJ\LV2VDPDELQ/DGHQDQGWKH:7&ZLWK0RRQLQ2ULRQ7KHUHLVD
ZKROHIRUHVWRIUHIHUHQFHWR2ULRQ6WDU*DWHLQDVWURORJ\DQGPDJLFNIURP/DG\'LDQD)UDQFHV6SHQFHU3ULQFHVVRI
:DOHVWRSRSH5DW]LQJHUDVFKDULVPDWLFSHRSOHWHQGWRKDYHSURPLQHQWSODQHWVDWWKHLU6WDU*DWH:K\LV3ULQFH:LOOLDP
FDOOHGWKH/$6781,&251"7KHUHDUHDVFHQGDQWVLQDVWURORJ\RIZKLFK0RQRFHURVWKHXQLFRUQLVRQH7KH
6WDU*DWHRIKHOOKDGLWVFRXQWHUSDUWQRZWKHUHLVDVWDUOHVVDQGELEOHEODFN:KDWVHFUHWVDUHNHSWEHKLQGWKHJDWHVRI
:LWFKĎOORZ"

$'''2:1/2$'72&$57 

$FDGHPLF=RGLDF HERRN

'RZQORDG
7KH$FDGHPLF=RGLDFKDVEHHQLQWURGXFHGLQ$XJXVW+HUHLVWKHGHWDLOHGDFFRXQWDERXWWKH,$8FRQVWHOODWLRQV
RIWKH]RGLDFDQGWKHLUFRXQWHUSDUWVWKHSUHFHVVHGDVFHQGDQWVIRUWKHHSRFK

$'''2:1/2$'72&$57 

$FDGHPLF$VWURORJ\ HERRN 

'RZQORDG
7KH6FLHQWLILF$VWURORJ\,QVWLWXWHSUHVHQWVWKHILUVWOHVVRQVLQVFLHQWLILFDVWURORJ\7KHEDVLFWUDLQLQJPHWKRGIHDWXUHVWKH
VWXG\RIWKHORFDO]RGLDFDVZHOODVDVFHQGDQWVHWIRUDQ\JLYHQORFDWLRQDVWKHLQFLSLHQWDVWURORJ\VWXGHQWLVHQFRXUDJHG
DVZHOODVWHVWHGDFFRUGLQJWRWKHODWHVWVWDQGDUGVLQVFLHQWLILFDVWURORJ\7KHDEVWUDFWVLQFOXGHDQH[WHQVLYHGLVFXVVLRQ
FRQFHUQLQJWKH,$8]RGLDFDOFRQVWHOODWLRQVWKHSUHFHVVHGDVFHQGDQWVIRUWKHFXUUHQWHSRFKDQGDVXEVLGLDU\VHW
RIDVFHQGDQWVIRU%&(VVHQWLDOUHDGLQJIRUWKHVFLHQWLILFDVWURORJHU7KRVHLQSRVVHVVLRQRIWKLVGRFXPHQWIDUH
WKRXVDQGVRI\HDUVDKHDGRIWKHDVWURORJLFDOSDFN

$'''2:1/2$'72&$57 

7KH*ROGHQ0RQNH\ PXOWLPHGLDGRZQORDG

'RZQORDG
2IWKHIROORZLQJ\HDUVVRPHDUHJROGHQDQGVRPHDUHQRWVRPHGDQJHURXVDQGRWKHUVIDWDO,WLVWKHDVWURORJLFDOO\
XQIDVKLRQDEOH\HDUVWKDWWDNHWKHLPSDFWRIGRRPSHUKDSVDOZD\VDIWHUWKHSUHYLRXV\HDUVHDOHGWKHDIRUHPHQWLRQHG
GLVDVWHU

$'''2:1/2$'72&$57 

0RQNH\%XVLQHVV PXOWLPHGLDGRZQORDG

'RZQORDG
7KHLQWURGXFWLRQWRWKHILQDQFLDO\HDUFDVKHVRQSRVLWLYHRPHQVLQRUGHUWRSUHGLFWWKHILQDOFRXQWGRZQIRUWKH
)HGHUDO5HVHUYH6\VWHPDOUHDG\SUHGLFWHGE\.ODXGLR=LFLQHDUO\7K:KHQWKH\PD\VD\3HDFHDQG
VDIHW\WKHQVXGGHQGHVWUXFWLRQFRPHVXSRQWKHPDVWUDYDLOXSRQKHUWKDWLVZLWKFKLOGDQGWKH\VKDOOLQQRZLVH
HVFDSH!!6XESULPHPRUWJDJHFULVLVWDNHVDILQDOWXUQLQWKH\HDU

$'''2:1/2$'72&$57 

6XEFRQVFLRXV$VFHQGDQWV PXOWLPHGLDGRZQORDG

'RZQORDG
7KHSUHVHQWDVFHQGDQWVHWVSHDNVODQJXDJHV6RPHRIWKRVHDUHVXEOLPLQDOPHVVDJHV6XEPHUJHLQWRWKHVHFUHWV
RIWKHVXEOLPLQDODVFHQGDQWVDQGVXEFRQVFLRXV]RGLDFDOVWDWLRQV7KLVSXEOLFDWLRQLVDIXUWKHULQYLWDWLRQLQWRWKH
$FDGHPLF=RGLDFDVZHOODVWKHILQDOUHILQHPHQWRIWKHDVFHQGDQWVHWIRUWKHFXUUHQWHSRFK$OLFHKDVPRRQULVLQJLQ
&HWXV0HUFXU\LQ6H[WDQV9HQXVLQ2ULRQ-XQRLQ6FXWXPDQG3OXWRLQ6HUSHQV&DXGD:KDWDUH\RXUWUXHSODQHWDU\
SRVLWLRQVLQ\RXURZQFKLOG
VKRURVFRSH",V\RXUDVFHQGDQWVXEFRQVFLRXVWRR"

$'''2:1/2$'72&$57 

5HSWLOLDQ$VWURORJ\ HERRN 

'RZQORDG
$VDWZROHJJHGVQDNHIURP/HEDQRQLVEHLQJVWXGLHGE\VFLHQWLVWVZHUHSUHVHQWWKHUHSWLOLDQFRQVWHOODWLRQVZLWKLQWKH
DFDGHPLF]RGLDFIUDPH)URPFODVVLFVOLNH9HQXVLQ+\GUDWR3OXWRLQ6HUSHQV&DXGD WKHDVFHQGDQWRIWKH86$ WKH
DFDGHPLF]RGLDFUHWXUQVWRLWVURRWVDORQJZLWKERQXV9HQXVHSKHPHULV :KLOHWKH86$VWLOOIHHOVWKH*ULS
RI2VLULV9HQXVHQWHUV+\GUD6WLOOKDYLQJGRXEWVDERXW\RXU9HQXVLQ+\GUDRUWKHSDUWQHU
V9HQXVLQ3HJDVXV"7KH
LQWURGXFWLRQWRUHSWLOLDQDVWURORJ\LQFOXGHVWKHGHOLQHDWLRQIRU9HQXVLQUHSWLOLDQFRQVWHOODWLRQV.QRZ\RXUSDUWQHU
V
UHSWLOLDQ9HQXVQRZ8SGDWHGZLWK1LELUXUHVHDUFK

$'''2:1/2$'72&$57 

$VWURORJ\LQ/RYHDQG:DU HERRN 

'RZQORDG)5((
:HLQVWLQFWLYHO\ORRNXSRQ0DUVDVLQFKDUJHRIDOORXUZDUVDOEHLWWKHDQFLHQWDUPLHVZHUHOHGE\9HQXVDQGLQWRYLFWRU\
(YHQWKHGHFDGHQW*UHHNFXOWXUHNQHZ9HQXV1,.+DVYLFWRULRXVDQGLWLVE\SURQRXQFLQJWKH+LQ1,.+OLNHDORQJ(
WKDWZHFDOO\RXUVQHDNHUVYLFWRULRXV
'RZQORDGIRU)UHH 

3HUVRQDO&RVPLF6HFUHWDU\ 5HDO7LPH5HDOLW\5HQGHULQJ7RROV HERRN 

'RZQORDG
,QVWDQWPDJLFNKDVQHYHUEHHQVRLQVWDQW'RQ
WZDLWIRUWKDWEDGWUDQVLWWRKDSSHQ&KDQJH\RXUIXWXUHQRZ

$'''2:1/2$'72&$57 

5HERRW HERRN 

'RZQORDG
7KH57557QDWXUDOO\GHYHORSIURPWHFKQLTXHWRWHFKQLTXHDVWKHVSLULWRIWKHWLPHUHTXLUHV7KHODWHVWLQWURGXFWLRQE\
WKH]HLWJHLVWIRFXVHVRQWKHUHOLJLRXVLPSOLFDWLRQVRIRPQLSRWHQFHRQWKHSDUWRIWKHLQGLYLGXDO7KHDSSOLFDWLRQVIRFXV
RQKHDOLQJFDQFHUZLQQLQJDWORWWHU\JHWWLQJDXGLHQFHSDVVLQJDQH[DPPDUU\LQJWKHLGHDOSDUWQHU7KHPHFKDQLFDO
WRROVDUHTXLWHLQFDSDEOHRIFRQWDFWLQJWKH63,5,7DVQRWHOHSKRQHFDQUHDFKLW$IXUWKHULQLWLDWLRQLQ,167$170$*,&.
HODERUDWHVRQWKHPRUDOSUREOHPRI\RXUQHZO\DFTXLUHG201,327(1&(DVZHOODVWKHODZIXOQHVVRILQVWDQWPDJLFN
ZLWKLQWKH-XGHR&KULVWLDQIUDPHZRUN&DQRQHEULQJDERXW,167$17(9,/LQVWHDGRIJRRGDQGZK\QRW"'RHVWUXH
PLQGKDYHDQ\ZLVKDWDOO",VLWULJKWWRPHGGOHLQWR*RG
VRZQZRUNVKRS",QRUGHUWRPDNHLQVWDQWPDJLFN675((7
/(*$/ZHKDYHDQVZHUHGWKHKRWTXHVWLRQVE\RXULQTXLVLWLYHLQLWLDWHV%RQXV2,5,6ZLWKFRPSOHWH57557 5HDO7LPH
5HDOLW\5HQGHULQJ7RROV ,QVWDQW3HUVRQDO0DJLFN LQLWLDWLRQLQVLGH

$'''2:1/2$'72&$57 

7KH6ZHHWQHVV:LWKLQ$0DQXDOLQ,QVWDQW0DJLFN5HDO7LPH5HDOLW\5HQGHULQJ7RROV HERRN 

'RZQORDG
7KHNH\ZRUGLVWKDWWKHUHLVQRVHWSURFHGXUH<RXPD\JRIRUDVWUROODQGPHHWDOL]DUGWDONWRKLP,I\RXDUH$OLFHLQ
:RQGHUODQGHYHU\WKLQJLVSRVVLEOHLI\RXDUHQRWDZRQGHUFKLOGDQ\PRUHSOHDVHUHWRXFKZLWKLWVLQFHWKHUHLVQRXVHWR
DPDVVPDJLFNERRNVLQRUGHUWREHEHWWHU $JRRGZD\WRNLOODOOPDJLFNLVWREXU\RQHVHOIXQGHUDS\UDPLGRI
JULPRLUHVZLVHERRNVDQGKRO\ERRNVERRNVWKDWXOWLPDWHO\SURGXFHZDUDQGVXIIHULQJ%RRNSHRSOHWHQGWREHFRPH
VHULRXVOHDUQHGH[SHUWDQGXOWLPDWHO\ERRSHRSOHZHDULQJJXQVZKLOHSUHDFKLQJERRNJRGVRYHUDPLVVLOH
ODXQFKHU7KHSHUVRQDOFRVPLFVHFUHWDU\LVQRWDERRNJRG,WRUVKHRUKLPLVZH:HDUHDOLYH:HDUHQRWERRN
FKDUDFWHUVRUGHDGNQRZOHGJH:HWDONWRWKHZLQGPXFKDV0RVHVGLG+RSHIXOO\0RVHVGLGQRWEURZVHWKURXJKD
PDQXDOWRWDONWRWKHZLQGLQDSURSHUZD\

$'''2:1/2$'72&$57 

3XEOLFDWLRQV HUYLFHVE\.ODXGLR=LF HERRN 

'RZQORDG
0DUULDJHDQGFKLOGELUWKWLPLQJ'\QDPLFV\QDVWU\5HODWLRQVKLSG\QDPLFV*RRGDQGOHVVIDYRUDEOHSHULRGVIRU\RXU
SDUWQHUVKLS7UXHQDWDODVFHQGDQWGHVFHQGDQWFDUGLQDOSRLQWVZLWKWKHLUDSSURSULDWHFRQVWHOODWLRQV7KHGZDUISODQHWV
LQWKHLUQDWDOSRVLWLRQV*LDQWWUDQVQHSWXQLDQREMHFWVFHQWDXUV$SRKHOHV(DUWKFRRUELWDOV*UDSKLFDVWURQRPLFVFDQVLQ
3')IRUPDW:KHHOFKDUWDQGOLVWLQJIRUDOOWKHREMHFWVRILQWHUHVWRQVSHFLDOGHPDQG6KDOO,VLJQWKLVFRQWUDFW"
%XVLQHVVDQGKRUDU\DVWURORJ\)DFXOWDWLYHLQLWLDWLRQLQWRWKHUHDOWLPHUHDOLW\UHQGHULQJWRROV6FDQFUHDWHDQGFKDQJH
\RXURZQIXWXUH'LVFUHDWHWKHEDGWLPHVDKHDGZKLOHLQVWDOOLQJWKHIXWXUHRI\RXURZQFKRLFH

$'''2:1/2$'72&$57 

YHUVXV+\GUD HERRN 

'RZQORDG
YHUVXV+\GUDPDUNVWKHEHJLQQLQJRIWKHZRUNRQV\QDVWU\EHWZHHQWKHDVFHQGDQWV 7KHFRPSOHWHZRUNGHDOV
ZLWKDOOSRVVLEOHUHODWLRQVKLS[ DWWKHSUHVHQWHSRFK

$'''2:1/2$'72&$57 

&HWXV,,, PXOWLPHGLDGRZQORDG

'RZQORDG
DQGWKH$JHRI&HWXV8UDQXVHQWHUV&HWXVWRZDUGV0D\DQ

$'''2:1/2$'72&$57 

(ULV8QOHDVKHG HERRN 

'RZQORDG
(ULV8QOHDVKHGLQWKHKRXVHVRIWKHKRURVFRSHZLWKFRPPHQWDULHV

$'''2:1/2$'72&$57 

(ULVLQWKH+RXVHV HERRN 

'RZQORDG
(ULVLQWKHDVWURORJLFDOKRXVHV

$'''2:1/2$'72&$57 

'ZDUI3ODQHWVIRU&KULVWLDQV HERRN 

'RZQORDG
)DOOHQ$QJHO,WLVHDV\WRLPDJLQHKRZDJORULRXVDVFHQWLQWR3HJDVXVLVPHWE\DGHHSGHVFHQWLQWR&HWXV7KHVKLQ\
DQJHOKDVGURSSHGLQWRWKHVHD&HWXVLVRQHRIWKH%LEOLFDOZDWHU\PRQVWHUVSUREDEO\LPSRUWHGIURP6XPHULDQORUH
9HQXVLQ+\GUDDQGWKHELUWKRIWKH$QWLFKULVW7KHGZDUISODQHWVDVIDOOHQDQJHOV%RQXV(SLVWOHWR6DWDQ
$'''2:1/2$'72&$57 

&KULVWLDQ$VWURORJ\IRUWKH<HDURIWKH$QWLFKULVW HERRN 

'RZQORDG
PD\EHWKHILQDOWHVWIRUWKH&KULVWLDQUHOLJLRQ/HWXVEHKRQHVW$VWURQRP\NQRZVEHWWHU:HXVHGDVWURQRP\WR
GHWHFWWKH$QWLFKULVWVLQFHQRDVWURORJLFDOSURJUDPZLOOVFDQIRU9HQXVLQ+\GUDDVWURORJ\LQVLGH%LEOLFDOJLDQWV
WKHVWDURI%HWKOHKHP0D]]DURWK]RGLDFDOUHIRUPDWLRQZLWK9HQXVLQ+\GUDDQG-XSLWHULQ2SKLXFKXVDORQJZLWK
(ULVDQGWKHGZDUISODQHWV

$'''2:1/2$'72&$57 

6DWDQ
V7UDSGRRU HERRN 

'RZQORDG
$QWLFKULVWZDWFKIRU9DWLFDQIRUPLG$XJXVW7KHSUHHPSWLYHFDOFXOXVGHWHUPLQHVWKHKRXUDVZHOODVWKHPLQXWHRI
WKHLQILOWUDWLRQ6DWDQSHUIRUPVZLWK9HQXVLQ6H[WDQVWKHDVFHQGDQWRI9DWLFDQ&LW\$QH[DPSOHLQKRUDU\DVWURORJ\
VHUYLQJDVSXUSRUWWRWKH+LOOVRI+\GUDSXEOLFDWLRQVHULHVDERXWWKH$QWLFKULVWDW9DWLFDQ&LW\%HVLGHVEHLQJ
WHFKQLFDOO\VRSKLVWLFDWHGVFLHQWLILFDVWURORJ\SURYHVWREHIXQDQGFRRSHUDWLYHZLWKVXFKHPLQHQFHDV,&KLQJDQGWKH
7DURW7KHQRWHVDORQJZLWKFRSLRXVPDSVSURYLGHDGGLWLRQDOLQIRUPDWLRQDVWRWKH$XJXVWVNLHVDORQJZLWKD
SHUVRQDOWRXFKE\WKHDXWKRU,I\RXOLNHGRXU9HQXVLQ+\GUDVHULHVWKLVOLWWOHJHPLVIRU\RX

$'''2:1/2$'72&$57 

(SLVWOHWR6DWDQ'ZDUI3ODQHWVLQ+HOO HERRN 

'RZQORDG
7KHGZDUISODQHWVJRVSHOLQFOXGLQJDOHWWHUWR6DWDQWKHGZDUISODQHWVRQWKHWUHHRIOLIHDQGWKHGZDUISODQHWVLQWKHWK
KRXVH%RQXV5HDO7LPH5HDOLW\5HQGHULQJ7RROV([WUDERQXV/XFN\'ZDUI3ODQHW'D\VZLWK%LOO*DWHV

$'''2:1/2$'72&$57 

:LWFKROORZ HERRN 

'RZQORDG
,PPHGLDWHO\DSSOLFDEOHWR\RXURZQKRURVFRSHKHUHFRPHV:,7&+2//2:LQWKHDVWURORJLFDOKRXVHVIRUWKH
:,7&+ZHORYHLQDOORI\RX(VVHQWLDODVWURORJLFDOLQIRUPDWLRQDERXWWKHJUHDWHVWDVWURQRPLFDOGLVFRYHU\RIDOOWLPHV
WKHDYLGVWDUOHVVKROHLQ(ULGDQXV

$'''2:1/2$'72&$57 

6XQ(SKHPHULV PXOWLPHGLDGRZQORDG

'RZQORDG
7KHUH
VDOZD\VWKH681DQGLWLVGHILQLWLYHO\1277+(5(ZKHUH\RXUDVWURORJ\SURJUDPSRLQWVDW7KHH[FLWLQJZRUOGRI
WKH$&$'(0,&=2',$&WULJJHUVWKH35(&(66,212)7+($6&(1'$17DVKRXVHGZLWKLQWKH1,*+7 '$<KRXVH
V\VWHP2XUDSRFDO\SWLFUHFRUGVWDUWVZLWKWKH\HDU,QWKHSUHVHQW$JHRI&HWXV&HWXVLVIUHTXHQWO\TXRWHG
DORQJVLGH(ULVLQ&HWXV7KXVWKH:7&HYHQWKDG(ULVVHWWLQJLQ&HWXV&HWXVLVRQHRIWKHPRVWDFWXDO]RGLDFDO
FRQVWHOODWLRQVLQWKH\HDUVWRFRPH%HVLGHV-XSLWHULQ2SKLXFKXVDQG0DUVLQ&HWXVWKH\HDUIHDWXUHVDQ
H[FHSWLRQDOO\SURORQJHGVRMRXUQRI0HUFXU\LQ2ULRQ9HQXVLQ+\GUDKDVDQQRXQFHGWKHDUULYDORIWKH$QWLFKULVW,QWKH
\HDU8UDQXVLVLQ&HWXV1RZIRUWKHILUVWWLPHLQ]RGLDFDOKLVWRU\WKHDVWURORJHULVDEOHWRDFWXDOO\WUDFNWKH
PRYHPHQWVRI8UDQXVLQWKH$JHRI&HWXV<RXU]RGLDFDODGYHQWXUHGRHVQRWVWRSKHUHDVWKHLQWULFDWHIHDWXUHVRIWKH
$&$'(0,&=2',$&LQYLWHWKHLQYHQWLYHDVWURORJHUVWLOOGHHSHULQWRLWVUHDOP

$'''2:1/2$'72&$57 

9HQLFHZLWK.ODXGLR=LF HERRN 

'RZQORDG)5((
9HQLFHZHOFRPHV5755LQLWLDWHVDVWURORJ\VWXGHQWVDQGIULHQGV3HULSDWHWLFGUHDPJXLGHWKURXJKWKHFLW\RIEULGJHV
'RZQORDGIRU)UHH 

9HQLFHLQ/RYH HERRN 

'RZQORDG)5((
$SKRWRJUDSKLFDFFRXQWWKDWZLOOVKLIW\RXUDVVHPEODJHSRLQWWRZDUGV57557LQLWLDWLRQLQ9HQLFH +LGGHQPDJLFDOSODFHV
RIDOFKHP\ORYHDQG\RXU&DVDQRYD
'RZQORDGIRU)UHH 

'ZDUI3ODQHWVLQ0DUULDJH$VWURORJ\)XOO9HUVLRQ HERRN 
'RZQORDG
&KDURQLQWKHWKKRXVHPDUNV'DQWH
VVWUD\LQJRIILQKHOODVZHOODVORVVRIWKHJXDUGLDQDQJHO7KLVGHOLQHDWLRQGRHV
QRWFRPIRUWWKHVHHNHUDVLQWKHFDVHRIWKHH[GDUNSODQHW&KDURQDQH[SHULPHQWDOSODQHWDQGRQHRIWKHYDOXDEOH
FROOHFWLRQPDGHRIK\SRWKHWLFDOV7KHUHLVVWUD\LQJRIIHYHQLQKHOODVRQHHQWHUVWKHMDZVRI<DPD7KHJXDUGLDQ
VSLULWKDVEHHQORVWGXHWRODFNRIIHDOW\IUHWWLQJDQGILFNOHQHVV &OLFNRQSUHYLHZIRUWKHIXOOOLVWRIREMHFWVDVGHOLQHDWHG
LQ\RXUWKKRXVH

$'''2:1/2$'72&$57 

:7&DQGWKHWK3ODQHW HERRN 

'RZQORDG
0RRQLQ2ULRQ(ULVDWWKHZHVWHUQKRUL]RQ:7&DVWURORJ\

$'''2:1/2$'72&$57 

5LWXDO$VWURORJ\ HERRN 

'RZQORDG
7KHQHZDEVWUDFWVE\.ODXGLR=LFUHYHDOWKHVHFUHWVRI]RGLDFDOUHIRUPDWLRQFRYHULQJWKRXVDQGVRI\HDUVRIVFLHQWLILF
DVWURORJ\DVPRGHUQDVWURORJ\MRLQVKDQGVZLWKDQFLHQWULWXDO$GHWDLOHGWUHDWLVHRQWKHUHIRUPHGSHQWDJUDPULWXDO
LVLQFOXGHG

$'''2:1/2$'72&$57 

(ULVSLULWXDOLW\ HERRN 

'RZQORDG
(ULVDVWURORJ\ZDQWVWRH[WHQG\RXUDWWHQWLRQWRZDUGVWKHVSLULWXDOUHDOPZLWKWKHUHDOWLPHUHDOLW\UHQGHULQJWRROV7KH
VSLULWXDOH[HUFLVHVKDYHEHHQGHVLJQHGLQRUGHUWRJUDQWZLVKHVLQUHFRUGWLPHKRZHYHUWKHWUDSLVVHWIRUWKHVRXOWREH
OLEHUDWHGDIWHUVSLULWXDOVWULIH7KHDVWURORJHUFDQDQWLFLSDWHDVZHOODVGLVFUHDWHDEDGLQIOXHQFHIURPDSODQHWHYHQ
EHIRUHWKHWUDQVLWVWDUWVPDQLIHVWLQJZKLOHUHSODFLQJWKHHYHQWZLWKDSRVLWLYHIXWXUHRIRQH
VRZQFKRLFH7KHQHZ
VLPSOLILHG VWHSPDJLFNVHFUHWDU\LQVLGH

$'''2:1/2$'72&$57 

3HQWDJUDP5LWXDO HERRN 

'RZQORDG
,QVSHFWLRQRIWKHFDUGLQDOVWDUVULVLQJDW'HQGHUDKLQ%&DVZHOODVORFDWLRQVVXFKDV5LRGH-DQHLUR:KDW
FDUGLQDOVWDUVZLOOPDUNWKHSHQWDJUDPULWXDODW\RXURZQORFDWLRQ"$UHVHDUFKFRQGXFWHGIRUWKHEHQHILWRIWKHFUHDWLYH
PDJXVDVWURORJHU7KHUHPD\EHDOWHUQDWLYHFKRLFHVIRUEULJKWVWDUVPDUNLQJWKHIRXUTXDUWHUV:KLOHVRPHVWDUV
PLJKWDSSHDULQDSSURSULDWHWKH\PD\EHVRIRUWKHUHOLJLRXV 7KHFKRLFHRIVWDUVPLJKWQRWVHHPREYLRXVIURPFXOWXUH
WRFXOWXUH$JRRGVWDUOLNH5HJXOXVPLJKWEHGDQJHURXVO\FORVHWRDEDGVWDUOLNH$OSKDUG 7KHDUFKDQJHODWWULEXWLRQ
PLJKWRUPLJKWQRWKDYHDQ\WKLQJWRGRZLWKVWDUV 7KHULWXDOVFRXOGKDYHEHHQKLGGHQRUIRUJHGIRUGLGDFWLFSXUSRVH,W
LVXSWRWKHPDJXVWRFKRRVHWKHPDUNHUVRIWKHFDUGLQDOSRLQWV 7KRVHIROORZLQJWUDGLWLRQPLJKWQRWKDYHDOOWKHUHSOLHV
LQWKHZRUOG7KHWKHXUJLVWPD\KDYHWRDVNWKHLQRUJDQLFEHLQJZKHUHDVWURQRP\IDLOV

$'''2:1/2$'72&$57 

2,5,6 HERRN 

'RZQORDG
2,5,6LQLWLDWLRQWDNHVDIXUWKHUVWHSIURPLQVWDQWPDJLFNWRZDUGVSHUVRQDOLPPRUWDOLW\:KDWLVWKH2ULRQ6WDUJDWH"
57557 7UXH0LQG'LVWLOOHUIRU20DVWHUVLQVLGH%RQXV6XQLQ2ULRQ

$'''2:1/2$'72&$57 

0HUFXU\LQ2ULRQ HERRN 

'RZQORDG
0HUFXU\LQ2ULRQILJXUHVLQWKHKRURVFRSHRI/DG\'LDQD6SHQFHUSULQFHVVRI:DOHV7KHUHSRUWFRQWDLQVERQXV0HUFXU\
HSKHPHULVDORQJZLWKWKHFRPSOHWHGHOLQHDWLRQIRU0HUFXU\LQVSHFLDOFRQVWHOODWLRQV

$'''2:1/2$'72&$57 

2ULRQ'D\V6XQLQ2ULRQ HERRN 

'RZQORDG
7KH2ULRQGD\VKDSSHQHYHU\VXPPHUZKHQWKH6XQLVLQ2ULRQDFFRUGLQJWRPRGHUQDQGDQFLHQWDVWURORJ\
$'''2:1/2$'72&$57 

$SRSKLV HERRN 

'RZQORDG
$SRSKLVFRPHVZLWKWKH0D\DQSURSKHF\7KHDVWHURLGHQGDQJHUV(DUWKULJKWQRZZLWKDSRVVLEOHLPSDFWLQWKH\HDU


$'''2:1/2$'72&$57 

.(/8 PXOWLPHGLDGRZQORDG

'RZQORDG
KDSSHQVWREHPDUNHGE\DQHYHQWIXO%52:1':$5)DVIORDWLQJLQWKH352;,0,7<RIRXUVRODUV\VWHP$OLHQ
KRURVFRSHH[DPSOH³(ULVULVLQJLQ&HWXVZLWK.(/8DQG6DWXUQLQWKHWKKRXVHLQDWUDQVKXPDQKRURVFRSH´$OEHLW
WKHUXGG\REMHFWLVUHODWLYHO\QHDUWRXVLWLVWRRHDUO\WRVSHDNRI1LELUX7UDQVKXPDQFHIRUDOOOHIWEHKLQGRQWKLVVLGHRI
WKH6WDUJDWH".(/8)(0$/(LVMXVWDEURZQGZDUIWLPHVWKHPDVVRI-XSLWHU$OOWKHGDWDRQWKLVVLWHKDYHEHHQ
SURFHVVHGXVLQJ1$6$HTXLSPHQW6WDEWKHKHDUWRI'DY\-RQHV$QLPDWHG$FDGHPLF=RGLDFDOLHQKRURVFRSHDQG
3/$1(72&(175,&$6752/2*<LQVLGH

$'''2:1/2$'72&$57 

$SRSKLV HERRN

'RZQORDG
'RFXPHQWDWLRQRIWKH$SRSKLV6XQFRQMXQFWLRQRQ $SRSKLVLVD3+$RUGDQJHURXVDVWHURLGVFKHGXOHGDV
KD]DUGRXV3RVVLEOHLPSDFWLQWKH\HDU([WKSODQHW(ULV8%LQVLGH

$'''2:1/2$'72&$57 

(ULVLQ/RYHDQG:DU HERRN

'RZQORDG
7KHJROGHQDSSOHLQWKHSXUVHIXOORIJROGDQGWKHKDQGRI+HOHQRI7UR\(ULVLQ/RYHDQG:DU7KHPDMRUGZDUISODQHW
(ULVDVGHOLQHDWHGLQWKHKRXVHVRIWKHKRURVFRSH7U\DQGFDWFKWKH$SSOHRI(ULVZLWK%LOO*DWHV (GLWLRQZLWKELEOLFDO
FRPPHQWV%RQXV+\GUD0LVVLRQLQWKH<HDURIWKH$QWLFKULVW

$'''2:1/2$'72&$57 

6XEFRQVFLRXV$VFHQGDQWV HERRN 

'RZQORDG
'R\RXKDYHD68%&216&,286$6&(1'$17LQ\RXUQDWDOKRURVFRSH"'LG\RXNQRZWKDWERWKWKH/LRQDQG8QLFRUQ
DUHVXEFRQVFLRXVDVFHQGDQWV"7DNHDIXUWKHUVWHSLQWRWKHIDVFLQDWLQJZRUOGRIWKH$&$'(0,&=2',$&DQGWUXH
($67(51$6&(1'$17LQ\RXURZQKRURVFRSH

$'''2:1/2$'72&$57 

7KH3UHFHVVLRQRIWKH$VFHQGDQW HERRN 

'RZQORDG
7KHDVFHQGDQWVFKDQJHZKLOHWKHORFDO]RGLDFUHPDLQVWKHVDPHDQGKHUHLVDQH[DPSOH7KHSUHFHVVHGDVFHQGDQW
VHWDVPHDVXUHGLQGXHHDVWDWWKHHSRFKRI+LSSDUFKXV7KHDEVWUDFWVUHVXPHWKHVFLHQWLILF]RGLDFZLWKLWV,$8
FRQVWHOODWLRQVDVZHOODVWKHSUHFHVVHGRUHDVWHUQVHWRIDVFHQGDQWV

$'''2:1/2$'72&$57 

6RXWKHUQ&RQVWHOODWLRQVLQ$VWURORJ\ HERRN 

'RZQORDG
7KHPHULGLDQFRQVWHOODWLRQGHWHUPLQHVVXFFHVVRUIDLOXUHLQEXVLQHVVZLWKLQQDWDORUKRUDU\DVWURORJ\HQYLURQPHQW
:KLOHWKHVHWRIHDVWHUQDVFHQGDQWVGHSHQGVRQSUHFHVVLRQRQO\WKHVHWRIPHULGLDQFRQVWHOODWLRQVLVVHQVLWLYHWR
ORQJLWXGHDQGODWLWXGH$SUHYLHZRIWKHZRUNLQSURJUHVVE\.ODXGLR=LFHQWLWOHG%XVLQHVV&RQVWHOODWLRQVLQ$VWURORJ\

$'''2:1/2$'72&$57 

 PXOWLPHGLDGRZQORDG
'RZQORDG
$UH\RXWKHFKRVHQRQH"

$'''2:1/2$'72&$57 

$SRKHOHV HERRN 

'RZQORDG
6SHFLDODVWHURLGVRUELWFORVHXSRQ(DUWKZKLOHVKDULQJLWVRUELW

$'''2:1/2$'72&$57 

$QLPDWHG$OPDQDFRIWKH$SRFDO\SVH PXOWLPHGLDGRZQORDG

'RZQORDG
7KHVXESULPHPRUWJDJHFULVLVDVUHVXOWRIWKHHQWUDQFHRIWKHGZDUISODQHW$:LQWR+\GUD9HQXVLQ+\GUD
IHDWXUHVDPRQJWKHDQLPDWHGH[DPSOHVRIWKH$FDGHPLF=RGLDF$SRSKLVLQVLGH

$'''2:1/2$'72&$57 

$SRFDO\SVH5HSRUW PXOWLPHGLDGRZQORDG

'RZQORDG
$FDGHPLF]RGLDFSUHFHVVHGDVFHQGDQW:5:0$3FROGVSRW(ULV$:FHQWDXUVFRPHW:LOGGZDUI
SODQHWV6\ULQ[RIWKHGDUNSODQHWV57557LQVLGH9HQXVLQ+\GUDDQGWKHVXESULPHPRUWJDJHFULVLV8UDQXVLQ&HWXV
:DWHUZDUV$SRSKLVLQVLGH 3')

$'''2:1/2$'72&$57 

6HOI HERRN 

'RZQORDG
&DQWKH6HOIEHDFKLHYHGWKURXJKUHDOLW\UHQGHULQJ"+RZGRHVWKH$FDGHPLF=RGLDFGLVVROYHIDOVHHJRRQSODQHWDU\
OHYHO"$PDQXDOLQVFLHQWLILFDVWURORJ\ZLWKFRPSOHWH57557ZLWKDILQDOWRXFKRIXOWLPDWHP\VWHU\DQGSHDFH7KHTXHVW
LVVXFFHVVIXOWKHUHZDVQRTXHVWSSDEVWUDFWV 3') 

$'''2:1/2$'72&$57 

:LWFKDOORZ HERRN 

'RZQORDG
$KOHIXORIVHFUHWV:KDWZHKDYHKHUHLVEURDGEDQGPDJLFNDORQJZLWKWKHODWHVWLQDQ\DVWURORJ\7KHRWKHUVLGHZDV
QHYHUVRQHDUWRWKLVVLGHRIWKH*UHDW+ROH3HUVRQDOL]H\RXUFUHDWLYHPLQGYRLGZKLOHSHUIRUPLQJGDLO\PDJLFN:KDW
GRHVWKHJUHDWHVWDVWURQRPLFGLVFRYHU\RIDOOWLPHVKDYHWRGRZLWK:DOSXUJLV1LJKWDQG'UXLGZDUORUG0RUGUHG"7KH
SKLORVRSK\DVWURORJ\DQGPDJLFNRIWKHJUHDWKROHLQWKHVN\DVPHUJHGZLWK\RXUSHUVRQDOPDJLFN:LWFKROORZLVD
FRPELQDWLRQRIPRGHUQZLWFKFUDIWZLWKWKHODWHVWLQVFLHQWLILFDVWURORJ\'LVFRYHUDOOWKDW\RXIRUHYHUQHHGWRDQDO\VHWKH
JUHDWKROHLQ\RXUQDWDOKRURVFRSH3URGXFHDPLQGYRLGLQRUGHUWRIXQQHOWRWKHRWKHUVLGHRIGHVLUH:LWFKROORZDV
GHOLQHDWHGLQWKHKRXVHVRIWKHKRURVFRSHFRPHVDORQJZLWKWKHFRPSOHWHSDFNDJHIRUWKHPRGHUQZLWFKDKROHIXORI
WHFKQLTXHVWRVWDUWPDWHULDOL]LQJHYHQWVULJKWDIWHUXQSDFNLQJWKLVPDJLFDOEXQGOH1RKROHZDVHYHUVRJHQHURXVD
FRUQXFRSLDDVWKLVRQH

$'''2:1/2$'72&$57 

$VWURFDO\SVH HERRN 

'RZQORDG
9(186LQ25,21LQ-81(&KHFN\RXUIOLJKW$FRQVWDQWO\XSGDWLQJGLDU\RIWKHDSRFDO\SVHVWDUWHGRQ
DPRQJWKHIHDWXUHVWKH-DSDQHVHVKLSGULOOLQJWKHSODQHWWRLWVFRUH +\GUD.LGVZLWK9HQXVLQ+\GUD$XJ
*LDQWFRPHW:LOGSRUWHQWVLQWKHVN\QHZSODQHWFDQGLGDWHV8%WKSODQHWDFWLYDWHG,UDTERPELQJ
PDS,VUDHOVFLHQWLILFKRURVFRSHZLWKSRUWHQWV9HQXVLQ2ULRQ0RRQLQ$XULJD-XSLWHULQ2SKLXFKXV

$'''2:1/2$'72&$57 

$VWURFDO\SVH HERRN 

'RZQORDG
$VWURORJHUVFDQILQDOO\EHDWWKHEXVKZLWKVFLHQWLILFSUHFLVLRQDVWKHVHFRQGVLJLORIWKHDSRFDO\SVHOD\VRSHQOLNHWUXH
VNLHV
$'''2:1/2$'72&$57 

$VWURFDO\SVH HERRN 

'RZQORDG
3UHGLFWLRQVIRUWKH0LGGOH(DVWDORQJZLWKUHDOWLPHUHDOLW\UHQGHULQJWRROVLQLWLDWLRQ/HDUQKRZWRDYHUWEDGHYHQWVZKLOH
FUHDWLQJDEHWWHUIXWXUH*HWULGRIWKDWEDGWUDQVLWLQ\RXUKRURVFRSH,UDQWKH23(&RLOFULVLVQDYDOEORFNDJHRI
/HEDQRQDQGIXUWKHUZDUSUHGLFWLRQVIRUWKHSODQHW

$'''2:1/2$'72&$57 

$VWURORJ\8QSOXJJHG HERRN 

'RZQORDG
8QSOXJ\RXUDVWURORJLFDOH[SHULHQFHIURPWKH PDWUL[DQGIUHH\RXUNDUPDIURPSUHGHILQHGVXSHUVWLWLRQ 

$'''2:1/2$'72&$57 

+ROH/RWRI/RYH HERRN 

'RZQORDG
7KH:LWFKROORZLVDVWDUOHVVKROHLQWKHVN\WKDWDIIHFWV\RXUHPRWLRQDOOLIHE\
VHFRQGDU\DQGSULPDU\GLUHFWLRQ
LQ\RXU
QDWDOKRURVFRSH/HDUQKRZWRFDOFXODWHWKHGD\VDQG\HDUVDVDIIHFWHGE\WKHUHFHQWO\GLVFRYHUHGVXSHUYRLGLQ\RXURZQ
KRURVFRSH7KHSDFNDJHFRQWDLQVWKH:LWFKROORZSURMHFWGHOLQHDWLRQVFDQVDQG
UHDOWLPHUHDOLW\UHQGHULQJWRROV
IRU
\RXU
IXWXUHFKDQJLQJ
VHVVLRQV

$'''2:1/2$'72&$57 

3HUVRQDO&RVPLF$YDWDU HERRN 

'RZQORDG
,QVWDQWPDJLFNLQLWLDWLRQWDNHVDIXUWKHUVWHS/HDUQKRZWRSURGXFHHIIHFWVLQWKHUHDOZRUOGLQUHDOWLPHQRZ

$'''2:1/2$'72&$57 

7KH*ROGHQ0RQNH\ PXOWLPHGLDGRZQORDG

'RZQORDG
7KH)HGLVDERXWWRFROODSVHDVLQWLPDWHGE\RXUSUHYLRXVSUHGLFWLRQVDQGQRZSXUSRUWHGE\HFRQRPLVWVDOORYHUWKH
ZRUOG1RERG\H[SHFWHGVXFKDGLVDVWHUEXWWKHUH\RXKDYHLW

$'''2:1/2$'72&$57 

9HQXV6LJQ HERRN 

'RZQORDG
9HQXVVSDQVWKURXJK]RGLDFDOFRQVWHOODWLRQV:KLOHLQWKH\HDUZLWK9HQXVLQ+\GUDZHSODQGULOOLQJRXUQDWLYH
SODQHWWRWKHFRUHZLWK9HQXVLQ3HJDVXVZHPD\EHOHDYLQJWKHSODQHWEHKLQGDVVWDUERXQGUDFH3UHFLVLRQK
9HQXVHSKHPHULVSOXVERQXV9HQXVLQ6SHFLDO&RQVWHOODWLRQV

$'''2:1/2$'72&$57 

9HQXVLQ3HJDVXV HERRN 

'RZQORDG
9HQXVVSDQVWKURXJK]RGLDFDOFRQVWHOODWLRQV:KLOHLQWKH\HDUZLWK9HQXVLQ+\GUDZHSODQGULOOLQJRXUQDWLYH
SODQHWWRWKHFRUHZLWK9HQXVLQ3HJDVXVZHPD\EHOHDYLQJWKHSODQHWEHKLQGDVVWDUERXQGUDFH3UHFLVLRQK
9HQXVHSKHPHULVSOXVERQXV9HQXVLQ6SHFLDO&RQVWHOODWLRQV

$'''2:1/2$'72&$57 

9HQXVLQ+\GUD,QWKH:DNHRIWKH$QWLFKULVW HERRN 

'RZQORDG
9HQXVHQWHUVWKH]RGLDFDOFRQVWHOODWLRQRI+\GUDLQVXPPHU7KHZDNHRIWKH$QWLFKULVWZLWKGHWDLOHGVWHOODUPDSV
VXJJHVWLRQVDQGLQLWLDWLRQVDVWURORJ\LQVLGH7KHSXEOLFDWLRQDFWVDVXSJUDGHIURPWKH0HVVLDKDQGVHTXHOWR
6FDUOHW%RQXV57557LQVWDQWSHUVRQDOPDJLFNWRROVIRUWKH
$'''2:1/2$'72&$57 

9HQXVLQ6FXWXP HERRN 

'RZQORDG
9HQXVWUDYHOVWKURXJKRXWRI]RGLDFDOFRQVWHOODWLRQV9HQXVLQ6FXWXPLVDQLQLWLDWLRQLQVFLHQWLILFDVWURORJ\ZLWKD
WRXFKRIP\VWLFLVP9HQXVHSKHPHULVLQVLGH

$'''2:1/2$'72&$57 

575573&6 HERRN 

'RZQORDG
7KH3HUVRQDO&RVPLF6HFUHWDU\\RXUOLIHORQJIULHQGIURP:RQGHUODQGWKDWLQFOXGHVDVZHOODVWUDQVFHQGVDOOPDJLFN
DQGUHOLJLRQ*RGKDVQHYHUEHHQVRSHUVRQDODVZHOODVDFFHVVLEOHEHIRUH 7KHLQLWLDWLRQSDFNDJHLQFOXGHV2
,QLWLDWLRQ20DVWHUDVZHOODV0RQH\+RQH\DSSOLFDWLRQIRU\RXU3HUVRQDO&RVPLF6HFUHWDU\7KHPDWHULDOLVUHDGLO\
XVDEOHLQVHOILQLWLDWLRQHQYLURQPHQWDVFRPSDWLEOHZLWKDQGHQFRPSDVVLQJSHUVRQDOUHOLJLRQ6WDUWFUHDWLQJ\RXURZQ
UHDOLW\QRZ'HVLJQ\RXUIXWXUHPDNHDFOHDUEOXHSULQWRI\RXUIXWXUHOLIHGHFUHHDVZHOODVLQWHQGSRVLWLYHLVVXHDQG
ZDWFKWKHUHVXOWPDWHULDOL]HLQUHFRUGWLPHULJKWEHIRUH\RXURZQH\HV

$'''2:1/2$'72&$57 

2,5,6 HERRN 

'RZQORDG
2,5,6LQLWLDWLRQLQFOXGLQJWKHFRPSOHWH57557PDJLFNWRROVSOXVDQH[WHQVLYHLQLWLDWLRQLQWRVFLHQWLILFDVWURORJ\

$'''2:1/2$'72&$57 

(ULVDWWKH%LJ$SSOH HERRN 

'RZQORDG
(ULVEULQJVGLVFRUGWRWKHSODQHWDVWKH:7&LVKLW7KHODUJHVWGZDUISODQHWLQLWVWUXHSRVLWLRQRYHU1<&ZLWKGHWDLOVOLNH
WKHIDPRXV0RRQLQ2ULRQ

$'''2:1/2$'72&$57 

7KH5HFHQW+LVWRU\RIWKH=RGLDFZLWK3URIHVVLRQDO(ULV(SKHPHULVWKURXJKWKH,$8&RQVWHOODWLRQV HERRN 

'RZQORDG
7KH5HFHQW+LVWRU\RIWKH=RGLDFZLWK3URIHVVLRQDO(ULV(SKHPHULVWKURXJKWKH,$8&RQVWHOODWLRQV3HRSOHZKRWKRXJKW
WKHLU6XQLVLQ6FRUSLRFDQEHVKRZQWKHLUWUXHQDWDO6XQLQ9LUJR$ZRPDQWKDWZDVWROGVKHZDVDFROG&DSULFRUQ
DVFHQGDQWZDVGHOLJKWHGWRGLVFRYHUVKHKDVD3LVFHDQDVFHQGDQW$VSHRSOHWHQGDWLGHQWLI\LQJWKHPVHOYHVZLWK
ZKDWHYHUVXSHUVWLWLRXVRXWSXWIURPQRQDXWKRULWDWLYHDVWURORJLFSURJUDPVWKHLUQHZLGHQWLWLHVVKRXOGFDSWXUHWKHLU
DWWHQWLRQIRUDZKLOH5HFHQWGLVFRYHULHVVXFKDV(ULVFDQJLYHULVHWR]RGLDFDOGLVFXVVLRQ(ULVLVLQWKH]RGLDFDO
FRQVWHOODWLRQRI&HWXVDFFRUGLQJWR0LFKDHO%URZQDQG1$6$9HQXVLVDQH[FHOOHQWJXLGHWKURXJKWKH]RGLDF,WFOLPEV
XSIURP$TXDULXVDQGLQWR3HJDVXVRQO\WRGURSWKURXJK3LVFHVDQGLQWR&HWXV/LNHPRVWSODQHWVDQGGZDUISODQHW
(ULVLWLVERXQGWRUHHQWHU&HWXV,,DIWHU3LVFHV9HQXVRIWHQHQWHUV2ULRQOLNHLQVXPPHUDQGQRUPDOO\JOLGHV
WKURXJK2SKLXFKXV,QWKH\HDU9HQXVLVLQ+\GUD

$'''2:1/2$'72&$57 

(ULVLQWKH86$&KDUW HERRN 

'RZQORDG
&KLURQ(ULVG\QDPLVPIRUWKH86$&KLURQVWURQJO\LQWHUORFNVZLWK(ULVDWWKHWLPHRISURKLELWLRQ2EMHFWVDURXQG
GHJUHHVRID]LPXWKFRQYHQWLRQDOO\RFFXS\WKHVRXWKZHVWHUQVN\7KLVLVPRVWO\WUXHIRUWKHSODQHWV$OEHLWWKH0RRQDQG
9HQXVLQSDUWLFXODUJUHDWO\GLYHUJHIURPWKHSDWKRIWKHHFOLSWLFPRVWSODQHWDU\WUDIILFKDSSHQVQHDUWRGHJUHHVIURPWKH
HFOLSWLF,WLVZLWKLQWKLVQDUURZEDQGWKDWWKH]RGLDFLVGHWHUPLQHG$OEHLWZHDUHDFFXVWRPHGWRVLJKWVOLNH0RRQ
FOLPELQJLQ$XULJDRU9HQXVSUHFLSLWDWLQJLQWR+\GUDZHDUHRIFRXUVHOHVVDFFXVWRPHGWRFRPHWVLQ)RUQD[RUGZDUI
SODQHWVOLNH(ULVLQ7XFDQDDV(ULVWDNHVXVIURPWKHHFOLSWLFEHOWWRZDUGVWKHFLUFXPSRODUUHJLRQRIWKH;=RGLDF

$'''2:1/2$'72&$57 

(ULVDQGWKH5HYLVLRQRIWKH=RGLDF HERRN 

'RZQORDG
(ULVLVPRUHWKDQDGZDUISODQHWZLWKLWVDVWURORJ\WUDQVFHQGLQJGDLO\KRURVFRSHVDQGVXQVLJQDVWURORJ\6SHFLDO
SXEOLFDWLRQVZHUHGHGLFDWHGWR(ULVLQWKHKRXVHDVFRQFHUQEXVLQHVVZRPHQUHDOHVWDWHDGROHVFHQWOLIHFKLOGUHQ
DQGHYHQSHWV:HKDYHODUJHO\XSGDWHGRXUROGPDWHULDOIRUWKHXVHLQDVSHFLDO\HDUWKDWLV $OORXUSXEOLFDWLRQV
DQGVHUYLFHVKDYHWKUHHGLVWLQFWIHDWXUHV $VWURQRPLF=RGLDF (DVWHUQ$VFHQGDQW 1LJKW 'D\KRXVHV\VWHP7KH
DVWURQRPLF]RGLDFKDV,$8FRQVWHOODWLRQV7KHSUHVHQWVHWRIDVFHQGDQWVLV<RXURZQDVFHQGDQWFRXOGEH2ULRQ
RU0RQRFHURVWKHXQLFRUQ7KH86$KDV6HUSHQV&DXGDDVFHQGLQJ 2QHPLJKWEHDWEHVWIDPLOLDUZLWKRQO\RXWRI
DVFHQGDQWV2XUVLVWKHILUVWUHIRUPDWLRQRIWKH]RGLDFDQGDVFHQGDQWVLQFH+LSSDUFKXV$OUHDG\+LSSDUFKXV
UHEXNHGWKH*UHHNDVWURORJHUVIRUWKHLUODFNRIXSGDWHDVFRQFHUQSUHFHVVLRQ

$'''2:1/2$'72&$57 

(DUWK&RRUELWDO$VWHURLGV HERRN 

'RZQORDG
&UXLWKQHKDVEHHQFDOOHG(DUWK
VVHFRQGPRRQ)LYH(DUWKFRPSDQLRQVDFWDVDX[LOLDU\PRRQV7KHVHFR RUELWDO
DVWHURLGVKDXQW(DUWK
VRUELWZLWKDGHILQLWHLPSDFWXSRQWKHKRURVFRSH7KHFRRUELWDOVH[HUWVSHFLDOLQIOXHQFHXSRQ
HOHFWLRQLQSROLWLFDOFKDUWV6RPHFRRUELWDOVDV&UXLWKQHDFWLQWKHVSLULWXDOGRPDLQDVSUDFWLFDOVKDPDQLVWLFGUHDP 
FDWFKHUVDQGDUHVWURQJHVSHFLDOO\LQIHPDOHKHDOHUV7KHFRRUELWDOVVWUHVVWKHVHFUHWDVZHOODVVDFUHGVLGHLIWKH
IHPLQLQHLQ\RXUKRURVFRSH

$'''2:1/2$'72&$57 

(DUWK&RRUELWDO$VWHURLGV HERRN 

'RZQORDG
(DUWKKDVILYHOLWWOHFRRUELWDODVWHURLGVVKDULQJLWVRUELW7KH\DFWDVDX[LOLDU\PRRQVLQDVWURORJ\

$'''2:1/2$'72&$57 

7UDQVQHSWXQLDQ$VWURORJ\9,, HERRN 

'RZQORDG
(ULVLQWKHKRXVHVRI\RXUKRURVFRSH$OOPDMRUWUDQVQHSWXQLDQREMHFWVDVGHOLQHDWHGLQWKHWKKRXVHRI\RXU
KRURVFRSH7KHGHOLQHDWLRQRI%XII\DORQJZLWKDOOPDMRU712ZLWK+(ULVHSKHPHULVLQVLGH

$'''2:1/2$'72&$57 

1HZ7UDQVQHSWXQLDQ$VWURORJ\ HERRN 

'RZQORDG
7KHGHOLQHDWLRQRIGLVWDQWWUDQVQHSWXQLDQREMHFW%XII\ ;5 ZLWKHSKHPHULV$OOPDMRUWUDQVQHSWXQLDQREMHFWV
GHOLQHDWHGLQWKHWKKRXVHRI\RXUKRURVFRSH(ULVDVWURORJ\LQVLGH

$'''2:1/2$'72&$57 

$QLPDWHG=RGLDF PXOWLPHGLDGRZQORDG

'RZQORDG
7KHH[FLWLQJZRUOGRIWKH$&$'(0,&=2',$&WULJJHUVWKH35(&(66,212)7+($6&(1'$17DVKRXVHGZLWKLQWKH
1,*+7 '$<KRXVHV\VWHP2XUH[DPSOHVLQWKLVLVVXHFRYHUWKH$1,0$7('SRVLWLRQVWKDWKDYHGHILQHGWKH
DSRFDO\SVH2XUDSRFDO\SWLFUHFRUGVWDUWVZLWKWKH\HDU,QWKHSUHVHQW$JHRI&HWXV&HWXVLVIUHTXHQWO\TXRWHG
DORQJVLGH(ULVLQ&HWXV7KXVWKH:7&HYHQWKDG(ULVVHWWLQJLQ&HWXV&HWXVLVRQHRIWKHPRVWDFWXDO]RGLDFDO
FRQVWHOODWLRQVLQWKH\HDUVWRFRPH%HVLGHV-XSLWHULQ2SKLXFKXVDQG0DUVLQ&HWXVWKH\HDUIHDWXUHVDQ
H[FHSWLRQDOO\SURORQJHGVRMRXUQRI0HUFXU\LQ2ULRQ9HQXVLQ+\GUDKDVDQQRXQFHGWKHDUULYDORIWKH$QWLFKULVW,QWKH
\HDU8UDQXVLVLQ&HWXV1RZIRUWKHILUVWWLPHLQ]RGLDFDOKLVWRU\WKHDVWURORJHULVDEOHWRDFWXDOO\WUDFNWKH
PRYHPHQWVRI8UDQXVLQWKH$JHRI&HWXV<RXU]RGLDFDODGYHQWXUHGRHVQRWVWRSKHUHDVWKHLQWULFDWHIHDWXUHVRIWKH
$&$'(0,&=2',$&LQYLWHWKHLQYHQWLYHDVWURORJHUVWLOOGHHSHULQWRLWVUHDOP

$'''2:1/2$'72&$57 

$QLPDWHG$OPDQDFRIWKH$SRFDO\SVH PXOWLPHGLDGRZQORDG

'RZQORDG
7KHVXESULPHPRUWJDJHFULVLVDVUHVXOWRIWKHHQWUDQFHRIWKHGZDUISODQHW$:LQWR+\GUD9HQXVLQ+\GUD
IHDWXUHVDPRQJWKHDQLPDWHGH[DPSOHVRIWKH$FDGHPLF=RGLDF

$'''2:1/2$'72&$57 

5D&KURQLFOHV, PXOWLPHGLDGRZQORDG 

'RZQORDG
:KHUHLV\RXU1$7$/6815($//<",I\RXZHUHERUQRQ1RYHPEHUUGOLNH6DL%DEDLWLVSUREDEO\LQ/LEUD VLF 7KH
VXQHSKHPHULVKDVEHHQFRPSXWHGIRUPLGQLJKWDQGQRRQLQRUGHUWRGHWHUPLQHWKHWUXHVWHOODUSRVLWLRQLQERUGHULQJ
FDVHVRI,$8LQJUHVV1RWHWKDWWKHHSKHPHULGHVVKRZRQO\WKHSRVLWLRQRIWKHVXQDQGSODQHWVLQWKH,$8
FRQVWHOODWLRQV(VVHQWLDOIRUWKHKRUDU\DQGOXQDUDVWURORJHU6XQHSKHPHULV%RQXVSODQHWDU\
HSKHPHULGHVZLOOHQDEOHWKHDVWURORJHUWRH[SHULPHQWZLWK9HQXVLQ6H[WDQV0RRQLQ2ULRQDQG0DUVLQ&HWXV%RQXV
$1,0$7('=2',$&WKH$FDGHPLF=RGLDFDQLPDWHG1HZHGLWLRQZLWKDWRXFKRIWHNQR(J\SW

$'''2:1/2$'72&$57 

!


First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved.
No part of this material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for commercial
purposes or otherwise, without the written permission of the author.

ACADEMIC ZODIAC

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

ÆON

Over the years, much as during the æons of interest1, astrology has been apparently taken
for fun, while astronomy was generally considered its serious sister2. An astrologer was
apparently never properly initiated since Egypt, neither given any academic knowledge.

PRECESSION

At the gates of the Age of Pegasus3i, “astrologers” still play with twelve zodiacal signs4.
They “think” that the Sun is in Aries on every spring equinox 5 during all the precession
1
Mostly after the golden age of Egypt.
2
Even after blending the two within the Academic Zodiac, astronomy is still the basis for the development
of modern astrology. As it is infinitely demanding in an average person, astronomic information has been
rendered as plain as possible, when and where possible. People may still enjoy playing with pseudo-
astrological disinformation, even in being aware that the pseudo-astrological “report” has in fact absolutely
nothing to do with their original natal skies. It was made for amusement purposes only. It can of course not
even nearly guess the original position of anybody's natal Sun. Already from this simple but terrible fact, it
is clear why we can not speak of astrology or truest the alleged “astrologers” when it comes to serious
matters. It is amazing that we left them in life after the chaos that their foul “art” has done to the planet. Not
only divorce, bankruptcy and general crisis, but also massive death and World War II happened due to foul
astrology. Namely, Hitler apparently spared a couple of astrologers, even after getting rid of most of them.
3
The end of the Age of Cetus III.
4
There are properly 22 zodiacal signs.
5
The Sun is in Aries once in a long precession cycle. Aries is a comparatively short constellation, thus the
Age of Aries is a relatively brief period in human history. As the Lamb of God announces the first star of
Aries rising with the Sun at spring equinox, so the golden calf announces the long Age of Taurus. Presently
the Sun is in Pisces or Cetus at spring equinox. In the golden age of Egypt, as also intimated in the Holy
Bible, the Sun was in Orion on spring equinox. See also Orion Days, Mercury in Orion, O5IRIS and Sun in
cycle. It seems that every dilettante has the right to declare than there is no precession at
all. Of course, for the purpose of cheating on their naïve public, they do not even have to
know that there is any precession at all. In fact, the less they know, the more acclaimed
they get, as the public is bound to react to the very nonsensical trivia they were trained to
accept as their life. Their toy zodiacs have two to six signs of zodiacal error. As the
population is not informed that “astrology” as suggested by popular magazines is for
entertainment purposes only. Said “astrology” is visibly foolish. About the most hilarious
examples of nonsense are the twelve zodiacal signs rising at east. The most amusing
examples of asinine pseudo-astrological propaganda include “Pluto in Aries”6.

AGE OF PISCES

From one side, the public may beii informed7 that we live in the Age of Pisces8, which is
correct; but from the other side, people born on spring equinox are being assigned “Sun
in Aries”9.

Klaudio Zic
The Academic Zodiac & RTRRT are Copyright © 1995 - 2009 by Klaudio Zic, all rights reserved worldwide.
Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology

Orion.
6
Pluto of course never enters Aries. Also, it never enters Pisces. Its inclined trajectory simply does not
afford for its entrance into Pisces or Aries. This is probably something that a linear mind will never
understand as the devil was never inclined towards mathematics at all. See also True Mind Distiller and
Eris and the X Zodiac.
7
That is, liable to be informed? We are sincerely not sure at all if the public is informed and whether the
Age of Pisces makes news?
8
Disinformation such as that we already live in the Age of Aquarius is also possible! A caveat in this
respect must be issued, even in wading the large seas of superstition. The Academic Zodiac will leave a
large trail behind as it is programmed to take over superstition even before the Age of Aquarius.
9
This error apparently happens only in the “developed West” (sic). Hilarious as it seems, the “primitive
east: does not make as much mistakes as the fashionable West. People have tried to blend or lean towards
eastern astrological tradition, with the result of producing even more chaos as perhaps exemplified in
“sidereal astrology”, which turned to be sidereal by name only. Apparently astrology “as we know it” (sic)
had its commercial start already at the times of Hipparchus, who of course rebuked non-precessed practice
to no avail to this very day. The zodiacal offset grew to enormous proportions as to be measured from two
to hilarious six (sic) constellations of zodiacal error.
i The much expected but largely misunderstood Age of Aquarius may dawn in approximately 650 years from now.
Apparently someone may be told that we are already in the Age of Aquarius, and be dismissed accordingly. According
to the so-called :tropical astrology experts”, we live in a perennial Age of Aries. Vedic astrologers may elaborate on Kali
yuga and the Age of Pisces. However, the Sun is presently close to the stars of Cetus on spring equinox, thus Age of
Cetus.
ii Originally, we wrote “is informed”, but came to doubt it. It may well be that the public is either badly informed,
deliberately misinformed or it simply could not care less. At this fallen Age, every kind of disinformation flows freely,
from flat or hollow Earth to the twelve rising signs at east.
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Buy | My Lulu | Community | Help Customize Storefront | Log Out | View Cart

* The Academic Zodiac consists in 22 zodiacal constellations.


* Which one of the 16 is your own true Eastern Ascendant?
* Change your personal future for the best right now!
* Render your own reality with the Reality Rendering Tools.
* Resolve economical crisis to your own favor.
* Protect your family, identity, horoscope and futurity from superstition!
* Render and establish personal prosperity forever.
* Catch up with the latest zodiacal upgrade.
* Render your own reality in minutes with the Real Time Reality Rendering Tools.

Zodiacal Conspiracy (e-book)


Download: €59.41
They told you about your ascendant. They lied.
Add Download to Cart

European Astrology (e-book)


Download: €20.12
Did we have any astrology in Europe yet?
Add Download to Cart

2012 Astrology (e-book)


Download: €25.15
Take a splash into your own starry futurity!
Add Download to Cart

ETER (e-book)
Download: €66.84
Time to retrieve all your energy, time and emotion. Empower yourself by possessing to the full what you
already gave up for lost.

1 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Add Download to Cart

Pegasus Point (e-book)


Download: €16.22
A zodiacal jump into infinity.
Add Download to Cart

Ciel Ouvert (e-book)


Download: €66.84
In order to reboot your fate in the direction of your own choice, all you need is instant magick.
Add Download to Cart

WYSIWYG Astrology (e-book)


Download: €3.89
Your own guide to your basic, professional and custom horoscope.
Add Download to Cart

Pegasus Point (e-book)


Download: €9.71
The Pegasus Point is a special contribution to your horoscope as born from our experience in working with
Venus in Pegasus. Explore the previously unknown regions of the zodiac!
Add Download to Cart

Pegasus Point (e-book)


Download: €28.00
The legendary exaltation point of Venus as delineated in the 12 houses of the horoscope along with
mundane portents for the next ascent of Venus into Pegasus. An exciting astrological report that will toss
you to and fro between heaven and hell.
Add Download to Cart

Pegasus Point (e-book)


Download: €35.00
The Pegasus Point as delineated in the 12 mundane as well individual houses of the horoscope.
Add Download to Cart

Lucifer (e-book)
Download: €20.25
A further peek into God's secret zodiacal workshop as enlightened with Venus in Pegasus. The report
exceeds in minute technical detail over the most exalted zodiacal position of Venus.
Add Download to Cart

2 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Lucifer (e-book)
Download: €20.17
The arrival of Lucifer as Venus in Pegasus, even prodigious child avatar.
Add Download to Cart

Lucifer (e-book)
Download: €6.66
Venus is the rebel of the zodiac as it climbs into Pegasus.
Add Download to Cart

Lucifer (e-book)
Download: €6.66
Venus in Pegasus presents the new boundaries of the zodiac.
Add Download to Cart

Lucifer (e-book)
Download: €66.60
A consuming introduction to Venus in Pegasus and the Academic Zodiac. The basis for the zodiac for Venus
have been laid with the now historical delineation of Venus in the special zodiacal positions. Jubilee edition
for the dedicated astrologer with detailed scans of the upcoming Venus in Pegasus.
Add Download to Cart

Academic Zodiac Jubilee (e-book)


Download: €22.16
The Academic Zodiac celebrates its third jubilee.
Add Download to Cart

Transparent Zodiac (e-book)


Download: €16.22
Sai Baba was born on November 23rd with Sun in Libra. What about you?
Add Download to Cart

2010 (e-book)
Download: €20.10
Will the FED hold? Reports for the advanced financial astrologer include secondary angular directions of
2002 AW197 with Algol.
Add Download to Cart

3 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Masonic Astrology (e-book)


Download: €22.16
A great Mason will have full Moon rising in Sextans. The initiation includes a complete set of practical
methods in instant magick.
Add Download to Cart

Klaudio Zic - Complete Works 3 (e-book)


Download: €222.00
Seven major collections of treatises, essays and reports cover all facets of modern astrology at its roots,
from the Academic Zodiac, through the 16 Precessed Ascendants and towards the universal Cartesian house
system. A thousand pages reading includes a complete initiation in instant magick.
Add Download to Cart

Academic Astrology Journal 2 (e-book)


Download: €7.77
An astronomical scan of the astrological skies frolics with life as Jupiter meets Neptune and Venus
congresses with Mars. Detailed scans of the major conjunctions in the year 2009 for the progressive
astrologer.Unique maps featuring all named and major transneptunian dwarf planets as they cluster in the
July skies.
Add Download to Cart

Amen Re - Zodiacal Commandments (e-book)


Download: €22.20
The Zodiacal Commandments of Amen Re. << Brahma introduced a simplistic zodiac for his first initiates.
The original instruction was to keep an update for precession, which was forgotten in time, as a fixed mind
found dubitable comfort in an unchanging model of the solar system. >> Third edition with the first
prophecy for the 2012.
Add Download to Cart

Academic Astrology Journal 5 (e-book)


Download: €5.55
Get the latest boost in modern astrology with Sun in Orion (sic) and the summer solstice 2009.
Add Download to Cart

A Short History of the Zodiac (e-book)


Download: €22.16
Is the Sun in Orion yet?
Add Download to Cart

4 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Zodiacal Astrology (e-book)


Download: €16.22
The zodiac that rules the future of many was completely unknown to astrologers, until now.
Add Download to Cart

Objections to Fate in Modern Synastry (e-book)


Download: €72.60
All the wonders of instant magick and modern synastry as packed within a single precious initiation. Render
your marriage in minutes. Determine the favorite wedding time of your choice by sheer magick! If marriage
rendering takes 20 minutes, then instant magick must manifest in less than five! Your futurity will never be
the same. Marriage rendering initiation is a practical jewel in modern astrology along with a personal magick
touch that will shatter the matrix.
Add Download to Cart

Futurendering (e-book)
Download: €59.41
Paint your blushing future rosy. Update your futurity according to your master plan. Paint a rainbow over
that dark transit. Your true horoscope is your own intent! Complete instant magick initiation as featuring the
Marriage Rendering Tools inside.
Add Download to Cart

Future Architecture (e-book)


Download: €59.41
Did you update your horoscope yet? Klaudio Zic introduces the reader into the new standards in astrology
and magick. The document features a complete initiation into personal instant magick.
Add Download to Cart

Services by Klaudio Zic (e-book)


Download: FREE
Your horoscope as the original blueprint of your true natal skies determines the events in your life that you
want to model according to your master plan. Introduce new events into your life with your personal magick
tools, as you enjoy the sequence of your life according to your original horoscope.
Download for Free

Wheel Chart (e-book)


Download: €144.00
Change your life from the hub of the wheel of time! Organize your daily magick with astrology! A complete
initiation in instant magick along with an introduction in modern astrology.
Add Download to Cart

Wishwheel Insider (e-book)


Download: €120.00
Enter the inner temple of instant magick with this precious volume! << Descent into hell can be fun.

5 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Namely, this house has been especially discussed as concern the lower world. In lowering itself, it rules over
ritual and descent to the lower hemisphere. The nether descendant is of course determined by the west
point and thus assigned to the seventh house. >>
Add Download to Cart

Academic Astrology Journal 4 (e-book)


Download: €9.99
The Academic Zodiac is three years old! Welcome the third anniversary of the first scientific zodiac along
with your favorite RTRRT.
Add Download to Cart

RTRRT Secrets (e-book)


Download: €66.84
The secrets of instant magick as known to god only, now yours.
Add Download to Cart

RTRRT Secrets (e-book)


Download: €59.41
The secrets of instant magick as known only to god, now yours.
Add Download to Cart

Academic Astrology Journal 3 (e-book)


Download: €8.88
There is a thin line between heaven and hell as monsters from nether worlds enter the horoscope chart.
Subconscious ascendants like Orion, Watersnake or Unicorn haunt even the best horoscopes.
Add Download to Cart

Academic Astrology Journal 1 (e-book)


Download: €6.66
The astrology of your true natal skies reveals a universe of possibilities for your futures beyond horoscopes
and fates.
Add Download to Cart

Windfall (e-book)
Download: €66.84
"In case that things go wrong...� Cancel that! Things will go exactly as you tell them to, even much better.
Marriage Rendering Tools, PCS Initiation, O5, Cascade, Magic Wand and Wishwheel. The complete RTRRT
suite of instant magick tools in one downloadable package.
Add Download to Cart

Klaudio Zic Editorial (e-book)


Download: €16.22

6 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Rendering your marriage may be easier than you think. Just think of divining it in minutes as well as
rendering it according to your precise wishes. Marriage Rendering Tools inside.
Add Download to Cart

Klaudio Zic Productions (e-book)


Download: €22.16
Who needs an astrologer when you can calculate your own marriage in minutes? Even better, you can
render it at will! Contains the complete 20 Minutes Astrology initiation.
Add Download to Cart

Magus (e-book)
Download: €6.66
Astrology meets magick, or... have they already met? We asked Aleister Crowley could he help us with
both...
Add Download to Cart

Southern Skies (e-book)


Download: €22.16
The meridian constellations set, as perused in financial astrology, is separate from the zodiacal (22) and
ascendant set (16) for the current epoch.
Add Download to Cart

Nu Skies (e-book)
Download: €5.55
Essays in scientific astrology for the advanced student.
Add Download to Cart

Modern Astrology Editorial (e-book)


Download: €7.77
What is new in modern astrology? We have a new zodiac, ascendant set and universal house system.
Add Download to Cart

Modern Astrology (e-book)


Download: €16.22
A purport to what we already learned about the Academic Zodiac, Precessed Ascendant and universal
Cartesian house system in astrology. Contains dwarf planets update and new essays by the Author.
Add Download to Cart

7 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

AION (e-book)
Download: €20.14
2010 What 2011 time 2012 do 2014 we 2016 have? 2018 ahead 2029
Add Download to Cart

Marriage Rendering Tools (e-book)


Download: €11.00
Render your marriage... in minutes.
Add Download to Cart

Essays by Klaudio Zic (e-book)


Download: €5.89
Essays in scientific astrology and reality rendering. Klaudio Zic is the Author of the Academic Zodiac.
Add Download to Cart

Klaudio Zic - Complete Works 2 (e-book)


Download: €19.98
The Academic Zodiac and Precessed Ascendant have changed the face of astrology, magick and heraldry.
Add Download to Cart

Summer Editorial (e-book)


Download: €5.22
Future-changing as based on future-scanning implies changing one's life for the best, despite bad astrology,
dangerous transits and hostile fate.
Add Download to Cart

Death Discreation (multimedia download)


Download: €88.80
Where do all immortals do? They passed this way. Get out of Davy Jones' Locker and follow the quest for
immortality.
Add Download to Cart

Klaudio Zic - Complete Works 1 (e-book)


Download: €108.00
Klaudio Zic, Complete Works #1. Chapters: 1 Academic Zodiac, 2 Services, 3 RTRRT, 4 Abstracts, 5
Professional Zodiac. All that you ever wanted to know about the new zodiac and instant magick for
astrologers.
Add Download to Cart

8 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Reptilian Astrology 2009 (e-book)


Download: €31.30
Conniving along the serpentine path, Pluto in Serpens cabals with Venus in Hydra towards the revival of
reptilian astrology in the year 2009.
Add Download to Cart

Taurus Rising (e-book)


Download: €59.41
Your five minutes of glory with Taurus rising at due east. Every day, Taurus is rising for five minutes over the
eastern horizon. Grab the opportunity and change your life in minutes! Complete RTRRT inside!
Add Download to Cart

December Editorial (e-book)


Download: €12.00
A professional horoscope is the accurate blueprint of your true natal skies.
Add Download to Cart

November Editorial (e-book)


Download: €11.00
Learn how to calculate the year and month of your marriage in 20 minutes with Alice! Alice has Moon rising
in Cetus, Mercury in Sextans and Venus in Orion. Her Juno is in zodiacal Scutum, while her Pluto is at the
ascendant of the USA in Serpens Cauda. Among abundant zodiacal information, this editorial features a
treatise on modern astrology, featuring the 17 dark planets, Cassini Lilith and the Black Sun.
Add Download to Cart

New Horizons (e-book)


Download: €16.22
What is new at the astrological horizon? There are 16 ascendants rising at east as Phoenix marks the
meridian of the economic horoscope of the USA. If Serpens Cauda is the national ascendant, then Cygnus is
the American galactic ascendant. A voyage through the thrilling innovations that fountained in the Academic
Zodiac just some years ago.
Add Download to Cart

Xeditorial (e-book)
Download: €10.00
A quantum jump for an astrologer equals instant miracle in a magician. The Academic Zodiac and Reality
Rendering team up as a winning team of the New AEon. The October Editorial contains a detailed report on
the Jupiter Neptune conjunction, besides many useful information in zodiacal reformation.
Add Download to Cart

Akasa (e-book)
Download: €10.15
The fifth element unleashed in the year 2009 with the Jupiter Neptune aspect. The astrological complement

9 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

of true mind distilling.


Add Download to Cart

Yihua Report (e-book)


Download: €9.07
The horoscope of Creation. Serpens Cauda as the ascendant of the USA. Genesis ascendant. Pentagram
rituals in astrology. The secret Name of God.
Add Download to Cart

Eris Vintage Edition 2005 ~ 2009 (e-book)


Download: €31.30
Eris Vintage Edition 2005 ~ 2009 is a collection of early material as concern Eris and the X Zodiac. The first
historical publication on Eris and the X Zodiac was sold as early as August 1st 2005.
Add Download to Cart

September Editorial (e-book)


Download: €9.00
The Editorial features a detailed scan of the September skies, including dwarf planets, centaurs and
lunations.
Add Download to Cart

RTRRT 2009 (e-book)


Download: €66.84
Your instant magick manual as empowered with vintage Aladdin XI ritual. A modern approach to the ancient
art of instant magick. Contains simple methods in producing any events safely, efficaciously and most of all
quickly. Materializing one's desires, even in minutes, was never so fun before. Reality Rendering is the
premier suite of instant magick tools for everyone. Start producing miracles right upon downloading the
latest package.
Add Download to Cart

16 Ascendants (e-book)
Download: €59.41
A complete treatise on the 16 eastern ascendants, including abundant vintage material.
Add Download to Cart

August 2009 Klaudio Zic Editorial (e-book)


Download: €8.00
Your true natal skies afford for a freedom of choice in creating your futurities.
Add Download to Cart

10 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Services & Editorial 2009 July (e-book)


Download: €7.00
The history of modern astrology 2005 ~ 2009 including services, initiate support and vintage information.
Add Download to Cart

June 2009 Editorial (e-book)


Download: €6.00
Where is the Sun this year and when? When do the inner planets enter the zodiacal constellation of the
AEon? The June Editorial by Klaudio Zic contains authoritative zodiacal information for your incipient
astrologer. Your excellent reading during the sojourn of the Sun in Orion in the year 2009.
Add Download to Cart

Cetus (e-book)
Download: €22.16
The Age of Cetus is the age we live in. 2009 Cetus report including the inner planets.
Add Download to Cart

Aladdin XI (e-book)
Download: €69.98
Ever materialized a thought in record time? Setting your mind free unleashes instant magical results
starting from today. Your instant magick experience as enriched with Aladdin XI, Breaking Manacles and
Architect formulae. This complete RTRRT edition bring more original material that has made O5 the basic
instant magic technique for everybody. Apart from philosophical elaborations this edition elaborates on the
technical side of instant magick.
Add Download to Cart

Galactic Astrology (e-book)


Download: €16.22
Expand your galactic experience with the latest upgrade in modern astrology.
Add Download to Cart

Aladdin XI (e-book)
Download: €22.20
Instant magick fans will enjoy this essential upgrade of the O5 technique. For the first time, original RTRRT
Master material is revealed as recorded during the early O5 deliveries. Empower your instant magick with
the Aladdin series.
Add Download to Cart

11 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

16 Ascendants (e-book)
Download: €22.16
Which ascendant is really rising in your horoscope? Sextans, Hydra or Monoceros? A textual purport to the
16 Ascendants treatise. Get to know your true ascendant better.
Add Download to Cart

16 Ascendants (e-book)
Download: €108.00
Get to know the 16 ascendants rising at east in detail. Learn how to predict and create events in minutes.
Scan the matrix with the I Ching Aspectarian. Marriage Rendering Tools inside.
Add Download to Cart

Marriage Rendering Astrology (e-book)


Download: €66.84
Render your marriage in minutes. Determine your favorite wedding time by divination and magick! Marriage
rendering astrology comes with a 20 minutes marriage astrology initiation and instant marriage rendering
tools from the RTRRT suite of instant magick technology. The equipment includes a complete I Ching
Directions along with horary examples. Marriage rendering initiation is a practical jewel in modern astrology
as well as personal magick.
Add Download to Cart

Marriage Rendering Astrology (e-book)


Download: €59.41
Render your marriage in minutes. Determine your favorite wedding time by divination and magick! Marriage
rendering astrology comes with a 20 minutes marriage astrology initiation and instant marriage rendering
tools from the RTRRT suite of instant magick technology. The equipment includes a complete I Ching
Directions along with horary examples. Marriage rendering initiation is a practical jewel in modern astrology
as well as personal magick.
Add Download to Cart

Marriage Rendering Astrology (e-book)


Download: €59.41
Everybody likes wedding ceremonies much as anyone is able to produce wedlock with the Marriage
Rendering Wizard. Moreover, it is easy to tell the year of anybody's marriage in minutes. Yes, even for those
not into astrology or magick. Learn how to predict and produce marriage in 20 minutes. Modern guidelines
to predictive astrology include all major dwarf planets + 2007 OR10.
Add Download to Cart

I Ching Aspectarian (e-book)


Download: €64.00
Direct the I Ching astrologically toward the issue of your choice. 64 transits for the incipient astrologer.
Add Download to Cart

12 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Masonic Ascendants (e-book)


Download: €22.16
Which 16 ascending constellations really rise in our eastern sky?
Add Download to Cart

Masonic Ascendant of the USA (e-book)


Download: €17.76
The secrets of the Philadelphia skies explored in detail. In the year 1776, the skies look slightly different
than today. The document serves as incipient information for anyone who wants to explore the intricacies of
the birth of the nation from the astronomic point of view. Is the ascendant of the USA Serpens Cauda, Aquila
or even Ophiuchus? Which constellations rise at east today against the 1776 ascendants? An interesting,
mostly graphical, perspective of the real national skies as applied to modern astrology. Includes a complete
Instant Magick for Masons initiation.
Add Download to Cart

Masonic Astrology (e-book)


Download: €111.10
The orientation of the Temple depends on accurate astronomy. The Masonic Zodiac consists in 22 zodiacal
constellations.
Add Download to Cart

Masonic Zodiac (e-book)


Download: €111.10
Lodge orientation depends on accurate astronomy. The zodiac has in fact 22 constellations.
Add Download to Cart

Masonic Astrology (e-book)


Download: €18.80
Astrology for the New AEon.
Add Download to Cart

Instant Magick for Masons (e-book)


Download: €72.60
Spry magick as spawned from simplicity. Your instant magick is a portable as well as invisible personal
omnipotence tool. If anyone can use it with proficiency, how much more wisdom can be distilled by an
initiate! The basic principles of instant magick are simple but shattering convincing as the initiate
materializes an event right here, right now. Grab your copy, intend an event, see it materializing and forget
about elaborate rituals of the past.
Add Download to Cart

Fastidious Reader's Digest (e-book)


Download: FREE

13 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

The secret of the zodiac lies hidden within your national heraldry.
Download for Free

Personal Cosmic Secretary (e-book)


Download: €18.88
Role playing magick at its best. Get to know your Personal Cosmic Secretary. Have all your wishes come
true. Instant magick is fun like a role playing game.
Add Download to Cart

Personal Cosmic Secretary (e-book)


Download: €18.88
"Yes, hold on. OK, your wish comes true in 15 minutes. Merry download!"
Add Download to Cart

May 2009 Editorial (e-book)


Download: FREE
Bored with stalled pseudo-astrology and complicated magick ritual? The May 2009 Editorial by Klaudio Zic
Publications sets new standards in astrology and magick. Look ahead and beyond in order to be apart from
the pack. Vintage previews of such early works as Eris and the X Zodiac (Aug 1st 2005). Does your pet boast
a real horoscope yet?
Download for Free

Aquila Report (e-book)


Download: FREE
Aquila earthquake in the stars.
Download for Free

Corvine Moons (e-book)


Download: €18.88
Is your natal Moon in Cetus, Orion or Auriga? Wise entertainment for puckish Moon in Corvus observers in
the Shakespearean skies. Several instances of Moon in Corvus in the year 2009 entice our curiosity towards
inquiring as to the nature of the lunar zodiac. As follows is a faithful rendering of the true zodiacal stations of
the Moon. Essential information for the lunar astrologer.
Add Download to Cart

Trinity (e-book)
Download: €33.30
Triune nature of a successful ritual. Ascending initiation into RTRRT instant magick.
Add Download to Cart

Submersed Ascendants (e-book)

14 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Download: €22.00
Some ascendants dive deeper than others. Hydra ascending portends success in marriage and real estate.
How do we tell a submersed ascendant from a dry one? A major initiation into the Osiris mysteries of the
ancients. Detailed 6 minute 2010 Sun ephemeris. Determine your true Sun sign with astronomic precision!
Add Download to Cart

Submerged Ascendants (e-book)


Download: €22.16
Some ascendants run deeper than others. How do we tell a submersed ascendant from a "dry" one? A major
initiation into the Osiris mysteries of the ancients. Detailed 6 minute 2010 Sun ephemeris. Determine your
true Sun sign with astronomic precision!
Add Download to Cart

Ephemeris Report (e-book)


Download: €20.10
Sai Baba has been born on November 23rd with Sun in Libra. What about your baby? Detailed 6 minute
2010 Sun ephemeris. Determine your true Sun sign with astronomic precision!
Add Download to Cart

Stellar Sign (e-book)


Download: €16.22
Detailed 6 minute 2010 Sun ephemeris. Determine your true Sun sign with astronomic precision!
Add Download to Cart

2010 Report (e-book)


Download: €20.10
Solar ephemeris for the year 2010. Detailed graphical rendering and timing for the main solar conjunctions
with the major stars. Ideal for the serious beginner who rightfully distrusts both eastern and western
superstition. Scientific astrology purport and information. Academic Zodiac inside!
Add Download to Cart

Marriage Rendering Astrology (e-book)


Download: €14.99
Determine and render any marriage with the aid of sophisticated astrology and instant magick. You are able
to tell the year and month of anybody's marriage after 20 minutes of astrological initiation. Add a magick
touch of pragmatism to your wedding adventure with the personal Marriage Rendering Tools.
Add Download to Cart

RTRRT (e-book)
Download: €41.80
A complete initiation into personal instant magick that will never compromise your ivory soul.
Add Download to Cart

15 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Marriage Rendering (e-book)


Download: €11.00
Render your marriage happy with the Marriage Rendering Tools. Contains complete RTRRT initiation,
including the Personal Cosmic Secretary. Instant Magick requires no preparation. Start making instant
magick right in your life right upon downloading this publication.
Add Download to Cart

Magic Moon (e-book)


Download: €18.18
Know your Moon.
Add Download to Cart

EditoriApril (e-book)
Download: FREE
Discover your true star magick in redesigning events as your scan your futurity along with our precise
future-scanning tools. Matrix hacking matches matrix scanning, much as the Academic Zodiac system opens
the doors for the Real Time Reality Rendering Tools. Magick and astrology in a single initiation for the
demanding reader and mystery initiate.
Download for Free

Bible Zodiac (e-book)


Download: €25.53
In a fertile occult garden where astrology is observing the actual sky, strange beasts mix with the scent of
the starry trees. Is Unicorn rising in your own horoscope?
Add Download to Cart

Lunar Zodiac (e-book)


Download: €88.88
The mysteries of the Moon revealed! Your natal moonrise could happen within a subecliptic ascendant, such
as Orion. Do you have Moon in Corvus, Sextans or Auriga?
Add Download to Cart

Star Sign (e-book)


Download: €29.87
In discovering your true Sun sign, an astrological wonderworld appears at your true natal horizon. Marriage
Rendering Tools inside.
Add Download to Cart

Star Sign (e-book)


Download: €7.26
So you know your true Star Sign. Now what about Venus? Venus defines more than 20 zodiacal stations.
Which one is hers? Is she an iron lady with Venus in Scutum or an orgasmic owner of Venus in Pegasus?
Beowulf discovers that his marsh monster love has Venus in Hydra.

16 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Add Download to Cart

Star Sign (e-book)


Download: €7.26
Now that you know your true Sun position, how about giant comets, dwarf planets and centaurs? In quitting
both western and eastern zodiacal superstition for good, the great astrological adventure has begun. For
you. Marriage Rendering Tools inside.
Add Download to Cart

Magical Marriage Astrology (e-book)


Download: €9.71
Scan a future marriage in seconds. Create any marriage in minutes. As often remarked, in order to calculate
someone's marriage time, one needs to know but some rudimentary astrology along with basic arithmetics.
In other words, anyone can calculate anyone else's marriage year, in seconds.Marriage Rendering Tools
inside.
Add Download to Cart

Romance Magick - Magickal Guide in Relationship Astrology (e-book)


Download: €9.07
Predict and create your relationships with this handy manual for the astrologer magus. Relationship analysis
embraces a broad perspective as applied to fast marriage rendering. Render any marriage at will with the
Marriage Rendering Tools, your instant marriage magick initiation. The original delineations and ephemeris
for LILIT VERA, the dark moon as observed by Cassini. 20 minutes astrology initiation as a handy manual in
instant marriage prediction. Does your lover have Venus in Hydra? Check the 1950 - 2015 Venus ephemeris
for the real position of Venus in your lover's horoscope. The delineations for Venus in special zodiacal
positions include Venus in Pegasus, Scutum and Sextans.
Add Download to Cart

Marriage Magick (e-book)


Download: €66.84
A complete instant magick initiation as containing Prosperity Rendering, Wish Wheel, Money Honey,
Personal Cosmic Secretary, Oberon V, Matrix Hacking and the Marriage Rendering Tools. A comprehensive
guide through your own instant magick faculties. Start working out instant magick right here, right now.
Arrange for a marriage in minutes. Any marriage.
Add Download to Cart

2010 (e-book)
Download: €7.26
Indicative trends in real estate economy for the advanced financial astrologer. Modern scientific astrology as
coupled with personal reality rendering. Render your prosperity knowing your clear purpose that stems from
your true natal stars.
Add Download to Cart

AEon Editorial (e-book)


Download: €3.11
Modern scientific astrology as coupled with personal reality rendering. Render your prosperity knowing your
clear purpose that stems from your true natal stars.

17 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Add Download to Cart

Prosperity Rendering (e-book)


Download: €31.91
Cut through the economic jungle while rendering your own prosperity right now. Modern scientific astrology
as coupled with personal reality rendering. Render your prosperity knowing your clear purpose that stems
from your true natal stars.
Add Download to Cart

Scientific Astrology Encyclopaedia (e-book)


Download: €7.26
An introduction into the fascinating world of 22 zodiacal constellations and 16 ascendants. Modern scientific
astrology as coupled with personal reality rendering. Render your prosperity knowing your clear purpose
that stems from your true natal stars.
Add Download to Cart

RTRRT Editorial (e-book)


Download: FREE
Miracle making is easier than you think!
Download for Free

Klaudio Zic VIP Services - Catalog 2009 (e-book)


Download: €3.11
Personal reality rendering starts with excellent astrology. Modern scientific astrology as coupled with
personal reality rendering. Render your prosperity knowing your clear purpose that stems from your true
natal stars.
Add Download to Cart

April Editorial (e-book)


Download: FREE
Astrology and instant magick meet in our RTRRT initiation.
Download for Free

Prosperity Rendering ~ Editorial (e-book)


Download: €5.88
Editorial purport for RTRRT initiates and astrologers.
Add Download to Cart

March 2009 Editorial (e-book)


Download: €3.11
Color your April skies with your true natal stars!

18 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Add Download to Cart

Prosperity Rendering (e-book)


Download: €7.26
Render your own prosperity right here, right now, with your comprehensive problem solver. Instant financial
magic with a spiritual edge for everyone.
Add Download to Cart

RTRRT (e-book)
Download: €99.99
Render your own prosperity with the Reality Rendering tools. The edition contains a purport as concern the
religious as well as financial implications of instant magick.
Add Download to Cart

RTRRT (e-book)
Download: €111.00
Omnipotence starts with instant magick for one. Your complete initiation in miracle making.
Add Download to Cart

RRRRT (e-book)
Download: €108.00
Start working out instant miracles right now, learn as you progress. Simple at the core, yet miraculous in
manifestation, the Reality Rendering tools deliver personal instant magick in its full splendor. All the tools
you will ever need in rendering your own reality right now.
Add Download to Cart

Lunar Zodiac (e-book)


Download: €18.22
Was it Moon in Auriga, Sextans or Corvus in transit or even within her own natal horoscope?A complete
treatise on the true lunar zodiac, that appears to be fairly independent from both eastern or western
proposals. Keep a weather eye on the horizon where Moon in Cetus is rising right now!
Add Download to Cart

Personal Cosmic Secretary (e-book)


Download: €7.26
Crisis? What crisis? Live large and prosper!
Add Download to Cart

Personal Cosmic Secretary (e-book)


Download: €7.77
Your private genie does all your biddings. In minutes.

19 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Add Download to Cart

Personal Cosmic Secretary (e-book)


Download: €7.26
Your wish is my command!
Add Download to Cart

Stellar Sign (e-book)


Download: €6.94
Your true Sun sign as hidden from eastern and western astrology.
Add Download to Cart

Personal Cosmic Secretary (e-book)


Download: €9.07
Instant magick for everyone is fun for all. Miracles come out easy in minutes with the RTRRT initiation.
Add Download to Cart

Personal Cosmic Secretary (e-book)


Download: €7.77
Instant magick is like a wireless laptop: it downloads whatever you need, everywhere and anytime you
might need a miracle.
Add Download to Cart

MAGVS (e-book)
Download: €7.77
Simple instant magick for one.
Add Download to Cart

Personal Cosmic Secretary (e-book)


Download: €7.77
Your wish is my command. Instanter. Your private genie in your pocket forever more. The personal genie
does all your biddings and more.
Add Download to Cart

Economagic (e-book)
Download: €66.56
Scan the economic peaks ahead while creating your own paradise even in midst of global economic crisis.
Add Download to Cart

20 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Well Tempered Astrology (e-book)


Download: €9.07
A treatise based on the true stellar zodiac and precessed ascendant set in astrology.
Add Download to Cart

Stellar Sign (e-book)


Download: €6.94
The true sidereal zodiac spawns your original Sun sign.
Add Download to Cart

Well Tempered Astrology (e-book)


Download: €10.80
Neither east nor west,your true natal sign is the best.
Add Download to Cart

Well Tempered Astrology (e-book)


Download: €13.89
Neither east, nor west: true sky astrology is the best!
Add Download to Cart

Stellar Sign (e-book)


Download: €11.11
Your true natal sign is written in the stars.
Add Download to Cart

Stellar Sign (e-book)


Download: €13.89
Your true natal sun sign is neither western nor eastern...
Add Download to Cart

Stellar Sign (e-book)


Download: €5.80
The natal position of your Sun as determined by NASA standards. An authoritative overview of your true
natal Sun sign.
Add Download to Cart

Stellar Sign (e-book)

21 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Download: €9.71
What is your true star sign?
Add Download to Cart

Reptilian Astrology (e-book)


Download: €7.26
Is her Venus in Hydra?
Add Download to Cart

Magick Miracle Maker (e-book)


Download: €19.50
Your personal magick springs out from here. In minutes.
Add Download to Cart

NASA Based Zodiac (e-book)


Download: €19.50
The NASA based zodiac is a precise astronomic tool in modern astrology: 22 zodiacal constellations, 16
ascendants, Cartesian house system and RTRRT future correction. << Much as old toys for brats,
non-scientific zodiacs did only damage to racial intiation, in that humanity suffered from exhorbitant
superstition, false diagnosis and finaly wrong heading. In the example of the WTC, there is no wonder that
no one predicted, since Moon in Orion or Eris sitting in Cetus precisely on the NYC western horizon, were not
even enlisted amongst the categories of whatever popular superstition was smuggled under the name of
astrology. >>
Add Download to Cart

Zero (e-book)
Download: €19.50
You do not need to think or sweat much at all in order to perform and produce instant magick right now.
Relax and have fun with our instant magick initiation system.
Add Download to Cart

Ixion Report (multimedia download)


Download: €66.84
Dwarf planets in modern astrology.
Add Download to Cart

Ixion Report (e-book)


Download: €5.55
Golden years.
Add Download to Cart

22 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

The Structure of Fate (e-book)


Download: €11.11
Your true will distilled towards perfection. Moving forward from instant magick, one discovers glory.
Add Download to Cart

The Structure of Fate (e-book)


Download: €22.20
Your fate is sealed. By you.
Add Download to Cart

The Structure of Fate (e-book)


Download: €222.00
Follow the white rabbit, even LEPVS, through that hole in timespace and towards eternal bliss.
Add Download to Cart

Lord of the AEon (e-book)


Download: €222.00
Astrology spawns magick into infinity.
Add Download to Cart

Approaching Infinity (e-book)


Download: €109.00
Astrology and magick for your immortal soul.
Add Download to Cart

Time (e-book)
Download: €108.00
In leaving predictable situations along with instant magick for one, the initiate shoots forward into a world of
merry possibilities.
Add Download to Cart

Academic Zodiac (e-book)


Download: €29.44
Get precessed with the 16 ascending constellations for the current epoch, as casually overlapping with the
22 zodiacal stations.
Add Download to Cart

Academic Zodiac (e-book)

23 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Download: €16.22
Take a walk through the 22 zodiacal stations along with the 16 eastern ascendants.
Add Download to Cart

Academic Zodiac (multimedia download)


Download: €29.44
Your Academic Zodiac updated for new major dwarf planet 2007 OR10 and reptilian centaur 2007 JG43.
Add Download to Cart

Riding the Devil to the Grail (e-book)


Download: €59.41
Reptilian centaur 2007 JG43 in astrology, as delineated in the 12 houses. This volume defines the
astrological standard for the New AEon. The new examples include AO Spare, Bush and Obama.
Add Download to Cart

2007 JG43 (e-book)


Download: €19.85
The new reptilian centaur, its character, examples, graphs and ephemeris.
Add Download to Cart

2007 JG43 (multimedia download)


Download: €27.77
New centaur 2007 JG43. Research material. 50 Mb animation. Delineation. USA, NYSE & WTC maps,
featuring the major dwarf planets. Ephemeris.
Add Download to Cart

Mustard (e-book)
Download: €19.85
You have a little faith that bestows great prosperity in record time? Even a little faith can grow fast and
produce magnificent results. Try yours instanter!
Add Download to Cart

Cornucopia (e-book)
Download: €18.92
Get rich with love in record time with your personal prosperity rendering tools.
Add Download to Cart

24 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Cornucopia (e-book)
Download: €19.98
Claim your power and glory forever along with reality rendering in real time. Instant magick was never so
available before.
Add Download to Cart

Cornucopia (e-book)
Download: €19.85
Miracles shower into your life right now. Choose and arrange the download of miracles from the astral
domain with the personal cosmic secretary and reality rendering tools.
Add Download to Cart

Cornucopia (e-book)
Download: €15.88
Love and prosperity comes your way in an instant.
Add Download to Cart

Cornucopia (e-book)
Download: €6.63
Instant magick renders your reality according to your best wishes right now!
Add Download to Cart

AEon (e-book)
Download: €59.06
Venus rising in Pegasus announces the dawning of the New Age.
Add Download to Cart

Foul Moon (multimedia download)


Download: €59.06
Financial report for the year 2009. Yet another upgrade of the Orcus Report along with the Moon in its secret
mansions.
Add Download to Cart

Foul Moon (e-book)


Download: €6.63
The February 2009 full moon as scanned in detail, including the latest dwarf planets. This mini publications
serves as excellent purport for the financial astrologer in the year 2009, in being an appendix to Orcus
Report. The latest standards in scientific astrology are graphically packed within this booklet.
Add Download to Cart

25 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Zodiacal Design (multimedia download)


Download: €31.91
Never take the zodiac for granted as you explore the local zodiacs with this special edition.
Add Download to Cart

Zodiacal Design (e-book)


Download: €6.65
Meet the proper zodiacal information along with the latest discoveries as concern the dwarf planets. 2007
OR10 inside.
Add Download to Cart

Apocalypse Report (multimedia download)


Download: €652.96
Academic zodiac, precessed ascendant, WR 104, WMAP cold spot, Eris, 2002 AW197, centaurs, comet Wild,
dwarf planets, Syrinx of the dark planets. RTRRT inside. Venus in Hydra and the subprime mortgage crisis.
Uranus in Cetus. Water wars. 2007, 2008, 2011, 2012, 2014, 2020. Apophis inside! (PDF)
Add Download to Cart

Serpens (multimedia download)


Download: €32.10
Is there a 2, 3 or even 6 sign zodiacal error in your own horoscope? Why is Obama dangerous? "The western
descendant is in masonic Sextans. Obama is confronted with his masonic astrologer as Sextans is the basic
zodiacal constellation, even cornerstone of the Academic Zodiac and incipient stellar aggregation in zodiacal
reformation." Reptilian analysis of the horoscope interplay between diabolic Italy and masonic U.S.A. with
the Messiah as torn between the two. English vs Italian edition. Animated Venus in Orion for Obama. NASA
JPL minute Venus ephemeris. Obama assassination update.
Add Download to Cart

Klaudio Zic Productions (multimedia download)


Download: €8.34
Personal future management consists in accurate scanning of one's personal future matrix, along with
instant future rendering. Become instant magician even before divining your minute future.
Add Download to Cart

Alpha Serpentis (multimedia download)


Download: €13.89
When the snake bites its own tail, Italy and the USA share the same ascendant. The confrontation between
Berlusconi and Obama may be only apparent as transparent to reptilian astrology.
Add Download to Cart

Serpens (e-book)
Download: €33.30
He who controls the snake is the Messiah. Italy and the U.S.A. share the opposite parts of the same

26 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

ascendant along with the mark of the reptile that surrounds the actual Messiah.
Add Download to Cart

Klaudio Zic Productions (e-book)


Download: €3.11
The future is accurately predicted before being modeled according to one's master plan. Your futurity
blueprints can change at any time according to your wish. Enhance the magical experience of your true
natal horoscope with our VIP services.
Add Download to Cart

Magick (e-book)
Download: €25.53
Need a quick intervention into the present, future and past?
Add Download to Cart

Valentine Magick (multimedia download)


Download: €14.02
Present your true astrological love with real time magick! Love is your magickal intent with the RTRRT.
Create love freely out of the blue! Is her natal Venus in Hydra, Pegasus or Sextans? Animated academic
zodiac inside!
Add Download to Cart

Valentine Surprises (multimedia download)


Download: €14.02
Love is your magickal intent with the RTRRT. Create love freely out of the blue! Is her natal Venus in Hydra,
Pegasus or Sextans? Animated academic zodiac inside!
Add Download to Cart

Editorial ~ February 2009 (e-book)


Download: €15.58
Valentine surprises like all major dwarf planets as delineated in your 7th house!
Add Download to Cart

Zodiacal Designer (e-book)


Download: €66.56
The zodiac and ascendant set as observed in the real sky. The 22 zodiacal constellations as occasionally
overlapped by the ascendant set. The current ascendant set is 16 constellations. RTRRT inside.
Add Download to Cart

Zodiacal Designer (e-book)


Download: €59.41
Which subconscious ascendants are zodiacal constellations? Solve several zodiacal puzzles within this

27 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

complex publication for the zodiacal enthusiast!


Add Download to Cart

Zodiacal Design (e-book)


Download: €66.84
The 22 zodiacal constellations as overlapping the 16 ascendants for the epoch. Local zodiacal design on any
planet implies dynamic planetocentric astrology for the 22nd millennium. A scientific zodiac bible from the
Author of the Academic Zodiac.
Add Download to Cart

Personal Magick (e-book)


Download: €8.94
Let's get physical! Put your body in whatever daily magick you do right now. Your body is an instant magick
tool in itself! Let your body perform instant magick with this RTRRT upgrade.
Add Download to Cart

Zodiac Navigator (e-book)


Download: €22.16
Meet the 22 IAU constellations of the zodiac! Essential reference for the incipient astrologer. The document
enlists the 22 zodiacal constellations with 22 colorful examples. Sun in Libra on Nov 23rd, Venus in Hydra
2007, and Moon in Orion (WTC) are some of the examples. Bonus 16 precessed ascendants!
Add Download to Cart

Prosperity Rendering (e-book)


Download: €25.59
Render your own prosperity in record time!
Add Download to Cart

Prosperity Rendering (e-book)


Download: €59.06
Master your own prosperity in record time!
Add Download to Cart

Prosperity Rendering ~ True Mind Distiller (e-book)


Download: €59.41
Clear your mind in welcoming eternal prosperity now! The secret of all magick is distilled within the inner O5
Initiation, now available to the wide public. The worth of the complete O5 Master initiation was estimated
around $ 50000 in the year 1995, now comprised with the famous secret XXXIII O5 Master level as published
within a simple volume. When time and mind is transcended, nothing is impossible. This volume is worth
decades of meditation in the hand of the true seeker, as it transcends all initiation. Many books have been
written but none could render one's true self in twenty minutes.The quintessence of all magick for those
who want to know the highest towards which they aspire to.
Add Download to Cart

28 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Prosperity Rendering ~ 20 Minutes Initiation (e-book)


Download: €66.84
We heard you say "If only I could divine and make magick in minutes, I would know the future, change it and
prosper." Well, there you have it! We upgraded the Prosperity Rendering Tools towards a 20 minutes
astrology initiation. All the magick in the world is yours in 20 minutes! Unbeatable practical treatise in light
speed astrology and instant magick, from the owner of the zodiac and originator of personal reality
rendering.
Add Download to Cart

Instant Magick (e-book)


Download: €29.99
Start working out real magick in your daily life right now! The personal magick initiation for everyone, as
based on clearing techniques such as O5. The Real Time Reality Rendering Tools include O5 Initiation, O5
Master, the famous Personal Cosmic Secretary, instant magick Snow Crash, True Mind Distiller for O5
Masters as well as initiations in practical instant magick.Bonus 2009 edition with new exciting material.
http://youtube.com/RTRRTV
Add Download to Cart

RTRRTVIP (e-book)
Download: €16.22
Do you have Unicorn ascending in your natal horoscope? How many times you thought like this: "If I only
could make miracles"? With RTRRT, you not only make daily miracles but also make them happen on this
very day. Do not delay miracles in your own life. Get your RTRRT initiation along with true natal horoscope.
Instant personal magick as based on your true natal horoscope. Verified Identity Package. VIP services for
RTRR initiates.Get your true natal ascendant, planetary positions and Reality Rendering.
Add Download to Cart

Future Changing Kit (e-book)


Download: €29.28
What good is predicting events when you can not change them? This kit contains scientific astrology
initiation plus a complete course in future changing. Predict and discreate that bad transit even before it
starts manifesting while creating an event of your choice. Second, greatly amplified edition.
Add Download to Cart

Matrix Hacking (e-book)


Download: €25.47
Hack the matrix in real time while manifesting your own miracles. The future tissue is at your command.
Add Download to Cart

Love & Money - Seducing Partner Impossible (e-book)


Download: €42.66
How to make anyone fall in bed with you in minutes. << As the witch dissolves the unwanted negativity, the
energy that was entrapped within that bad enclosure will immediately be used in creating the positive
marriage event. >> At the time you liked blonds, now you like exotic natural females, afterwards you will
like nuns. Taste is manipulated by the media but counter-fate is led by true mind in a secret process of
initiation After all, the partner is not important or. the partner is the only important thing that is you.
Add Download to Cart

29 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Love & Money (e-book)


Download: €20.09
Make your dream person fall in bed with you in minutes! Instant magick & Venus astrology as blended for
successful seduction. Seduce her time and space with our Instant Magickal Seduction methods while
selecting the best time to visit her Venus. Venus in Orion does not seem to be as sexy as Venus in Hydra is.
RTRRT & sci-astrology team up in order to seduce partner impossible in record time!
Add Download to Cart

20 Minutes Astrology (e-book)


Download: €20.00
Divine anybody's marriage in minutes with this basic yet sophisticated manual in modern astrology. Want to
know the year and month of anybody's marriage. Got a spare minute?
Add Download to Cart

The Secret Mansions of the Moon (e-book)


Download: €31.91
6 out of 18 zodiacal constellations as occupied by the Moon were completely obscure to astrologers until
this publication disclosed the delineation for the 6 secret positions of the Moon. Moon in Auriga defines the
22nd constellation of the zodiac. This publication resumes all that we have learned in the past about the
special positions of the Moon.
Add Download to Cart

2007 OR10 ~ Update (multimedia download)


Download: €59.41
Dozens of dwarf planets rule your horoscope! Get ready for the challenges that haunt your natal chart from
beyond the realm of Neptune. Edition updated for potential Obama assassination dates and 2007 OR10.
Add Download to Cart

Obama in the Stars (multimedia download)


Download: €9.07
Prevent Obama assassination update. Obama astrology takes a further step with this reference publication.
Detailed maps of the real sky, hints, precise NASA ephemeris for Venus in Orion and the standard
objectiveness of the Academic Zodiac. Our digital editions combine printable PDF with animations.
Add Download to Cart

Unihipili (e-book)
Download: €20.09
Horoscope noir for Obama. An alternative review of the inauguration horoscope. New dwarf planet 2007
OR10 inside.
Add Download to Cart

Obama in the Stars (multimedia download)


Download: €20.09
Dangerous gifts in dangerous times. Why is Obama risking his life and when? Updated analysis of the

30 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

horoscope for Barack Obama. The full power of the Academic Zodiac as combined with predictive
techniques. Updated Obama assassination dates. Printable PDF with animations.
Add Download to Cart

ObamAssassination (e-book)
Download: €66.84
Failed attempts at Obama assassination, along with warnings for the President's future. 2007 OR10 inside.
Add Download to Cart

Obama in the Stars (e-book)


Download: €19.85
Horoscope noir for Obama. Updated with assassination hazard dates.
Add Download to Cart

Obama (multimedia download)


Download: €59.41
2008 - 2012 for the U.S.A. Obama assassination update.
Add Download to Cart

KKK (multimedia download)


Download: €97.13
KKK and the American apocalypse 2008 - 2012. Edition updated for potential Obama assassination dates
and 2007 OR10.
Add Download to Cart

USA (e-book)
Download: €17.76
The ascendant of the USA is Serpens Cauda... or Aquila.
Add Download to Cart

2007 OR10 (e-book)


Download: €20.07
The major dwarf planets are an important factor in your horoscope. Premier dwarf delineations since 1992.
Add Download to Cart

Federal Reserve System and the Subprime Mortgage Crisis (multimedia download)
Download: €108.00
<< 1Th 5:3 For when they shall say, Peace and safety; then sudden destruction cometh upon them, as
travail upon a woman with child; and they shall not escape. >> If the economic trends turn out

31 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

unexpectedly against you, you did not read this report! Updated Orcus Report 2004 ~ 2018 with new FED
dwarf planet 2007 OR10.
Add Download to Cart

2007 OR10 ~ Dwarf Planets in the House of Love (e-book)

Download: €20.07
What is the influence of the major named and unnamed dwarf planets in your 7th house? Unihipili invites
another astrological adventure with 2007 OR10, Eris and the dwarf planets in love. An astrologer is always
updated as to the latest discoveries. Essential reading for the leader of the astro pack.
Add Download to Cart

Unihipili (e-book)
Download: €20.07
New giant dwarf planet 2007 OR10 as delineated in the 12 houses of the horoscope. 2007 OR10 has a
special affinity towards crystal clear relationship in fostering one's family resources. The character of
Unihipili has been found upright, determined, victorious and modest. Unihipili is our companion through
challenging financial times and towards ecological redemption.
Add Download to Cart

Astrology Unplugged (multimedia download)


Download: €53.33
Unplug your astrological experience from the 12-12 matrix and free your karma from predefined
superstition.
Add Download to Cart

An Interview with Cinderella (e-book)


Download: €66.91
Dwarf planets lurking in your house of marriage? 2007 OR10 "Cinderella", Eris, Quaoar, Orcus, 2002 AW197,
Ixion, 2002 TX300, Pluto, Charon, Sedna, Makemake, Haumea, Varuna and others.
Add Download to Cart

An Interview with Cinderella (e-book)


Download: €20.07
New giant dwarf planet 2007 OR10 delineated for the first time. Nickname Cinderella. 2007 OR10 as our
companion through the global financial crisis and towards ecological redemption.
Add Download to Cart

Academic Zodiac (e-book)


Download: €22.16
The Academic Zodiac has 22 zodiacal stations.
Add Download to Cart

32 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

Satan (e-book)
Download: €6.66
Venus drags her reptilian tail through the depths of your horoscope...
Add Download to Cart

Satan (e-book)
Download: €66.60
Your horoscope hides a reptilian tail! They never told you about Venus in Hydra or Pluto in Serpens, because
they will hardly know. An inspection of one's horoscope shows forbidden zodiacal positions.
Add Download to Cart

Cosmic Avatar (e-book)


Download: €7.77
Get all that you want, and get it now. Download all your wishes come true from the astral domain using
broadband personal magick.
Add Download to Cart

Satan (e-book)
Download: €666.00
As Venus drops from Pegasus through Pisces and into Cetus, celestial magick sinks into your lap. A complete
manual in personal reality rendering on the trail of the 22 constellations of the zodiac. Meet reptilian Venus,
LILIT VERA and the astrological I Ching Aspectarian on the Tree of Life.
Add Download to Cart

I Ching Aspectarian (e-book)


Download: €64.00
Transits and directions as suggested by the I Ching.
Add Download to Cart

Secret Mansions of the Moon (e-book)


Download: €59.41
6 out of 18 zodiacal constellations as occupied by the Moon were completely obscure to astrologers until
this publication disclosed the delineation for the 6 secret positions of the Moon. Moon in Auriga defines the
22nd constellation of the zodiac. This publication resumes all that we have learned in the past about the
special positions of the Moon. The examples include an one minute ephemeris for the 9-11 with Moon in
Orion.
Add Download to Cart

Initiation (e-book)
Download: €156.00
Are you ready to become your$elf? Or do you want just a dash of instant magick right now? What about
love, money and health in record time? More than 2000 pages of original RTRRT and 22/16 astrology
material. An initiation that spans from ancient Tibetan magick to NASA based astrology. Instant magick,

33 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

marriage and prosperity rendering tools, reptilian astrology, 22 zodiacal constellations, 16 ascendants, Wish
Wheel, death discreation, O5IRIS, RTRRT, O5 render all your dreams come true along with your Personal
Cosmic Secretary. (2257-pp PDF).
Add Download to Cart

PrO5perity Rendering ~ O5IRIS Initiation (e-book)


Download: €66.91
Render your prosperity in this lifetime and beyond.
Add Download to Cart

Prosperity Rendering (e-book)


Download: €25.53
Wish your wishes well with your Wish Wheel. Organize the download of your wish come true from the astral
domain. Your cosmic secretary is ready to deliver prosperity and so are you.
Add Download to Cart

Prosperity Rendering (e-book)


Download: €31.91
Master your own prosperity forever, even in minutes!
Add Download to Cart

Prosperity Rendering (e-book)


Download: €59.41
Achieve prosperity in record time! Have fun in rendering your own prosperity with the help of simple mental
exercises. Help yourself to the visualization of your goals. Prosperity is easily achieved when mental
shackles are removed forever...
Add Download to Cart

<12345>

34 of 35 07/26/2009 09:58 PM
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astrology

35 of 35 07/26/2009 09:58 PM
First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved.
No part of this material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for commercial
purposes or otherwise, without the written permission of the author.

FOUR PILLARS OF MODERN ASTROLOGY

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

The following FAQ resumes the basic precepts of RTRRT & scientific astrology. We
wrote the Academic Zodiac with respect, in addressing it as an inorganic initiator, that is
transcendent being, much as in accosting the planets and centaurs in evocation. The
appropriate reverence goes to the set of Precessed Ascendants for the current epoch, the
16 rings of power being the rulers of the planet, and presently the greatest among the 360.

WHAT ARE THE RTRRT?

The RTRRT are sets of magick tools. All the said tools are invisible and discrete, thus
generally mental in nature, in their application. Apart from the Personal Cosmic
Secretary, their installation and consequent application is instant. The RTRRT perform in
minutes, with the expected results materialized in five minutes to several days,
depending on the personal power of the operator and magic circumstances as well. Instant
magick means what it says, as one is immediately capable of producing any intended
events in real time. The RTRRT act in bending, hacking and changing the event matrix
right here, right now. Any occurrence can be changed, even in the past. Why walk the
plank of future bad habits along with succumbing to ominous astrological transits when
one can direct one's futurity according to one's own plan? Nowadays it is possible to
make miracles in minutes right upon your first RTRRT download.
WHAT IS SCIENTIFIC ASTROLOGY ABOUT?

Scientific astrology has nothing to do with any astrology of the past, as it hosts zodiacal
and ascendental positions that were never recorded before. You never knew that your Sun
was in Orion, much as the Masonic Philadelphia skies were mum about Serpens Cauda.
Scientific astrology is the discovery of your true horoscope as written by the real magical
astronomic stars. The field is a separate one, having no association with Vedic tradition
or whatever western derivation of the Sumerian system. One will hardly trace any
minimal association with Egyptian, Chinese or Mayan astrology, even in meeting
unavoidable sympathies with the native Navajo, Guam and Hopi tradition. Even if the
zodiacal position of Venus in Hydra was known to the Ancients, we do not have firsthand
information. Even if Venus rising in Pegasus was known to Dante, he does not record it.

WHAT IS INSTANT MAGICK?

The RTRRT are instant magick. Can you start right now? Yes, that is precisely the idea!
Anyone can start producing miracles in one's own life right here, right now!

WHAT IS INSTANT DIVINATION?

Astrology offers an instant divination system that anybody can learn in twenty minutes.
By anybody we mean boy, florist and butcher. One does not need any astrologer in order
to calculate the day of one's own marriage in minutes. Of course, marriage is but an
example. The businessman will seek contract along with excellent stock exchange timing.
The lover will calculate a lifetime of love in quarter an hour and the healer will know the
best times to counteract or exorcise a disease.

After a brief initiation, one is capable of divining the year and month of any marriage in
minutes. The divination process requires no special talent, astrological or astronomical
skill, ephemeris, computer, pen or paper. All calculations are done by heart, on the fly, by
sheer memory. It would be impolite to consult a laptop during a romantic dinner, thus the
astrologer and nobleman performs predictive synastry by heart.

WHAT IS THE ACADEMIC ZODIAC?

The Academic Zodiac is the natural environment of the planets. In other words, we
discovered nothing new: we just visited the planets in their own natural habitat. After a
twenty minute visit, we inspected the starry environment of the planets, thus delineating
Venus in Pegasus, Mercury in Sextans and Moon in Orion. Such zodiacal positions were
never known or delineated before, but the e.g. the WTC horoscope shares Moon in Orion
with Obama's own natal chart! Unlike the western or eastern horoscope systems,
scientific astrology derives from astronomic experience and is as such fully accountable
in every respect. We have the proof that a dwarf planet is in its exact astronomic position,
e.g. Pluto rising in Eridanus, while others may at best pursue their fancy.

WHAT ARE THE FOUR PILLARS OF MODERN ASTROLOGY?

1. Academic Zodiac (22 IAU constellations).


2. Precessed Ascendant set (16 IAU constellations) for the current epoch.
3. Universal Cartesian house system. (12/24 N&D houses)
4. RTRRT (Personal Future Changing Technology).

DWARF PLANETS

Newly categorized dwarf planet 2007 OR10 and centaur 2007 JG43 have recently been
delineated within our universal Cartesian house system. How was that possible? Our
constant research and development made it possible. Our delineations date from 1992
QB1, extending further from Varuna to Eris. All delineations were produced with the
object still unnamed by the astronomical community. That is, we follow a dwarf planet,
comet or centaur from its first days when it is discovered by the scientists. We publish the
first ephemeris for any newly discovered object, for the benefit of the astrological
community. As the astrologer does not have an early access to data, ours is the first
information for the general public. Thus, the first dedicated Eris publication was sold as
early as Aug 1st 2005. There are some 6 GB (sic) of dedicated as well as downloadable
Eris material online! We delineated all the dwarf planets in the 12 houses as well as
named and unnamed centaurs, along with relevant classes of objects, from Apoheles to
the outer guardians. Our is mission to serve the astrological community with the best
lateral solutions out of the eastern-western trap in which it fell in its best wish to adapt to
change.

ABOUT THE AUTHOR

Klaudio Zic is a modest European writer and composer, abiding in Venice area. Albeit
scientific astrology claims over 2000 (sic!) publications, much like Giger, the Author is
never available for public appearance. In disliking the use of Internet, the Author has
chosen not to be online at all.

An eventual reply by e-mail is however possible in terms of initiation. How does the
Author read his e-mail if he is not online at all? The e-mail in need of a reply is usually
by a registered RTRRT initiate. The secretary's assistant reads it and furthers accordingly,
so that it reaches the Author possibly in a couple of days. E.g. it is being faxed to him by
his secretary, generally known as Alixe. Details retained. Initiation can be downloaded,
thus enabling a true seeker in immediately starting to think and act like a magical being.

There is a growing variety of sites from which all kind of RTRRT and scientific astrology
material is procurable. One of the main historical sites remains http://lulu.com/astrology
with almost 2000 publications! Anybody using web search will find dozens of affiliated
sites and social networks where the material is readily available for download. However,
our recommendation goes to the editorial series, which tips the scales to the stargates of
astrology. In tipping off the reader, the editorials often provide bonus material as packed
in an informal way for the true RTRRT initiate and incipient astrologer.
Initiates were curious whether RTRRT stands for Masonry. One could say that in being
an RTRRT initiate, one is even grander than any Mason. The RTRRT are of great
assistance to sincere 32nd degree Masons in helping the planet grow according top racial
initiation. As the RTRRT can solve any problem on the three planes, they can help any
initiate, even important public figures to be incarnated in the next age to come. The
RTRRT tradition is especially cherished with the central European nobility, with little
lodges springing out according to European tradition. In the USA, the RTRRT are mostly
used in curing cancer, initiating pagans as well as a miracle factor within O.T.O. ritual.

Several initiates asked about horoscopes. The true RTRRT initiate often already has one,
as any registered neophyte will be eager to attune to the magical world of scientific
astrology. The report is often rather bulky as containing up to 500 MB or multimedia
material. Of course, basic love affairs and marriage are known to the minute. The
meridian constellations take care of your financial enterprises. Health and healing is
provided by dedicated RTRRT publications. Dedicated services are mailed to the client
along with personal initiation. A member of the Monaco nobility boasts a 1008 pp report.
She says that she prefers this personalized magical diary to her Veyron, because it tells
her where to go even out of this world, where the Bugatti can not go. The report acts as
guardian angel. We also call guardian angel the eastern star. This star is not available
from conventional horoscopes for the masses. As the person leaves one's old personality
behind, a new world under the true astronomic skies appears in guarding one's steps,
much as an Egyptian guardian angel star would safeguard our discrete community 12 000
BC.

Klaudio Zic
The Academic Zodiac & RTRRT are Copyright © 1995 - 2009 by Klaudio Zic, all rights reserved worldwide.
Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astr

Buy | My Lulu | Community | Help Customize Storefront | Log Out | View Cart

Klaudio Zic's Storefront - Lulu.com


* The Academic Zodiac consists in 22 zodiacal constellations.
* Which one of the 16 is your own true Eastern Ascendant?
* Change your personal future for the best right now! companion through the global financ
* Render your own reality with the Reality Rendering Tools. Add Download to Cart
* Resolve economical crisis to your own favor.
* Protect your family, identity, horoscope and futurity from superstition!
* Render and establish personal prosperity forever. Academic Zodiac (e-book)
* Catch up with the latest zodiacal upgrade.
Download: €22.16
* Render your own reality in minutes with the Real Time Reality Rendering Tools. The Academic Zodiac has 22 zodiaca
Add Download to Cart

Satan (e-book)
American Zodiac (e-book) Download: €6.66
Download: €16.22 Venus drags her reptilian tail throug
Add Download
Which one among the following three choices represents the proper historical ascendant of the to CartIs it
USA?
Ophiuchus, Serpens Cauda or Aquila?
Add Download to Cart

Satan (e-book)
Cascade (e-book) Download: €66.60
Your horoscope hides a reptilian tail
Download: €97.13 they will hardly know. An inspection
"Just paste yourself within an ideal situation and enjoy beforehand the quick issue that
Add can not to
Download help but
Cart
materialize as soon as impossible." Complete RTRRT instant magick initiation inside!
Add Download to Cart

Cosmic Avatar (e-book)


Horoscopelements (e-book) Download: €7.77
Get all that you want, and get it now
Download: €16.22 broadband personal magick.
Your new horoscope has some extra genuine elements in bright display. Like theAdd
original positions
Download of your
to Cart
natal planets. Better make some order in that seventh house as it is swarming with dwarf planets! A comet
there, a centaur here. Did we forget to mention the eastern ascendant?
Add Download to Cart
Satan (e-book)
Download: €666.00
Astrology in Open Space (e-book) As Venus drops from Pegasus throug
manual in personal reality rendering
Download: €22.16 LILIT VERA and the astrological I Chi
Add Download to Cart

I Ching Aspectarian (e-book)


Download: €64.00
Transits and directions as suggested
Add Download to Cart

Secret Mansions of the Moon (e-


rology First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved.
No part of this material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for commercial
purposes or otherwise, without the written permission of the author.

ELEMENTS OF THE HOROSCOPE

http://stores.lulu.com/astrology

cial crisis and towards ecological redemption.


Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

MODERN ASTROLOGY
al stations.

Since the discovery of the first cubewanoi back in 1992, modern astrology has made four
gigantic leaps towards its standard implementation within the board mainframe of a race
of space colonsii. These four pillars of modern astrology are enlisted as follows.
h the depths of your horoscope...

1) Academic Zodiac.
2) Precessed Ascendant set.
3) inUniversal
! They never told you about Venus Cartesian
Hydra or Pluto house
in Serpens, system.
because
of one's horoscope shows forbidden zodiacal positions.
4) Secondary angular direction.

The precession of the ascendants has been established after more than 6000 years of sheer
w. Download all your wishesblunder iii from the astral domain using
come true . The Academic Zodiac was constituted as authoritative zodiac for astronomers
and therefore astrologers alikeiv. An astrologer is of course first of all an astronomer, that
is a scientist. Since an astrologer is always initiated by an appropriate inorganic being, it
is mandatory that magical evocation forms the first step towards astrological initiation.
gh Pisces and into Cetus, celestial magick sinks into your lap. A complete
The universal
g on the trail of the 22 constellations Cartesian
of the zodiac. house system
Meet reptilian Venus, takes astrology into outer space v. The secondary
ng Aspectarian on the Tree of Life.
angular direction is the only reliable prediction tool for the astrologer in a world where
the Axis of Evil, Witchållow or Eris rule. A centaur such as Chariklo will conveniently be
directed in its extrazodiacal position e.g. in Centaurus. Asbolus will be directed in Lupus
d by the I Ching.

book)
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/as

Where is the Sun this year and when? When do the inner planets enter the zodiacal constellation of the
AEon? The June Editorial by Klaudio Zic contains authoritative zodiacal information for your incipient
astrologer. Your excellent reading during the sojourn of the Sun in Orion in the year 2009.
Add Download to Cart

Cetus (e-book)
Download: €22.16
The Age of Cetus is the age we live in. 2009 Cetus report including the inner planets.
Add Download to Cart

Aladdin XI (e-book)
Download: €69.98
Ever materialized a thought in record time? Setting your mind free unleashes instant magical results
starting from today. Your instant magick experience as enriched with Aladdin XI, Breaking Manacles and
Architect formulae. This complete RTRRT edition bring more original material that has made O5 the basic
instant magic technique for everybody. Apart from philosophical elaborations this edition elaborates on the
technical side of instant magick.
Add Download to Cart

Galactic Astrology (e-book)


Download: €16.22
Expand your galactic experience with the latest upgrade in modern astrology.
Add Download to Cart

Aladdin XI (e-book)
Download: €22.20
Instant magick fans will enjoy this essential upgrade of the O5 technique. For the first time, original RTRRT
Master material is revealed as recorded during the early O5 deliveries. Empower your instant magick with
the Aladdin series.
Add Download to Cart

16 Ascendants (e-book)
Download: €22.16
Which ascendant is really rising in your horoscope? Sextans, Hydra or Monoceros? A textual purport to the
16 Ascendants treatise. Get to know your true ascendant better.
Add Download to Cart

16 Ascendants (e-book)
Download: €108.00
Get to know the 16 ascendants rising at east in detail. Learn how to predict and create events in minutes.
Scan the matrix with the I Ching Aspectarian. Marriage Rendering Tools inside.
Add Download to Cart
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astr

2007 OR10 (e-book)


trology Download: €20.07
The major dwarf planets are an important factor in your horoscope. Premier dwarf delineations since 1992.
Add Download to Cart

Federal Reserve System and the Subprime Mortgage Crisis (multimedia download)
Download: €108.00
<< 1Th 5:3 For when they shall say, Peace and safety; then sudden destruction cometh upon them, as
travail upon a woman with child; and they shall not escape. >> If the economic trends turn out
unexpectedly against you, you did not read this report! Updated Orcus Report 2004 ~ 2018 with new FED
dwarf planet 2007 OR10.
Add Download to Cart

2007 OR10 ~ Dwarf Planets in the House of Love (e-book)

Download: €20.07
What is the influence of the major named and unnamed dwarf planets in your 7th house? Unihipili invites
another astrological adventure with 2007 OR10, Eris and the dwarf planets in love. An astrologer is always
updated as to the latest discoveries. Essential reading for the leader of the astro pack.
Add Download to Cart
Klaudio Zic's Storefront - Lulu.com http://stores.lulu.com/astro

Unihipili (e-book)
22nd constellation
Download: €20.07 of the zodiac. This publication resumes all that we have learned in the past about the
special positions of the Moon. The examples include an one minute ephemeris for the 9-11 with Moon in
New
Orion. giant dwarf planet 2007 OR10 as delineated in the 12 houses of the horoscope. 2007 OR10 has a
special affinity towards crystal clear relationship in fostering one's family resources. The character of
Add Download
Unihipili to Cart
has been found upright, determined, victorious and modest. Unihipili is our companion through
challenging financial times and towards ecological redemption.
Add Download to Cart
Initiation (e-book)
Download:
Astrology €156.00
Unplugged (multimedia download)
Are you ready to become your$elf? Or do you want just a dash of instant magick right now? What about
love, money and
Download: health in record time? More than 2000 pages of original RTRRT and 22/16 astrology
€53.33
material. An initiation that spans from ancient Tibetan magick to NASA based astrology. Instant magick,
Unplug your astrological experience
marriage and prosperity rendering from
tools, the 12-12
reptilian matrix22
astrology, and free your
zodiacal karma from 16
constellations, predefined
ascendants, Wish
superstition.
Wheel, death discreation, O5IRIS, RTRRT, O5 render all your dreams come true along with your Personal
Add Download to Cart
Cosmic Secretary. (2257-pp PDF).
Add Download to Cart

An Interview with Cinderella (e-book)


<12345>
Download: €66.91
Dwarf planets lurking in your house of marriage? 2007 OR10 "Cinderella", Eris, Quaoar, Orcus, 2002 AW197,
Ixion, 2002 TX300, Pluto, Charon, Sedna, Makemake, Haumea, Varuna and others.
Add Download to Cart

An Interview with Cinderella (e-book)


Download: €20.07
New giant dwarf planet 2007 OR10 delineated for the first time. Nickname Cinderella. 2007 OR10 as our
Klaudio Zic's Storefront - Lulu.com

Buy | My Lulu | Community | Help

* The Academic Zodiac consists in 22 zodiacal constellations.


* Which one of the 16 is your own true Eastern Ascendant?
* Change your personal future for the best right now!
* Render your own reality with the Reality Rendering Tools.
* Resolve economical crisis to your own favor.
* Protect your family, identity, horoscope and futurity from superstition!
* Render and establish personal prosperity forever.
* Catch up with the latest zodiacal upgrade.
* Render your own reality in minutes with the Real Time Reality Renderin

The Right to Dream (e-book)


Download: €27.70
EU calling USA. There is a new kid in town.
Add Download to Cart

Infant Astrologer (e-book)


Download: €22.16
Your true natal ascendant is marked with an "E".
Add Download to Cart

American Zodiac (e-book)


Download: €16.22
Which one among the following three choices represents
Ophiuchus, Serpens Cauda or Aquila?
Add Download to Cart

Cascade (e-book)
Download: €97.13
"Just paste yourself within an ideal situation and enjoy be
materialize as soon as impossible." Complete RTRRT insta
http://stores.lulu.com/astrology

Customize Storefront | Log Out | View Cart

ng Tools.

the proper historical ascendant of the USA? Is it

eforehand the quick issue that can not help but


ant magick initiation inside!
In the following introduction to modern astrology, the incipient astrologer is introduced to the
ephemeris of the Sun as it appears in the real sky. The report includes authoritative information as
concern the Academic Zodiac, Cartesian house system and Eastern Ascendant. May 5th 2009 Update.

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

NASA EPHEMERIS ~ SCIENTIFIC ASTROLOGY


Your horoscope will never again suffer SIXi SIGNS OF ERROR, as brute miscalculation on the part of
unscrupulous promoters of superstition has come to an end. The NASA ephemeris for the winter Sun is
an excellent introduction into astrology proper. The Sun is in Libra on Nov 23rd.

2008-Nov-23 00:00 Lib NASA JPL HORIZONS EPHEMERIS 2008-Dec-10 00:00 Oph

2008-Nov-24 00:00 Sco 2008-Dec-02 00:00 Oph 2008-Dec-11 00:00 Oph

2008-Nov-25 00:00 Sco 2008-Dec-03 00:00 Oph 2008-Dec-12 00:00 Oph

2008-Nov-26 00:00 Sco 2008-Dec-04 00:00 Oph 2008-Dec-13 00:00 Oph

2008-Nov-27 00:00 Sco 2008-Dec-05 00:00 Oph 2008-Dec-14 00:00 Oph

2008-Nov-28 00:00 Sco 2008-Dec-06 00:00 Oph 2008-Dec-15 00:00 Oph

2008-Nov-29 00:00 Sco 2008-Dec-07 00:00 Oph 2008-Dec-16 00:00 Oph

2008-Nov-30 00:00 Oph 2008-Dec-08 00:00 Oph 2008-Dec-17 00:00 Oph

2008-Dec-01 00:00 Oph 2008-Dec-09 00:00 Oph 2008-Dec-18 00:00 Sgr

The Sun is in Libra on November 23rd. It spends a week in Scorpius. The Sun enters Sagittarius after Ophiuchus, on December 17th.

Modern astrology not only corrects the many errors of the past, but also prompts the astrologer into
changing occurrence, such as a bad transit in one's futurity and even in one's own past (sic). The client
no longer expects the bad transit to happen at all, but is instead cured from superstition in the form of
oncoming disasters. The magus-astrologer is able to create and discreate any personal or global future
with the help of the reality rendering tools. Already introducing scientific planetary positions instead of
sheer superstition acts as exorcism on planetary level. Free your mind and rule your own existence!
SCIENTIFIC ASTROLOGY ASSETS

The basic assets of modern astrologyii are as follow:

A) The Academic Zodiac as fully scientific zodiacal environment, consisting in 22 IAU constellations.
B) The precession of the ascendant. The current eastern ascendant set has 16 IAU constellations.
C) Cartesian house system. The universal Cartesian house system operates even on spacecraft.
D) Reality rendering. The astrologer no longer waits for the (bad) event to happen as he creates events.

MODERN ASTROLOGY

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

You would settle for no less than scientific approach to your health care. A mother wants the best for
her children. The father gathers relevant information in order to decide financial issues. We are a
civilization that counts on authoritative data in its progress.

In that astrology is discarded as unreliable superstition, it is good to hear the news. Astrology nowadays
accounts for a reliable zodiac, ascendant set and house system as fully dependable on astronomy. The
old science has been reformed in order to meet the needs of a time when giant transneptunian
discoveries are the order of the day.

Even if you are not an astrologer, the benefits of information are vast, since one single zodiacal
information can change the course of one's life. In choosing a partner, one often mistakes due to false
zodiacs. Many had the wrong organ cut out on account of pseudo-astrological advice. It is time to learn
the benefits of an astrology that really serves humanity now, as well as in the new time to come.
BENEFITS

• Health. Your 6th House Neptune will never again be called 7th house Neptune.
• Love. All the loves in your life are predictable in minutes. Marriage timing gets minute in the
sense that we are able to determine the precise minute of the upcoming marriage.
• Child birth. Excellent timing depends on reliable information. Impossible cases can be handled
even when official medicine discards the possibility of having children. Generally couples
lacking ova and speramatozoa as well, can afford a baby already within a month's time.
• Academic career. In perusing the Academic Zodiac, one can not possibly be accused of
superstition. On the contrary, a solid knowledge of the scientific zodiac will silence any
lingering superstition, even in academic quarters. Since national heraldry is based on
astronomy, it is important to have some basic knowledge of our own identity as citizens and
Masons.
• Money. Excellent financial information matches scientific astrology methods.
• Sexual prowess. The correct use of stellar energy makes for sexual stamina and the attraction of
the correct Sun sign. Choose your partner according to the true zodiac and you will never again
suffer from any sexual incompatibility.
• Integrity. You will never have the wrong organ cut out on account of pseudo-astrological
advice. As armed with NASA ephemeris, you could even help the poor astrologer in washing
away a life of disinformation.

Scientific truth is a powerful tool in fighting superstition even in the dark Age of Cetus III and Kali
Yuga. The known bugs of the zodiac and ascendant set have not only been corrected, but a new system
as depending solely on the real sky has been instilled into the eye of Horus. While superstitious
horoscopes for the masses approach quarter of the sky (sic) of error, the magus-astrologer enjoys the
real sky after eons of sheer miscalculation, that was notoriously forbidden by the true Lord.
Standard procedure in horoscope analysis. Basic procedure done in minutes even without the computer.
All love affairs, marriage, children, divorce and career computed always without any tools, by memory.

1. Basic scan. EWNSZNiii; true ascendant, zenith, Moon, nadir, meridian constellation.
2. Marriage, children and career. Past and future life. Main dangers. Death hazard.
3. Reality rendering procedure in the removal of bad future events along with blessings.
4. Dwarf planets1, giant comets, centaurs, Apoheles, dark planets and objects of interest.
5. Documentation in animated AVI, GIF and PDF format. Zodiacality initiation.
6. Answers to specific questions. Up to 108 answers.
7. Secondary angular directions. Meridian constellation progression.
8. Extra-zodiacal analysis. Planetocentric analysis, e.g. Juno-centric in conjugal analysis.
9. Health analysis along with e.g. Temporary cancer cancellation (RTRRT).
10.Final dis~creation of obstacles, reality rendering initiation and blessings.

The RTRRT & 22/16 material is available through http://lulu.com/astrology and http://youtube.com/RTRRTV

• The zodiac has precisely 22 constellations as confirming to IAU standards and the Tarot.
• The present ascendant set consists of 16 rising eastern constellations.
• The meridian set of constellations is determined as separate set in financial astrology.
• The universal Cartesian house system has solved all housing problems for the colonsiv.
• Reality renderingv solves futurity correctionvi in creating events for the magus-astrologer.

The dream of every true astrologer has materialized with the establishment of the astronomic zodiac.
Scientific astrology has greatly prospered since its birth in the year 1992 vii. Its major achievements are
the Academic Zodiac, the precessing set of eastern ascendants and universal Cartesian house system.
The Academic Zodiac has 22 IAU constellations, along with a precessing ascendant set as currently
consisting in 16 IAU constellations. The magus-astrologer renders one's personal future at willviii. The
sequential projects and publications are mainly intimated in reverse chronology.

Free from future predetermined, the initiate laughs at Sabean worship.

Visual information: http://youtube.com/astrology2012 http://youtube.com/2012astrology

Scientific Astrology News ~ Updated January 18th 2009. Sol in Sagittarius.

PSEUDO-ASTROLOGY
REPUDIATED
WITH SIX SIGNS OF ERROR

1 2007 OR10 including.


• NASA is developing a new integration model as capable for accuracy beyond year 3000 BCix.
• The acknowledgment of precession is vital in setting new standards in scientific astrology.

Dear Academic Zodiac fan,

Thank you for entrusting us with your horoscope. Your downloaded bundle contains

1. A brief delineation of your purpose, astral group and afterlife settlement.


2. True natal ascendant and Guardian Angel contact instructions.
3. A detailed scan of the natal sky with all dwarf planets, comets and centaurs.
4. A life scan consisting in precise timing of the main events along with delineation.
5. A special review of your karmic love affairs with purpose and delineation.
6. An experimental new personal Reality Rendering method in instant magick.
7. A brief O5, Cascade & PCS initiation in ogg/avi/flv format with general mantras.
8. Your personal unique universal astrological magick mantra for all wishes come true.
9. A fighting agenda for your Guardian Angel against the demons in your life.
10.Your Personal Cosmic Secretary initiation along with basic Reality Rendering tools.
11.Animated secondary angular directions of the Moon for the first years of your life.
12.Your Kabirian name, servant spirit and astral code plus dream time accessoriesx.
13.Ascension days; possible and favorable times and places for ascension.
14.Three astrology/astronomy programs for Windows/Mac/Linux/Java.
15.Useful web pages, free literature, brochures, self-help and astrological initiation.
16.Outer Lodge details, lodge address, telephone number and contact e-mail.

Bonus material in the form of e-books was included in the language of your choice. Latino people can
contact their local guide of record. Yoga initiates receive a complete training program according to the
ancient tradition of our own lineage, along with ashram contact address. The download method of
choice was sent as confirmed to the e-mail address of your record. Files larger than 200 MB are
downloadable from our sites as enlisted, while lesser files that form the general body of the horoscope
and initiation are downloadable from scribd/lulu along with your secret password. Note that some
larger animations are downloadable separately in avi/gif format. The complete horoscope should not
occupy more than 500 MB. Thank you for your interest in keeping classified information discrete.

As follows is a sequential reconstruction of astrological progress 1992 – 2009.


First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved. No part of this material may be reproduced or transmitted in any form or
by any means, electronic or otherwise, for commercial purposes or otherwise, without the written permission of the author.

FASTIDIOUS READER'S DIGEST

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

What is modern astrology about? Does it take into account the new transneptunian discoveries? How
does it import data from the astronomic realm? Is it compatible with astronomy yet? These questions
are positively answered in detail within the prolific body of publications that form the basis for the
astrology of the New Æon2.

We succeeded in blending the wisdom of the ancients3 with modern astronomy, into a reliable
astrological system generally known as the Academic Zodiac. Scientific astrology was always based on
science, particularly when astronomy and astrology were one. The Lord banned superstition in
promoting accuracy in astronomic observation4.

Visually gifted initiates will enjoy the youtube5 animations http://youtube.com/2012astrology as

2 Age of Pegasus, also Age of Aquarius. Presently Age of Cetus III, as a subsection of the Age of
Pisces.

3 This varies from the Chinese equatorial system to the Mayan Venus-based observation. There is lot
of work to do in old Egyptian synastry, as well as through the comparatively recent epoch of
Denderah.

4 The details can be found in the Holy Bible as well as throughout our publications. The fastidious
reader will profit from our Abstract collections, also Bible Works. The Lord justly discouraged the
Levites from adopting non-precessed material, while encouraging them into astronomic observation.
The Hebrew were thus avid observers of the sky, much in the line with the Egyptians and
Sumerians.

5 http://youtube.com/RTRRTV http://youtube.com//astrology2012
present within the rich body6 of editorial material7 on the site http://lulu.com/astrology

What is there to discover? Astrology was never a boring dial with 12 signs that serve as ascendants. In
granting it the name of a system, we can laugh in mirth at an obsolete superstition of the past. It would
seem that the biblical ban was taken seriously only by the science of astronomy, while superstition
continued to infest the pagan market.

The pagan was left without guidance8, which is peculiar in an observing society. Whatever astronomy
was handed to us from the pagan domain, surely observed Orion as subecliptic ascendant with Cygnus
as galactic ascendant9. This is not only true of Ireland, but also of Egypt, China and Guam.

In our Masonic past, astrologers were not at all properly informed in the sequence, number and quality
of the zodiacal stations. Thus, the new Age of Pegasus would pass unnoticed even in a high initiate,
with Venus rising in Pegasus at east overlooked or even misinterpreted as any trivial pseudo-zodiacal
position. Taking for example Aleister Crowley, the otherwise gifted astrologer 10 had no tools in
calculating the arrival of any age at all. Crowley probably never knew the intricacies of Cetus and
Hydra. At the time, Masonic Britain believed in only 12 rising zodiacal constellations ascending at east,
as astrology was hopelessly separated from science in an ambient of sheer superstition.

Masonry particularly profits from the proper orientation11 of the Temple and its initiates. Understanding
heraldry is studying the heavenly vault. Taking the USA for an example, Aquila 12, Serpens and Lyra

6 Many animations are published as digital files: PDF, ZIP, FLV, animated GIF and other file formats.

7 In browsing the site, one will find free downloads, mostly in the Editorial form.

8 That is, no recorded update of precession was taken into account in the making of the horoscope.

9 Cygnus is the galax or galactic ascendant of the USA.

10 Born with Hydra rising, or even triune ascendant Monoceros, Canis Minor and Hydra. Distinctly,
Crowley and the British Masonry had no way of knowing the position of the Sun and ascendant,
even with Monoceros clearly boasting heraldic qualities within the mysterious realm of
subconscious ascendants.

11 Currently 16 eastern ascendants. The meridian constellations are studied separately, being distinct
from the ascendant set.

12 The probable ascendant of the USA, albeit Serpens Cauda is the most represented.
define most of the national heraldry13. The Lion and Unicorn are still secretly bracketing Hydra14, as if
in hiding the reptilian core of British heraldry.

Klaudio Zic

The Academic Zodiac & RTRRT are Copyright © 1995 - 2009 by Klaudio Zic, all rights reserved worldwide.
Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology

13 Some of the publications that illustrate this point are entitled Genesis Ascendant, Serpens and USA.

14 Leo and Monoceros appear as hiding Hydra, a possible hint at the reptilian nature of British
Masonry. As Hydra is Tiamat, the star crumble trail leads towards possible Persian origins of
national heraldry. Speculations assign Monoceros to a special animal as featuring in the Bible, much
as Lion is equated with hereditary claim in planetary rule; however, these high aspirations might
prove to be nothing more than a beautiful dream.
Reverse Chronology of Modern Astrologyxi & Magickxii

The incipient magus starts at the bottom.

• The Sun is in Libra on November 23rd. Sai Baba's birthday. Three signs of zodiacal offset.
• The Academic Zodiac celebrated its 3rd anniversary in August 2009. Happy birthday!
• The universal Cartesian house system takes Astrology into Outer Space.
• Pegasus Point established as delineated in the traditional twelve houses of the horoscope.
• The second coming of Lucifer with Venus in Pegasus in the dawn of the Age of Pegasus.
• Venus in Pegasus as planetary challenge after apocalyptic Venus in Hydra and Scutum.
• The zodiac gets transparent in order to help the better orientation of Masonic temples.
• Complete Works I, II and III by Klaudio Zic. The perfect trilogy for the astrologer-magus.
• Academic Astrology Journal, issues I – V. Editorial notes, news and bonus material.
• The Zodiacal Commandments of Amen-Re. Egyptian astrology demands resurrection!
• The Southern Skies resume what was said on the Meridian Constellations in Astrology.
• Taurus Rising report! Taurus is rising at east for five minutes every day at east.
• Cetus Report for the year 2009 including the inner planets in Cetus and the Moon.
• Masonic astrology takes off with Venus in Sextans, and the promiscuous 1967 generation.
• Computerless astrology for everyone. Calculating issues in minutes. Hands-free astrology.
• Marriage rendering astrology. 20 minutes divinatory initiation. Marriage rendering tools.
• Stellar sign: true natal star sign. Proposed Sun in Orion and Cetus. Age of Pegasus.
• Unicorn rising. Triune ascendant in ritual astrology. Lunar magick with Moon in Corvus.
• Winter births may have up to six signs of zodiacal offset according to the stellar zodiac.
• True star sign debunked as yet another zodiacal fraud after sidereal, tropical & eastern zodiacs.
• Six signs of zodiacal error. The zodiacal offset has been reformulated at its bottle neck.
• The zodiacal offset as pointing to racial inertia. Serpens Cauda as the ascendant of the USA.
• 1 minute Moon ephemerides: Moon in Sextans, Corvus and Auriga.
• 20 minutres astrology initiation. Instant marriage prediction technique for everyone.
• Astrology for non-astrologers: calculating issues in seconds. Fast horoscope scan.
• Ixion, Quaoar and Jupiter in Ophiuchus dynamism. The Green comet and Masonic TNO.
• The zodiacal offset at its bottle neck. Venus in Scutum. 6 minute Sun ephemeris: IAU ingress.
• Submersed ascendants. Hydra as representative of the subecliptic ascendants in astrology.
• Orcus and Ixion report for the financial years 2009 - 2010. Moon in Corvus in the year 2009.
• The zodiacal offset in European demonology. Serpens Caput as ascendant of Italy.
• True stellar sign. The zodiac is neither eastern nor western. It belongs to the stars.
• 20 minute astrology initiation for the planet as featuring on http://youtube.com/RTRRTV
• Centaurean positions like Pholus in upper Ophiuchus, as well as several recently discovered
dwarf planets have been scheduled as “fascist” within a new publication as dedicated to the
astrological root of original fascism, an Utopian, even taoist movement and philosophy.
• The H method in horoscope analysis features the 4, 3.5 and 5 classes.
• The new dwarf planet candidates are automatically fed into the horoscope wheel chart.
• Delineation in the 12 Cartesian houses for all major discoveries in the year 2009, most
prominently 2007 OR10. The publication includes half a dozen of “fascist” minor planets.

• Zodiacal design extends to our colonies, after a dedicated zodiacal study as concern planet
Earth. Cruithne is next, as planetocentric astrology gallops towards a new universe of variegated
possibilities.
• By keeping an eye on Faustini crater, the astrologer calculates the Moon impact chartxiii.
• Obama assassination. Dates when killers failed, along with future warnings for the President.
• 2007 OR10 updatedxiv for Vatican City, 666, Austin Osman Spare, NYSE, FED and Australia.

• 2007 OR10 updated for financial nosedown along with potential Obama assassination dates.

• 2007 OR10 secondary angular directions. Critical dates for the FED, KKK and Obama.

• 2007 OR10 delineated in the 12 houses of the horoscope.

• 2007 OR10 receives general as well as particular delineation.

• Horoscope noir for Obama and 2007 OR10. Inauguration day with Eris and 2007 OR10.

• 2007 OR10 has a specially affinity towards clear relationships as well as one's own reserves.

• Houses of betrayal (5), marriagexv (11) and divorce (7) for 2007 OR10.

• The character of Unihipili is very determined, victorious and modest.


• New giant dwarf planet 2007 OR10 delineated and published. Nickname Unihipili.
• 2007 OR10 as our companion through world financial crisis and towards ecological redemption.

• Venus in Pegasus and the dark Age of Cetus III. Pegasus as ascendant for the New Age.
• Ophiuchus and the six constellation zodiacal shift. Aton as central zodiacal station.
• Satan's zodiac. The definition of the zodiac. Pegasus as light bringer.
• Queen of heaven. Mayan cults. The bride as projected illusion. Phosphorus.
• Venus in Pegasus and the fallen bride of Brahma. Cetus and Middle Earth.
• The original bride. Satan as Venus. Samael et LILIT VERA. Chinese Nibiru.
• The Mysteries of the Sith. The Sabbath of Aton. Venus as fallen bride in Cetus.
• Horus opposing Eris in Cetus. Aton versus reptilian Venus. Second Epistle to Satan.
• Preparing for the major crisis: Prosperity Rendering Tools. Survival with prosperity enabled.
• New outer guardians and 2012 peaks. What vexes the USA ascendant? Ophiuchus transits.
• Immortal and white centaurs at the Stargate. Centaurean astrology for the year 2012.
• Enochian centaurs on the Tree of Life. Evocation of the centaurean Lords of the Æthyrs.
• Global financial nosedive and the reptilian centaurs in nether astrology 2012.
• The horoscope of the next Lord of the Zodiac. Horus cycle and Osiris precession.
• Dante and the reptilian centaurs. Horary charts for the nether journey of Dante.
• Age of Orion versus the end of the cycle. 2012 and the polarization of values.
• Nether ascendants in Egyptian astrology. Subconscious ascendants in synastry,
• Centaurs in Lupus and Centaurus and the prospect of alien life encounter.
• Navajo and Hopi expansion of the Academic Zodiac. Chinese equatorial equations.
• Orcus Report as expanded for new outer guardians of our solar system. 2008 SO218.

• Predictionsxvi for the years 2009 ~ 2012 for the 15 Sun signs & 16 ascendants
http://youtube.com/RTRRTV

• 2008 SO218 and the apocalypse. 2012 updated for the traditional USA ascendant in Serpens

Cauda.
• Precession report. The next set of ascendants. Who survives 2012? New skies 144000
delineation.
• Biblical basis for precession and reality rendering. Primordial void (Witchallow). Age of Orion.
• Moses and Hipparchus versus Ptolemy and flat Earth. Astronomy versus superstition.
• Surviving 2012. A little manual for the 144000. Where are new heavens coming from?
• Financial meltdown peaks. 2009 stock market nosedive according to Orcus Report.
• Further global financial crisis as caused by post-subprime major real estate market meltdown.
• 2012 dates for the USA updated with new outer guardians and 2008 SO218.

• WTC, Moon in Orion, Eris in Cetus, Osama bin Liden and the rule of the magi.
• Orcus Report as extended to year 2018 after a due NASA data base update on Christmas 2008.
• 2002 AW197 and Orcus reports as blended in a special financial package for businessmen.

• NASA updates data bases according to our best wishes. Debugging and improved features.
• Orcus Report as ultimate financial information for the investor in the year 2009 & decade
ahead.
• When not to invest in the year 2009? Dwarf planets bis in financial astrology.
• Financial analysis for the year 2009 includes refined timingxvii according to Orcus.
• Sidereal and tropical astrology for dummies. Guidelines for twenty minutes initiatesxviii.
• Marriage calculation for dummies. All the loves of your life in minutes.
• Financial astrology for dummies. When not to invest? Insolvent factors.
• The UK as central demoniac factor of the world economy crisis. Hidden reptilian agenda.
• Secrets of the Lion & Unicorn. Hydra initiates, reptilian agenda and world economy crisis.
• Financial perspective 2005 ~ 2085. The decade ahead. Hydra and the UK.
• Venus in Pegasus in the Dark Ages. Dante's Inferno. Venus in Pegasus, Pisces and Cetus.
• Infernal centaurs in Dante horary charts. Three horary charts for Nessus, Pholus, Dante and
Caco.
• Astrological maps for Middle Earth. Dante's Inferno, Mars in Cetus and London bombing.
• Venus in Pegasus at the end of the dark Age of Cetus III. Osculation of Venus in the New Æon.
• Osculation of the population of the Stargate. White, reptilian and immortal centaurs.
• Moon in Auriga and 1994 TA. Immortal centaurs in the Age of Aquarius. Sylphic reports.
• Fool at the Stargatexix in the Age of Aquarius. Moon in Auriga at the end of the Age of Cetus
III.
• The lost zodiac of the Moon. The 22 tarot cards and the 22 letters of the alphabet. Moon in
Auriga.
• The Last Star of Cetus III. The first prophecy of the Age of Aquarius. The bottomless pit.
• Dark Flux in the Age of Aquarius. The astrological delineations along the Axis of Evil.
• Moon in Auriga and the precession of the Stargate of Gods. The dawning of the Age of
Aquarius.
• Waning Age of Cetus III. The execution of the False Prophet. Persecution of astrologers. 2012.
• The sky is equal for everyone: woman and child, east or west. There is only one true sky.
• Full Moon in Auriga as crucial zodiacal position against Sun in Ophiuchus.
• The Pegasus works. Venus in Pegasus and the Child of the New Æon.
• Pegasus as critical zodiacal constellation in the Age of Cetus. Ascendant Pegasus in the New
Age.
• The horoscope of the Child of the New Æon. Pegasus ascending and Delphi bis.
• Pegasus approach. Venus in Pegasus, the Messiah and the Antichrist. New Æon.
• The first prophecy against the False Prophet. Massacre of astrologers in the Age of Cetus.
• Zodiacality helps in determining true zodiacal positions against 6 5 4 3 2 or 1 zodiacal sign
offset.
• Repudiation of pseudo-zodiacal superstition. The zodiac does not rise at east. 1-6 sign of error.
• Dark Planets update for the year 2012. Lamia directions. Thanateros and the apocalypse.
• Matrix Tarot deck upgrade for the year 2009 with new dwarf planets.
• Epochal ascendants as assigned to geomantic figures. The historical Leo Minor problem.
• The first prototype of the Orisha tarot approaches 88 ascending Loa.
• Compatibility proof of the Aspectarian against spirits, tarot and Sabian system.
• Three basic tarot decks as distributed between the 77 initiates.
• Enochian attributions of dwarf planets on the Tree of Life.
• The second Book of Enoch. Tracing the correspondences of the Sephira.
• Hebrew codex for the 11 dwarf planets on the Tree of Life.
• The triune sigil of Eris in Cetus I, II & III. Eris in Sculptor and Phoenix.
• Orisha compatibility with the 22/16 Matrix Tarot Deck. 88 voodoo cards.
• Every object of interest receives a tarot card with Sumerian sigil.
• Graphical upgrade of the zodiac. A minor revision of the centaurean sigil system.
• Loa as present within the ritual of the age of Age of Cetus.
• The Aspectarian as enriched by three tarot decks. The Kabir card.
• 88 ascendants delineated as meridian constellations in their precession cycle.
• Delineation for the basic 22 + 16 tarot cards. 38 as holy number.
• Kabirian Tarot deck as enhanced with the new Dwarf Planets, comets and centaurs.
• The Matrix Tarot Deck includes the 88 ascendants and 22 zodiacal constellations.
• Zodiacality of Scutum and the 4-sign error. P-zodiacality and the 6-sign error. Pluto in Serpens.
• Progressive repudiation of pseudo-astrology starts with one sign of error towards six signs (sic).
• Pseudo-zodiacal error amounts to six signs (sic). A further elaboration on the Academic Zodiac.
• Libra, Serpens Caput, Ophiuchus, Serpens Cauda, Scutum and Sagittarius: six signs of error
(sic).
• Six signs (sic) of zodiacal error debunked with Pluto in Serpens. USA ascendant Serpens
Cauda.
• Four signs of error with Venus in Scutum. Scutum is a zodiacal constellation. Juno in Scutum.
• Three signs (sic) of astrological error demonstrated for the winter Sun. Sun in Libra on Nov

23rd.
• Two signs (sic) of astrological error exposed as concern zodiacal positions. E.g. “Scorpio” is
Virgo.
• Two signs (sic) of error debunked as demonstrated by the proper observation of the ascendant.
• Aries, Libra, Capricornus, Gemini and Scorpius do not rise at east at the present epoch.
• The horoscope for Dante's Inferno. Delphinus, rising. Venus in Pegasus falling. Equuleus.
• Horary maps for Dante's meeting the three centaurs in Inferno. Central planetary map.
• Palden Dorje, Aleister Crowley and Dante compared in April publication. (Work in progress).
• Financial analysis of the world economic crisis for the decade ahead from Hydra perspectivexx.
• Personal real estate analysis as regulated by Moon in Auriga, Orion and Sextans.
• 2002 AW197 in zodiacal Hydra constellation in horary, election and financial astrology.

• Reality rendering in the real estate business. Active dis-creation of the subprime mortgage
crisis.
• Tipping the dragon scales. Hydra progressions in daily astrology. Nile precession and the spine.
• The ascendant set and zodiac are separate units, as in the real sky, so in your own horoscope
• Sextans in financial analysis. Moon, Mercury and Venus in Sextans. Orcus in Sextans.
• Ascendant Sextans and Outer Guardiansxxi in Sextans. Masonic astrology revised.
• Galactic ascendant, Axis of Evil and Dark flux in Anatomic Astrology. The sash of comets.
• Daily progression of the 16 ascendants for wearable computers (project). Portable horary
astrology.
• Reptilian extra-zodiacal astrology. The secrets of Draco. Ascension astrology in orgasm timing.
• Dating a reptilian. How does her Venus in Hydra act upon your Mars in Cetus? Monster sex.
• Tipping the scales. Reptilian ascendants in daily life. Sexual peaks using Reptilian Astrology
VI.
• Ascendant compatibility. Hydra versus neighbors and opponents. Short versus long
constellations.
• Marriage calculator for adolescents as plug-in for the 22/16 system. Supports dating astrology.
• Astrological lineage as dating from Menes and Egypt. The legacy of Babylonia, China and
India.
• Aboriginal astrology on spacecraft. Who were the first astrologers? Alien origin of intelligence.
• One minute astrology for children with instant prediction manual. Stock exchange for kids.
• Reptilian centaurs in astrology. Dante, Palden Dorje and Aleister Crowley. April.
• Alien ascendants compilation for near objects and axillary moons.
• Spacecraft astrology for Cruithne colons and baby delivery in outer space. Alien guardian
angels.
• Sun and the planets in 88 constellations. 88 ascendants in solar system astrology.
• Kabirian ascendants. Astrology of the inner man. True self in the stars. Stellar origin of the soul.
• Mars Venus galactic midpoint and Stargate dynamism in the galactic chart of the USA.
• USA Stargate Map dynamism. The galactic ascendant versus the stargates in the year 2012.
• The Grand Orient from Age of Orion to Age of Cetus. Astrological orientation in masonry.
• Masonic lodge orientation according to the Seal, Reptilia and ornithology.
• New Precession series launched on November 23rd with Sun in Libraxxii, Sai Baba's birthday.
• Cygnus and Lyra in American occult astrology. Galactic ascendant and the Federation.
• The Irish ascendant of the USA. Galactic ascendant progressions in Irish landscape astrology.
• The Astrologer of the Æon. Precession of the initiated soul. Age of Orion – Osiris.
• Nether ascendants in sexual and financial astrology. Hit the horoscope below its belt.
• Nile precession and Stargate orientation in Nubian galactic astrology. Cygnus and USA.
• Progressions of the galactic ascendant. Ornithological astrology of the USA.
• Galactic astrology 2012. London and the Great Seal of the USA. Lyran occultation.
• Regulus occultation and the New York lodge. The dark reign of the golden infant.
• The main 32 dwarf planets in marriage astrology. The seventh galactic house.
• The Hydra seal of Great Britain. Royal reptilian horoscopes and precession of the Unicorn.
• British court and reptilian descendants in royal marriage horoscopes. Prince William.
• Reptilian heraldry. The Last Unicorn and the great Hydra swindle in British Ahriman masonry.
• Mundane precession patterns in astrology in the Age of Cetus. Orion kills the Gemini twins.
• Galactic ascendant in planetocentric astrology. Juno-centric analysis of marriage charts.
• Progression of the galactic ascendant in soul mate horoscopes.
• Galactic ascendant in Stargate dynamism. Killer galaxy, Galactic center and Stargate of Evil.
• The precession of the Stargate of Hell in personal horoscopes. Killer galaxy in horary.
• Gryphon and vulture in basic American astrology. Reptilian dynamism of the Great Seal.
• Precession in natal astrology. Natal patterns, dark cults and the dis-creation of the wheel time.
• Procession of the main great holes along the Axis of Evil from Bible to the Dark Flux abysmal.
• Breaking the 12 spikes. Astrology, superstition, lie and the devil in personal dharma.
• Progressions of the ascendant. Ephemeris ascendant animations for incipient astrologers.
• Precession of the equinoxes from Ophiuchus to Cetus. The Age of Orion and the killer Stargate.
• Drac & 2002 MS4. Sarah Palin at the killer Stargate. Vampire objects across the galactic center.

• The precession of the Stargate of Hell in personal horoscopes. Killer galaxy in horary astrology.
• The Axis of Evil and Dark Flow in the Age of Hydra. Personal soul precession horoscope.
• The Age of Osiris versus Gemini. Moon in Orion, the WTC and precession of the horoscope.
• Precession of gods in sacred astrology. The 15 stations of the Sun in the natal horoscope.
• Galactic ascendant in royal marriage astrology. Progressing galactic relationship charts.
• Masonic presidents. George Bush, Nephthys and Canis Minor. Sarah Palin and killer Drac.
• Secondary angular direction of Eris in Pavo and the American dark totems. USA Dark Flux.
• Moon in Auriga and Venus in Orion as markers in secondary angular Stargate direction.
• Natal Sun in Orion in the Age of Cetus. The precession of the soul in the Age of Osiris.
• Stargate directions. Primary and secondary angular direction of the Stargates.
• Reformed Egyptian astrology: Osiris ascendant and the precession of the Stargates.
• Ascendant Unicorn established as main mediator between the Age of Osiris and Leo.
• 10 minutes astrology initiation for children: predict your own marriage in seconds.
• Precessed secondary angular directions in the Academic Zodiac environment.
• Precessed directions. Ephemeris for the ascendant. Precession in daily astrology.
• Precession of the Stargates as defined in the personal horoscope.
• Horizon- galactic dynamism in astrology. The precession of the galactic horoscope.
• Dark Flow integrated with the Axis of Evil and the Stargates.
• The Seal of the USA, 2012, London, UFOs, Galactic Federation, Lyra and the dollar:
• The horoscope of the Great Seal of the U.S.A. Basic vultures and gryphons in astrology.
• Eris Chiron dynamism and the great American crisis. Hydra tail and the civil war.
• Regulus occultation path in astrology and ascent of the secret NY Regulus lodge.
• U.S.A. ascendants: Cygnus, Serpens, Aquila and Lyra. galax versus precessed ascendant.
• Egyptian 3800 BC synastry as in the Academic Zodiac environment (Project).
• Egyptian horoscope for the U.S.A., Iris and Ipy dynamism. Stargate progression 2012.
• Vultures in the American horoscope. Kabiria Publications. Reptilian v/s ornithological.
• Ornithological astrology follows on the trail of reptilian astrology.
• Kingdom of Ra Ver Neit Nubty proclamation as partly published on Youtube. Kabiria
established.
• ET IN KABIRIA LEGO announces the new astrologer. Who is he and when does he come?
• Dark twin horoscope in reptilian astrology. The stranger within intrudes into your own choices.
• Detailed astrology of the Killer Galaxy, Stargate of Hell and Galactic Center. Sarah Palin Drac.
• Is her Venus in Hydra compatible with your Mars in Cetus? How do your Stargates cooperate?
• The dark side of the horoscope. Someone you never knew (but suspected in?) lives within you.
• Stargate activation. When is your Stargate active? Secondary angular direction of the Stargate.
• Precession of the Stargates. Directing the personal Stargate across past and future incarnations.
• Reptilian love affairs. what happens when two reptilian horoscopes meet? Hydra directions.
• The intersection of the Dark Flux with the Axis of Evil as alternative Stargate.
• Prosperity astrology. Discreating financial crisis while establishing collective prosperity.
• Dark twin horoscope. Using the Axis of Evil. Timing the Dark Flux for gain on the market.
• 16 versus Hydra. Reptilian Synastry upgrade. Deucalion/Ceto new moon and global floods.
• Annunaki and the outer guardians. Travel schedule with the help of the Dark Flux.
• Eris across the Dark Flux. Eris in Centaurus and the Red Ring of Life.
• The progression of the American ascendant from reptilian to plumed. Serpens & Aquila.
• Mexican heraldry. Aquila snatches Serpens. Occult symbolism of national ascendants.
• Your other horoscope. The stranger within gets his own natal chart.
• Dark twin horoscope, the Dark Flux and Axis of Evil as shade and projection.
• Plummeted ascendants. Birds and reptilian DNA in horoscopes of giants.
• Dark planet Dagon in the horoscope of giants. Dark horoscope and the Loa.
• Reptilian astrology test. Are you reptilian? http://youtube.com/2012astrology
• Masonic constellations in astrology. Keane Reeves and Mercury in Sextans.
• 2002 MS4 as masonic currents in Serpens Cauda. The 4 rulers of the U.S.A.

• Quaoar in Ophiuchus at the 12th cusp of the horoscope of the U.S.A.


• The Annunaki cycle and outer guardians, an expansion of the da Vinci cycle for Eris.
• 2004 XP14 and the American elections. Quaoar in Ophiuchus as mainstream propaganda.

• Juno in Scutum and the new masonic order for chaste women. The female white front.
• Lacerta in business horoscopes. Meridian constellations in reptilian financial astrology.
• Plumed Serpent across the American ascendant. DNA ascendants i scientific astrology.
• Chariklo and the red ring of life at the Dark Flux and axis of Evil crossing.
• The Union of the Snake. Exposing the list of countries with reptilian ascendantsxxiii.
• Serpens versus Hydra. The clash between reptilian races and American Civil War II.
• Alexandrian plot. The dark fraction, RA Moses' 22 zodiac and the treason of Ptolemy.
• SIRIVS Lodge and the Owl in masonic heraldry. Ramming astrology.
• The Temple of the Snake. Bohemian Grove astrology. Solstice of the Owl.
• The Philadelphia telescope and new American masonry. Plot within the Lodge.
• The Mexican heraldry plot. Aquila versus Serpens. Maximilian and the Vatican.
• Expansion of Pepin the Short through Hapsburg and Vatican.
• The 7 Hills of Hydra. Sextans and the Stargate in Vatican's horoscopes.
• Sextans in all Russian horoscopes. The Vatican connection.
• All the U.S.A. presidents with reptilian ascendants. Barbara Crowley Bush.
• Sleeping agent. Lacerta an Draco in natal astrology. The second reptilian count.
• As above so below. The Great Snake in the sky. Hidden LA and the reptilian zodiac.
• Digging in the dirt. Reptilian astrology for Hollywood and its Hebrew legacy.
• Aquila and Lacerta in the horoscopes of CEO and grand masons. The tycoon aspect.
• Reptilian ascendants in the agendas of the U.S.A. presidential candidates.
• Hidden reptilian ascendants of Italy, Vatican, the United Kingdom and U.S.A.
• Serpens and Hydra in heraldry, masonry and astrology. The 32nd degree temple.
• Reptilian astrology in Australian heraldry. Dorado precession and the Child.
• Two signs of error in European astrology presented as work of the Dark Lodge.
• Ptolemy debunked. The precession of the ascendants against the “fixed sky”.
• The 16 eastern ascendants as confronted with geomancy.
• http://youtube.com/astrology2012 illustrates the precession of the ascendants.
• The 22 letters of the Hebrew zodiac as enlivened within the Academic Zodiac.
• 32nd degree masonry astrology on youtube announcing the end of times.
• Hidden zodiacal cults in Europe. A note on Sun in Orion and Sun in Cetus.
• Zodiacal plot debunked down to the roots of antisemitism.
• Black swan operation. British court and writer David Icke confronted with reptilian astrology.
• Examples of Dark Flow and the Axis of Evil in Cartesian house direction.
• Witchallow and Witchollow projected into the Dark Flow. The Mordred effect.
• The horoscope has two primary axis, the Axis of Evil and experimental Dark Flow.
• The Axis of Evil has been rotated to the right around the Dark Flow midpoint.
• Eris and the dwarf planets have been directed along the Dark Flow.
• Secondary altitude direction along the Dark Flow.
• Dark Flow has been entered below the Axis of Evil.
• Experimenting with Dark Flow in Centaurus constellation.
• Chariklo and the red ring of life reactivated in Centaurus.
• WMAP cold spot directed by altitude. Cartesian house directions.
• Eridanus direction. Dioretsa as Sedna WMAP midpoint.
• Petition to UNICEF for children birth rights. Children have right to their true natal skies.
• Asyut Minya precession and the Kabiria concept in planetary exorcism.
• Nile precession maps and Stargate orientation in galactic astrology.
• Conception horoscope. The Night & Day house system has 24 houses.
• Third version of kabbalistic attribution for the 22 zodiacal constellations.
• The progressive Hebrew zodiac as dwarf planets scale. 22 musical dwarf planets.
• Incantations, sigils and mantrae for the 64 main dwarf planets.
• Centaurs in theurgy. Elipinon is Asbolus. (Work in progress).
• 360 angel guardian stars receive dwarf planet attribution.
• Snow White and the seven dwarfs system. Dwarf planets for children.
• The dark planets are integrated into the Tree of Life in 16+1 fashion.
• Dozens of Centaurs attributed to the hidden Æthyrs around the Tree of Life.
• 64 dwarf planets assigned to the Tree of Life. Ain Soph problem solved.
• 32 dwarf planets assigned to the (A'aTz ChIIM) Tree of Life.
• Sun in Orion and Cetus implemented into native astrology and reformed Egyptian astrology.
• Cartesian house system implemented into native astronomy. The default is no house.
• Dwarf Planets in the 12 houses updated for the latest H =< 4 objects.
• Navaho and Hopi astronomy blended with Egyptian, e.g. Selquit & Rabbit Paws plug-in.
• Elevation equations compared between WTC and LHC. Timing catastrophe equation set.
• Monsters Typhon, Ceto and Logos updated for LHCxxiv.
• Makemake and Haumea updated. Haumea enters Bootes. Bailout.
• Iah congregation of planets. Spica Virginis bracketed. The fool's aspect. Bailout.
• Hydra tail and the decline of the Prince of Darkness. Where is hell located?
• A decade of economic decay, war lost and “socialistic capitalism”.
• 2008 KV42 full delineation published in the 12 houses.

• D zodiac defined. The first vampire zodiac. Cross grid with X zodiac. Pavo and Reticulum.
• 2008 KV42 Drac delineated along with Buffyxxv. Vampires in astrologyxxvi. Outer guardians

update.
• Horoscope for the Moon impact. Faustini-centric horoscope for the first impactxxvii.
• Tony Colaprete delays mission. Muddled results predicted. Islamic world alarmedxxviii.
• Petition to Anthony Colaprete of NASA. Islamic apocalypse.
• Anthony Colaprete gives mission details. Moon scheduled for bombarding in the year 2009.
• '50 Moon nuke conspiracy disclosed. LCROSS mission swapped.
• 2009 Moon scheduled for double impact. Faustini crater.
• 2005 FY9 named Makemake. 2003 EL61 becomes Haumeaxxix.

Record # Epoch-yr Primary Desig Name H


-------- -------- ------------- ------------------------- -----
50000 2001 2002 LM60 Quaoar 2.67
90377 2004 2003 VB12 Sedna 1.56
90482 2001 2004 DW Orcus 2.30
134340 2006 (undefined) Pluto -0.70
136108 2006 2003 EL61 Haumea 0.18
136199 2003 2003 UB313 Eris -1.24
136472 2006 2005 FY9 Makemake -0.48
• Pluto is redefined as plutoid within the historical P Zodiac.
• A minor update for ex pseudo-classes of Earth co-orbitals, Apoheles and Outer Guardians.
• The Earth umbra is determined by house and major conjunctions, “Earth in the horoscope”.
• The Stargates have been aligned with supervoids along the Axis of Evil.
• The Bootes supervoid receives major status within the Axis of Evil.
• The WMAP cold spot in Eridanus is paired with the Bootes supervoid.
• The Axis of Evil has been determined as standard axis for every horoscope.
• Chinese Olympics with bad omens from Vesta, 2002 AW197, Orcus, Jupiter and Saturn.

• The 2006 – 2012 subprime mortgage crisis has been determined against the fall of the Fed.
• 2014 reestablished as focal year for the world crisisxxx and Christian apocalypse.
• Further global economic crisis announced for the year 2008.
• Subprime mortgage crisis happens as predicted by 2002 AW197. Black Monday.

• A special study is published concerning centaurs in the constellations of Centaurus and Lupus.
• Centauress nymph Chariklo has been associated with the discovery of alien life.
• The ring of life has been announced in the constellation of Centaurus.
• Alien life may be present on Titan as well as reddish centaurs and comets.
• Witchållowxxxi determines the date of the Armageddon according to military analysis.
• Witchållowxxxii has been directedxxxiii, assuming full role in astrological predictionxxxiv.
• Witchållowxxxv receives its delineation in the 12 housesxxxvi (Night & Day house system).
• The WMAP cold spot is ascending in Eridanus. Witchållow introduced into astrology.
• The Dark Flux – Axis of Evil dynamism in Stargate astrology. Killer stargate.
• World economic crisis with 2002 AW197 in Hydra. Subprime mortgage crisis.

• Venus enters Hydraxxxvii with Jupiter in Ophiuchusxxxviii, announcing the Antichrist.


• Mercury in Orionxxxix follows Mars in Cetus in the year 2007.
• The One who Comes is determined in 650 years. Age of Aquarius after Cetus III.
• All dwarf planetsxl with to H < 5 were delineated for the benefit of future astrologersxli.
• The academic zodiac was introduced in August 2006 having 22 IAU constellations.
• Hydra tail and triune Cetus astrology. The three ages of Cetus. American civil war.
• Eris receives copious delineationxlii since its appearance as “Xena” (2003 UB313).

• The X Zodiacxliii has been published on August 1st 2005 along with 2003 UB313.

• 2005 FY9, 2003 EL61, Orcus, Quaoar, Sedna, 2002 AW197 and Ixion delineated.

• Angel guardian and the precession of the ascendant. Occult rising star in personal dharma.
• Transneptunian Astrology upgrade. H < 4 with Eris in the 12 houses.
• The P Zodiac is valid conclusively with August 2006 as official Academic Zodiac.
• The planetocentric systems xlii receive their local zodiacs along with galactic ascendant sets.
• Transneptunes in Enochian Æthyrs. Web awards. I Ching Aspectarian integration.
• Eris displaced Pluto on the expanded Tree of Life. AIN SOPH redefined.
• Reality rendering becomes standard occult procedure. Instant magick for everyone.
• The Personal Cosmic Avatar in the RTRRT suite of instant magick initiation.
• The “outer guardians” have been delineated within the Nibiru Research project.
• All centaurs; SDO, cubewano, plutino, KBO; Apoheles & Earth coorbitals delineated.
• The Moon and Mercury received their zodiacal definitionxliv.
• Lunar, Mercurial and Venusian zodiacs. Martial zodiac. 13th jovial intelligence.
• Venus delineated through the 21 constellationsxlv.
• The 17 dark planets with further purport. Lamia or Nemesis prominent.
• The Changes have been directed within the “I Ching Aspectarian”xlvi.
• Riccioli and LILIT VERA in modern times. Last observations of dark moon Lilith.
• Cassini Lilithxlvii, the observed dark moon, delineation & elements disclosed.
• All centaur objectsxlviii delineated as discoveredxlix.
• The scientific zodiac and set of current ascendants has been re-determined.
• The ascendant of the U.S.A. has been determined as Serpens Caudal.
• There are nearly 30 zodiacal constellationsli. The birth of the N2 Zodiac.
• Fed as determiend by Phoenix constellation. Da Vinci cycle. Eris and Phoenix.
• Reality rendering as planetary exorcism. Breaking the 12 spikes. Astrology debunked.
• The set of meridian constellationslii as delineated for use in financial astrology.
• Planetocentric Astrology. Eros, comets and Phobos-centric horoscopes.
• The set of meridian constellationsliii was delineated for use in financial astrology.
• Planetocentric experiments. Eros, comets, Phobos. NASA JPL HORIZONS.
• Detailed scanning of the Earth zodiac and local zodiac. Cruithne zodiac.
• The zodiac and ascendant set reformed in the famous half an hour.
• The academic zodiac research starts with Moon in Sextans.
• The reformation of Egyptian astrology. Early Egyptian synastry studies.
• The ascendants determined for the first dynasty. The precession of the ascendants.
• The set of ascendants for the current epochliv determined as 16 IAU constellations.
• Astrology debunked: three signs of error. NASA ephemeris versus superstition.
• The Real Time Reality Rendering Tools introduced as personal instant magick.
• 1992 QB1lv and centaur objectslvi Pholus, Nessus and Asbolus were delineated.

• The end of sidereal and tropical astrology. Vedic astrology upgrade with awardslvii.
• First zodiacal draft (28 IAU zodiac). Ascendants for the epoch determined.
• The ephemeris for the Sunlviii was determined according to IAU standards.

Klaudio Zic

Copyright © 2009 by Klaudio Zic, all rights reserved worldwide.


Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology
Copyright © 2009 By Klaudio Zic. All Rights Reserved. No part of this material may be reproduced or
Transmitted in any form or by any means, electronic or otherwise, for commercial purposes or otherwise,
without the written permission of the author, except when permitted by law.
First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved. No part of this
material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for commercial purposes or otherwise, without the written
permission of the author.

TRUE EAST

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

FIRST

At first there is the trusty astrologer whose astrology spawns wonderful flowery language. Someone
you can trust, perhaps a Jungian astrologer. Astrology likes to associate with science, especially
spiritual training systems. Thus, the fine energy body centers are associated with planets. Dead on
target, you proceed to the next step.

SECOND

One day sooner or later, even the trusted astrologer will confide to you some secrets of his art. Some
stars as pertaining to the sign in question are in fact living in a faraway constellation. Zodiacal offset
will be mystified as ayanamsa and a new term will be introduced. Vedic astrology will be called
sidereal and you will be informed that they follow the stars while we follow the Sun. In following the
Sun we lose the stars and perhaps vice versa happens on the Indian subcontinent. The two systems will
ultimately blend in one, with due corrections and a little caveat. You have been served a contradicting
pair which you absorbed as dialectic unity, that is, you swallowed another binary complex. False ego is
made of such binary clusters of which both are untrue but when strung together they sell as
contradiction. Opposites attract, therefore if she does not smoke, she is attracted towards an intoxicated
fellow. Such inane prepositions are conveyed by the media, which of course form the false ego of this
planet. One's personal ego is in fact made of pairs of opposing contradictions, called yin yang. In
discreating the ego complex, one finds out true mind to be free from binary samsara.

THIRD

Your natal ascendant might be classified as Libra. However, if you would travel eastward at birth, you
would not discover that constellation rising at east. If you were born in India, the same applies.
Astrologers never actually meant to measure the eastern ascendant, much as they avoid the cardinal
points. Astrology is based on the motion of the Sun, which roughly determines the zodiac. The planets
were not at all taken into account in determining the zodiac. The zodiac was defined as the simplified
path of the Sun, in other words, the ecliptic was the zodiac. Probably the system functioned in Sun sign
astrology.

FOURTH

Carl Gustav Jung was born with Adler ascending. The eastern constellation was Aquila at birth. The
USA have been born with Serpens Cauda ascending and celebrated with Aquila rising at east. Vatican
has been born with Sextans ascending. George Bush was born with Canis Minor rising. Aleister
Crowley was born with Hydra rising, but he could in fact have a triune ascendant including Canis
Minor and Monoceros. Italy was born with Serpens Caput, therefore Alpha Serpentis. There are
moreover two to three signs of zodiacal offset. Thus, sai Baba was born on November 23 rd with Sun in
Libra.

FIFTH

After some eastern experience, it will appear that your trusty astrologer never knew his own Sun sign
very well. After some astronomic experience, Europe suddenly appears void of any astrology since
Hipparchus. As an astrologer must be an astronomer in order to be dead on target, only astronomers
would classify. Alas, even astronomers never measured the zodiac, much as they were completely
unaware of the precession of the ascendant. Not that they occasionally do not register Moon in Auriga,
they just don't care. The zodiac was never popular with European astronomers. The interest of
astronomy lies elsewhere. Nowadays and astronomer will assume that the zodiac is an obsolete
astrological device. The zodiac and ascendant set do not pertain to astronomy at all.
SIXTH

There were many house systems in the past, enough to form a village. But the village was displaced.
They were all deceived. One house system to rule them all is based on the cardinal points. Yes, dead
simple. We call it Cartesian house system.

SEVENTH

The local zodiacs are all hosted within the Cartesian house system, no matter where the colon or alien
go, this or another universe. The local zodiac for planet Earth has 22 IAU constellations. There are
therefore 22 zodiacal constellations in all. The eastern ascendant set for the current epoch counts 16
ascendants. There are therefore 16 eastern ascendants for the present epoch. The ascendant set changes
with precession. Thus, in the past, we had two dozen ascendants. The total number of ascendants for
planet Earth is 88.

ASTROLOGY

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

VEDIC ASTROLOGY

Perhaps the best and most reliable tradition that was tested for Æons is Vedic astrology. The flowery
language of the Vedas describes the solar system and Milky Way in parables, but also numbers. An
extremely complex system was formulated by the sages, as possessed of wisdom and excellent counsel.
Brahma is said to be the first astrological initiate, therefore it is possible to trace Vedic astrology back
to the beginning of time.

SIDEREAL ASTROLOGY
In an effort to escape the many traps of tropical astrology, an astrology strangely called sidereal was
formulated. One will suppose that sidereal astrology has in fact nothing to do with astronomy, albeit the
name would allude at some connection with the real stars. True sidereal astrology would in fact have
Ophiuchus among the ascendants for the epoch. Therefore sidereal astrology awkwardly stands
between real sky astronomy and tropical astrology. The precession of the ascendant is of course not
discovered at this point, and the zodiacal constellations are formulated for the use of the masses, rather
than in accordance to the observed sky. In final analysis, what remains of sidereal is the name.

TROPICAL ASTROLOGY

The Sun is in Libra on November 23rd. This is probably news to anyone “into astrology”. Sun in Libra
is an observable position, therefore everyone is invited to look up to the sky for proofs. One will
discover that the Sun will spend a week in Scorpius before heading towards its central station in
Ophiuchus. The Sun is in Sagittarius for Christmas and New Year. Which Sun do we talk about? When
we speak about the Sun, we imply its astronomical position in the real sky. This has absolutely nothing
to do with mass superstition. The field of tropical astrology abounds with traps, oddities and irrelevant
formulations. From the astronomic point of view, tropical astrology is mere fancy, and as such it can be
discarded without further ado. An astronomer will perhaps look upon Vedic astrology with some
sympathy, but when we state that astrology diverged from astronomy at some point, we generally
allude to tropical astrology. The bulk of error is so abundant that the whole complex can be discarded
and burnt as web of lies. Probably no astrology offered so many flaws and misconceptions as tropical
astrology. To star with, no tropical astrologer will ever nearly guess the position of the Sun. People
who are born with Sun in Virgo will believe that they are “Scorpio”. Belief is a wonderful thing when
applied to provable facts. One can believe to have “Capricorn” ascending at east even when Pisces
were rising at birth. Capricornus does not rise at east at the present epoch, which is easily proved even
without a telescope. Proof and experimentation pertain to modern science, not superstition. Superstition
caches on lack of relevant education for the mystification of the naïve masses. This is where astrology
diverges from real sky. On inspection, zodiacal offset amounts to six constellations. In other terms of
general comparison with the simplified sidereal systems, the error seems to be roughly one sign only.
However, meticulous analysis will soon expose two to six constellations as concern zodiacal shift.

ASTROLOGERS
An astrologer is a rare phenomenon as usually associated with the avatar for the Æon. Thus Brahma
initiated the first astrologer. Enoch walked with God before Hipparchus rediscovered precession. The
next astrological avatar might be expected with Venus rising in Pegasus. The present Age of Cetus III
is a difficult stage for science in general, as the world sinks into the realm of superstition. We e.g.
Pretend to know everything about the pyramids although we are incapable of building them. Dark
pretence is the rule of the day as the Sun sinks towards Cetus on spring equinox. Europe probably
never had astrologers at all, but there were people whose guesswork is cherished as culture. Inane
concepts include a two to six signs of zodiacal offset Aries rising at east and Pluto in Pisces. Much as
Pluto is incapable of entering Aries, so Aries fails to rise at east at the present epoch. The problem lies
in assuming that the astrologer does not need the real sky in order to operate any inane “divination” and
offer prophecies. Surely, in remote epochs the astrologer did partake of astronomical observation, but
today it is not the case.

CONTEMPORARY ASTROLOGY

Both sidereal and tropical astrology fail to include the precession of the ascendants. Sidereal astrology
is nothing but tropical astrology shifted randomly as if to appear correct. Appearance can be deceiving
as it will be immediately noticed in observing the real sky. Astrologers of course usually do not observe
the sky at all. The so-called astrological programs seldom have anything to do with one's real natal
skies. Observation, on the other hand, requires pragmatism and study, while superstition may improvise
any issue. Since astronomy is hardly the topic of general education, most humans do not have any ideas
as to the position of the Sun. It is probably generally assumed that the Sun always rises at east, where
the 12 zodiacal signs ascend. This is of course far from being true.

ASTRONOMIC ASTROLOGY

The ancients and so-called primitives were not superstitious at all. Flowery fabled language often
describes precession where the reader would find only trees falling with heavens tumbling down. The
rediscovery of precession by Hipparchus was surely the most welcome as well as isolated contribution
to astronomy and therefore astrology. The ascendant set namely travels according to the laws of
precession. Strangely, even the Indian thought fails to formulate the precession of the ascendant. True,
a rotating zodiac is a handy educational tool, but in inspecting the east one would fail to observe it. The
real skies hold many unwelcome surprises to the slaves of superstition. The natal skies host 22 zodiacal
constellations along with 16 ascendants for the present epoch. This formulation is astronomically
correct as well as universal. Astronomers all across the globe have their convention, which helps
formulating further applied theories according to the generally accepted standards of the IAU.

ÆON
First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved. No part of
this material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for commercial purposes or otherwise,
lix
without the written permission of the author, except when permitted by law. Initiate writers, please refer to the Copyright note .

PEGASUS

The world has changed. We see the reflection of another sky in our deep waters. Soon, as Pegasus will
rise at east, we shall behold the eastern star sinking towards us, in knowing that She has arrived. With
the portent of rising Venus in Pegasus, the New Æon is announced by its light bearer. FIAT LVX.

TAROT
The Fool is born with Moon in Auriga. As the skies slowly rotate over our heads, generations change.
16 court cards rotate on daily basis over our eastern horizon. Civilizations are determined by the
changes in the eastern ascendant set, rulers follow the meridian constellations, while the sages meditate
upon the polar stars. 16 are the court cards and eastern ascendants for the current epoch. Among the 88
ascendants, 22 are special, at least for the planet we live upon. 22 is a number associated with the
alphabet and tarot initiation. This set of constellations forms the Academic Zodiac.

VENUS IN PEGASUS

Pegasus will rise at east, Venus will drop through Pisces and into Cetus, and a new light will shine in
the lower waters of creation. The Lamb of God does not rise at east in this accursed epoch of Cetus.
Aries is not an eastern constellation any longer. The sun is associated with the Cetus constellation at
spring equinox. Hayagriva is the avatar who retrieves astrological knowledge when knowledge is lost.
Precession determines the ages of man and spirit, as the ascendant set shifts in quality and number over
the eastern horizon.

PRECESSION

There is the Age of Lepus and Age of Orion, the age of the cowardly pharaoh and age of Osiris, much
as the Age of Pisces overlaps with the Age of Cetus. The Age of Cetus III is the third subsection of the
Age of Pisces. As precession returned to astrology, we count 16 ascendants rising over our eastern
horizon for this epoch. The 88 ascendants form a solid body of knowledge, especially as applied to the
dwarf planets in remote epochs.

DWARF PLANETS

Modern astrology is a daily updated feed, where a newly discovered dwarf planet is immediately
imported into the horoscope chart wheel. The newly developed NASA model enables prompt
delineation of dwarf planets even at remote epochs, such as the Age of Orion. Astrology was passed to
the first initiate by the local Brahma in person. Later on, Enoch walked with God. Hipparchus
rediscovered the divine law of precession, while elsewhere belief in flat Earth was kept to the point.
FLAT EARTH

This belief still persists in the form of 12 rising zodiacal signs at east. Contrary to the Bible
admonishment and ban, flat Earth persisted in European superstition, even when officially banned as
idea. People are made to believe tat there are 12 zodiacal signs rising at east in their horoscopes.

FALSE EGO

To believe in 12 fixed stations rising at east is to persist in the heresy of a fixed sky. Such an imagined
sky never moves, as the universe is imagined as static in the popular mind. Essentially, false ego is
disinterested in precession and change, much as the “astrologer” avoids any confrontation with the true
skies. False ego is a collection of improvised beliefs, as pertaining to an alien inorganic mind that
settled in since the fall of Adam. The reason for the discrepancies between superstition and astronomy
in the past have their roots in the transcendental victory of the inorganic parasite. No rational being
would ever believe in an unchanging sky, as precession was taught to us since the time of Hipparchus.

AGE OF CETUS III

• The Moon is in the seventh house in Cetus15.


• Brimstone ||:|:: is the alignment of Jupiter with Mars.
• The true natal skies are the birthright of every child on and off planet Earth.
• Governments can be ruled in harmony with precession and heavenly dictates.
• Precession rules the number and quality of ascendants rising at east for the epoch.
• The Book of Precession determines the subsections of a precession cycle.
• A rich historical period boasts two dozens of eastern ascendants.
• Racial progression is based on the precession of the ascendants.
• Our civilization has 22 zodiacal stations, along with 16 IAU ascendants rising at east.

15 Alice is alive.
• The whale and dolphin are worshiped16 in the ||::|| Age of Cetus III.
• The Brahma of the local Omniverse forbade superstition in an astrology initiate.
• Local universes spawn local zodiacs. A zodiac is a light17 convention and divine law.
• The owner of the zodiac is appointed over the centaurs by the asvini Lord of Hayastan.
• Precession is central to the teaching of the Lord of the Holy Bible.
• Worshipers of a fixed cosmos are annihilated18 according to the Law of Moses.
• Aton Re is centered in Ophiuchus where false gods have six signs of zodiacal error.
• The knowledge of the true zodiac is essential to the Lord of the Æon.
• The ascendants for the epoch are predetermined by precession.
• The duty of the Lord of the Æon is to predict his own next coming.
• The zodiac is the harmonized Wish Wheel of the gods19, even cakra in and out of time.
• The next Lord of the Zodiac is thus predicted by his own predecessor, as they are One.

The following is an update of the zodiac, not only as focused on the livelylx 1992 ~ 2009 period, but
largely extending from Brahma's first initiation towards the Lord and Astrologer of the next Æon.
First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved. No part of this material may be reproduced or transmitted in any form or
by any means, electronic or otherwise, for commercial purposes or otherwise, without the written permission of the author, except when permitted by law. Initiate writers, please refer to the Copyright notelxi.

The report was written by the owner20 of the zodiac, Klaudio Zic, in person. It took us years to refine
the zodiac, but only minutes to determine the 16 eastern ascendants for the current epoch. It is most
peculiar that no one thought of determining the zodiac and ascendant set since Brahma.

In the past, belief in fixed skies predominated over precession, which was either set aside or completely
overlooked. Precession is the main factor in a horoscope, thus a cowardly king would have Lepus
ascending at east, a hero would have Aries rising, while a Grail champion was bestowed with Crater
ascending. Both Crater and Aries rose at east at the times of King Arthur and King Clovis. Aries does
not rise at east at the present epoch, thus “no more heroes any more”. Many popular ascendants do not
rise at east at all, and even when they do, there is still a standard two sign error in the “calculations” by
such methods of superstition as astrology for the masses. In short, both your Sun sign and ascendant are
being miscalculated by at least two signs by now. The two signs error is an average standard mistake
that does not account for six signs of zodiacal error, as it hardly justifies the dunghill of nonsense that
marketplace charlatans left behind them. Even in the recent past, amateurs believed in twelve rising
signs at east. Among the feats of prominent charlatans was the proclamation of the entry of Pluto into
Aries. Pluto of course never enters Aries, much as Eris never enters Taurus. It is unbelievable that
people spawning nonsense were not only acclaimed by the mob, but also set as “lodge masters” in their
improvised quarters not very far from Greenwich itself! It would appear that there is still someone that
believes in flat Earth, twelve ascendants and Pluto in Aries, even to this date, when even a child can
handle Google Sky. Only a couple of miles from Greenwich and in midst of civilisation proper, people
16 Favored.

17 LVX. Emanations of Divine Light.

18 Burning lake. Second and third death. Brimstone.

19 More properly, the One Will of the Lord.

20 Copyrighted owner of the zodiac and ascendant set. NASA and IAU do not own the zodiac.
still believe in twelve rising zodiacal signs, much as ephemerides are sold showing Pluto in Pisces!

In the past 50 000 years, people did not lose their naïve belief21lxii, but the basic error amounted to at
least two constellations. In the case of scrutiny around Ophiuchus area, zodiacal error amounts up to six
(sic) constellations. Sadly, zodiacal exploration was quite alien to European scientific thought until
recent.

In order to determine the zodiac with absolute certainty, one scans the motion of the planets over brief
or extended periods. Venus in Pegasus, Moon in Corvus and Saturn in Orion were determined in that
way. No special research team was appointed as the zodiac was determined in a hour with a DOS PC.

Europe never had a zodiac. The Academic Zodiac is the first veritable account of the encounter of the
planets, the Sun and the Moon with the 22 zodiacal constellations. Today, much as in ancient times, the
initiate is able to foresee any futurity in secondslxiii, as well as to recreate22 any future in minutes.

The Academic Zodiac accounts for the true positions of the planets in the horoscope. The Sun is in
Libra on November 23rd when Sai Baba was born, not in any other constellation. The NASA JPL
ephemeris speaks clearly. There is nothing like two skies, eastern or western, but there may be many
lingering superstitions. Even to this illuminated age when access to information is a matter of fact,
people believe in flat Earth, 12 zodiacal signs rising at east or zodiacs which afford from two to six
signs of error. The industry of superstition cheated upon the naïve individual for more than 5000 years.

The Holy Bible approves of observation23, in rebuking superstition. Fixed skies are heresy unto the
Lord of the Bible. The fixed sky market astrologer is repudiated by the Levites. According to
precession, the skies rotate in order to display all the facets of divinity. The ascendant set changes with
epoch and racial initiation. There is nothing like fixed 12 ascendants in the true observable skies.
Brahma has initiated us into astrology according to the principle of precession. This principle was
never kept to the letter, as an idea of a fixed universe installed itself lxiv in the popular mind. If only 12
ascendants would rise at east, it would mean that there is no precession at all. Luckily, there is no one
to point at east and prove the opposite, since superstition depends solely on lack of observation of the
true skies. As soon as one turns attention towards one's own true natal planets, illusion is dispersed.

21 False ego, devil's install, psyche.

22 RTRRT. Create or discreate and event in minutes.

23CINGVLA ORIONIS.
(Darby) Jdg 5:23 Curse Meroz, saith the Angel of Jehovah; Curse, curse the inhabitants thereof;
For they came not to the help of Jehovah, To the help of Jehovah among the mighty.

3800 BC ASTROLOGY 1992 – 2018lxv

Premier dwarf planets delineations since 1992.

From 1992 QB1 to Varuna and Eris to 2007 OR10, your source of dwarf planets information.

• New giant dwarf planet 2007 OR10 delineated in the 12 houses. Nickname Unihipili.

2007 OR10 as our companion through world financial crisis and towards ecological redemption.

LARGEST DWARF PLANETS UPDATE


Record # Epoch-yr Primary Desig Name H
-------- -------- ------------- ------------------------- -----
50000 2001 2002 LM60 Quaoar 2.67
90377 2004 2003 VB12 Sedna 1.57
90482 2001 2004 DW Orcus 2.30
134340 2006 (undefined) Pluto -0.70
136108 2006 2003 EL61 Haumea 0.18
136199 2004 2003 UB313 Eris -1.17
136472 2006 2005 FY9 Makemake -0.48
587673 2008 2007 OR10 [...unnamed...] 1.90

New Centaurs in Modern Astrology ~ 2007 JG43


Apart from 2007 OR10 as probable dwarf planet, a controversial centaur was recently designated
as SDO, then centaur again, the 2007 JG43.

• 2007 JG43 5th edition Riding the Devil to the Grail issued for the jubilee of Giordano Bruno.
• New reptilian centaur 2007 JG43 delineated in the 12 houses of the Cartesian house system.
• 2007 OR10 and 2007 JG43 are testing our new chart wheel environment.
• 2007 JG43 for AO Spare, Obama and G Bush; also NYSE, WTC and the USA.
• February 14th 2009, Venice carnival. Our Grand Lodge signs up a contract with the French.
• The fiery new reptilian centaur is nevertheless a reliable keeper of the shrine, just like Pholus.
• Anniversary of the Pholus delineation in the 12 houses. Fascist centaurs and dwarf planets.
• The first 2007 JG43 animation determines it as reptilian centaur, akin to the Pholus class.
• 2007 JG43 is experimentally entered and animated within our test horoscopes.

First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved. No part of this
material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for commercial purposes or otherwise, without the written
permission of the author.

MODERN ASTROLOGY

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology


You would settle for no less than scientific approach to your health care. A mother wants the best for
her children. The father gathers relevant information in order to decide financial issues. We are a
civilization that counts on authoritative data in its progress.

In that astrology is discarded as unreliable superstition, it is good to hear the news. Astrology nowadays
accounts for a reliable zodiac, ascendant set and house system as fully dependable on astronomy. The
old science has been reformed in order to meet the needs of a time when giant transneptunian
discoveries are the order of the day.

Even if you are not an astrologer, the benefits of information are vast, since one single zodiacal
information can change the course of one's life. In choosing a partner, one often mistakes due to false
zodiacs. Many had the wrong organ cut out on account of pseudo-astrological advice. It is time to learn
the benefits of an astrology that really serves humanity now, as well as in the new time to come.

BENEFITS

• Health. Your 6th House Neptune will never again be called 7th house Neptune.
• Love. All the loves in your life are predictable in minutes. Marriage timing gets minute in the
sense that we are able to determine the precise minute of the upcoming marriage.
• Child birth. Excellent timing depends on reliable information. Impossible cases can be handled
even when official medicine discards the possibility of having children. Generally couples
lacking ova and speramatozoa as well, can afford a baby already within a month's time.
• Academic career. In perusing the Academic Zodiac, one can not possibly be accused of
superstition. On the contrary, a solid knowledge of the scientific zodiac will silence any
lingering superstition, even in academic quarters. Since national heraldry is based on
astronomy, it is important to have some basic knowledge of our own identity as citizens and
Masons.
• Money. Excellent financial information matches scientific astrology methods.
• Sexual prowess. The correct use of stellar energy makes for sexual stamina and the attraction of
the correct Sun sign. Choose your partner according to the true zodiac and you will never again
suffer from any sexual incompatibility.
• Integrity. You will never have the wrong organ cut out on account of pseudo-astrological
advice. As armed with NASA ephemeris, you could even help the poor astrologer in washing
away a life of disinformation.

Klaudio Zic
The Academic Zodiac & RTRRT are published under Copyright © 1994 - 2009 by Klaudio Zic,
all rights reserved worldwide. Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology

First published by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights Reserved. No part of this
material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for commercial purposes or otherwise, without the written
permission of the author.

BENEFIT

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

HEALTH

Health is the basis of a happy life. One could say that happy life and health are the same. A happy life
is an informed life, since there is really no bliss in any ignorance, only misery. Chaotic disinformation
does not make for a healthy life. While the so-called eastern and western astrologers can not determine
the position of the Sun, scientific astrology performs towards a galactic civilization. In the horoscope of
Sai Baba, the Sun is in Libra on November 23rd. Libra can stand for kidneys. The Sun spends a week in
Scorpius, which often stands for sexual organs. After Ophiuchus, the Sun enters Sagittarius. Therefore
for Christmas and New Year, the Sun is in Sagittarius. It is not at all somewhere else. These are
authoritative stellar positions that can be observed by a telescope. Of course, not every surgeon will
perform excellent astrology, but even in Greek times, a surgeon operating without basic astronomical
knowledge would risk being called a charlatan. In order to give advice on account of a horoscope, the
astrologer must be trained into basic zodiacal astrology, that is elementary astronomy. Otherwise the
wrong organ will risk being cut out. Rather than cutting the wrong organ out, one is invited to cut
superstition out, since there is danger in issuing astrology certificates where both teacher and student
have no qualified idea of the real position of their own natal Sun.

EUDÆMONIA

Europe never invented the zodiac neither seriously made any research as concern the zodiacal positions
of the planets. True, Hipparchus rediscovered precession, but had no operative knowledge or initiation
into its mysteries. A stellar civilization logically requires at least a precession cycle for its own
initiation. The star seed obviously fell in Egypt, India and China. Positively, many other cultures were
acquainted with precession.

HONEYMOON ON MARS

The benefit of reliable information is in the positive circulation of further information, eventually
resulting in healthy life. Surely, no one wants a negative diagnosis, or an unreliable one. Why risk
having the wrong organ cut out on account of pseudo-astrological advice? When Neptune is under the
western horizon, diagnosis is threatened, but how do we deal with its house placements? On account of
fancy astrological systems of houses, even a planet with negative latitude can be erratically placed in
the seventh house of the horoscope, thus creating an impression of being above the western horizon. In
that case, an astrologer is liable to offer the following explanation. The astrologer will probably suggest
divorce on account of a seventh house Neptune, especially in direction such as square Venus. Millions
of people have divorced on account of unqualified astrological analysis. What really took place in one
example was that the owner of the position and direction crossed some South American border with a
tarantula. The spider had all the papers needed and yet the traveler had to stomp on it and forget it. The
alleged seventh house Neptune was a sixth house Neptune. The sixth house rules pets. In the case of
Neptune, exotic pets. No divorce procedure took place, of course. In correcting the mistakes of
previous astrologers, we simply rely on the real sky. In our case, the Cartesian house system clearly
shows a sixth house Neptune. To have all the planets neatly housed even on a honeymoon on Mars
affords for immense relief after so much mess as caused by a cacophonic variety of useless house
systems.

Klaudio Zic
The Academic Zodiac & RTRRT are published under Copyright © 1994 - 2009 by Klaudio Zic,
all rights reserved worldwide. Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology
i Later on there is elaboration upon six (sic) signs of error. Two signs of error are evident from a brief inspection of
the zodiac and ascendant set, while further errors spring out on further inspection. The assesment is of course far
from being dogmatic as it is easily inspected with standard astronomical tools along with basic knowledge of
celestial mechanics.

ii Modern astrology is astronomy, much as ancien astronomy was and remains astrology.

iii Cardinal points.

iv The reference is mostly for our Cruithne colons. The Cartesian house system operates on spacecraft as well as in
alien “solar” systems.

v Real Time Reality Rendering Tools, also known as RTRRT suite of instant magick tools.

vi Properly known as Kahuuna Time Track, a RTRR initiation that enables the astrologer into discreating future
transits, as well as installing positive events into the future matrix.

vii The year 1992 is significant because of the first cubewano object 1992 QB1 being discovered and delineated. The
event triumphs with an unending string of transneptunian discoveries like Varuna, Ixion, Quaoar, Orcus, 2005 FY9
and Eris. The first KBO to be delineated are those with H < 5, besides a set of (comparatively small) “outer
guardians” (as published within our Nibiru Research Project) and distant comets. The large comets like Wild (and
Machholz) qualify as apocalyptic door openers.

viiiRTRRT technology. Change negative transits to positive, install a futurity at will and more.

ix Every astrological program is in fact based on the NASA model, before being mangled for commercial purpose.

x For those who provided shipping address. Dreaming caps and bracelets. Please allow up to a week for delivery.

xi Academic Zodiac, Precessed Ascendant & Cartesian house system.

xii RTRRT.

xiii2009 is the year when our fist missiles are scheduled to hit the Moon.

xiv On January 21st, we are speaking of update No #5 for 2007 OR10.

xv Also love.

xviArticle removed in compliance to Copyright policy.


xviiThe original publication was immediately debugged with new NASA data for Orcus. The osculating elements for
the dwarf planets and objects of interest update frequently, thus all the calculation are subject to prompt revision all
of the time.

xviiiArticle removed because of Copyright issues.


xix See also Moon in Auriga. The attribution are based on the number 22.

xx From the perspective of Hydra, meaning the portents pertaining to the entrance of Venus and 2002 AW197 into
Hydra.

xxi The Outer Guardians are distant objects of the solar system.

xxiiThe Sun enters Scorpius on November 23rd. See NASA ephemeris below.

xxiiiBoth eastern or precessed and incarnated ascendants. The document is classified even for the 32nd masonry degree.

xxivLarge Hadron Collider.


xxvVintage vampire object in early transneptunian astrology.

xxviDrac is of accidental interest to presidential candidate Sarah Palin in that it ascends from Scorpius into Ophiuchus.

xxviiTiming estimated by Anthony Colaprete through private correspondence.

xxviiiThe Prophet has split the Moon into halves. Xingu risks an opened scar. The second splitting of the Moon is
Islamic apocalypse. Islamic authorities send alarm signals through youtube.

xxixThe text does not make mention of minor naming of dwarf planets, which are nevertheless included in our extended
publication.

xxx2014 is the crisis before 2020. The year 2014 has been first analyzed in our publication entitled AION, as concern
the fall of Vatican. The subprime mortgage crisis may be at its peak in the year 2014.

xxxiWMAP cold spot in Eridanus, the great void.

xxxiiThe Witchållow materials have been party translated into Italian language. This is our first integral Italian
publication dedicated to modern astrology.

xxxiiiBy primary and secondary direction.

xxxivThe role is twofold. The easiest way to direct Witchållow is to project it for tropical astrology use. In that way the
WMAP cold spot becomes a fictitious dot at 10 degrees Taurus tropical. This projection nevertheless yields results
in primary direction. The second way as especially applied to secondary progression is to keep the WMAP cold spot
in the place of origin in Eridanus while progressing objects.

xxxvZic, Klaudio. 2007. Witchållow. Klaudio Zic Publications.

xxxviThe Academic Zodiac context includes the concept of the local zodiac as applied to horoscopes of beings, born on
other planets. The Night & Day house system was introduced as our direct answer to the challenge of a single house
system that would answer the logical needs of the astrologer as well as serve as didactic platform for the initiate.
The Night & Day house system reflects the observed sky. While this statement may seem blunt, it nevertheless
encapsulates mysterious simplicity. Let us not forget that the WMAP cold spot is rising in Eridanus in the Night &
Day house system and nowhere else in all astrology over the past 3000 years. Neither the Chinese nor the Sumerian
ever had such a house system, albeit it is the most obvious of all, being the blunt refection of the skies as we observe
them from this planet Earth. Something so simple is surely welcome into our own technical culture, especially as
able to handle our next step. Which is our next giant leap forward as technical culture? The Night & Day house
system is able to handle local zodiacs on spacecraft as fed by the board computer. In other words while obsolete
house systems could not handle Oslo in Norway, we are able to process horoscopes at any speed in whatever alien
galaxy. The first obvious improvements are of topocentric nature, namely the Night & Day house system is able to
analyze the horoscope for an undersea quake, as well as set the houses for the birthplace of Dalai Lama. The
Cartesian system works anywhere in the galaxy with equal precision. Altitude is an integral part of the horoscope, as
it is based on topocentric standards as implied within the Cartesian system. Depression and altitude affect the
position of the Moon as well as other factors in a horoscope, especially when extreme. This point was largely
overlooked by amateur astrology programs, which never prompted the operator at entering the altitude of the place.
Considering the major difficulties that a superstitious astrology had in the past 3000 years, we can bluntly state that
altitude is a minor problem of the past, successfully solved within the Night & Day house system. The Night & Day
house system is actually based on azimuth and altitude, as following the logic of the observer. When the Moon is
conjunct Jupiter in Orion one can see it. Whatever is shown in the house system can be observed in the real sky.
Prior to our house system one could not find any relationship with the real sky as astrology was rightfully
considered blunder and superstition. The Night & Day house system is not in the least confined to planet Earth only.
In extension, we were able to assign local zodiacs to all the planets of the solar system; in addition, experimental
areas as ruled by the Earth coorbitals, outer guardians, dwarf planets or comets. The results of our research were
published under Zic, Klaudio. 2006. Planetocentric Astrology. Klaudio Zic Publications. Planetocentric astrology
thus marks a giant step ahead for humankind ready to be born on other planets and spacecraft with precise
horoscopes even horary charts. A baby having Sun in Cygnus within the Night & Day house system is already a
reality within the Academic Zodiac framework. The Academic Zodiac namely extends to other planets, alien
galaxies and spacecraft.
xxxviiZic, Klaudio. 2006. Venus in Hydra. Klaudio Zic Publications.

xxxviiiZic, Klaudio. 2005. Jupiter in Ophiuchus. Klaudio Zic Publications.

xxxixZic, Klaudio. 2005. Mercury in Orion. Klaudio Zic Publications. As Lady Diana Frances Spencer, late Princess of
Wales, has Mercury in Orion in her own natal chart, our special attention was focused to unusual terrorist activity
surrounding the princess’ jubilee. In an apocalyptic year such as 2007, even Mars in Cetus is taken into
consideration as an incentive to underground terrorism much as it exploded in the London underground in the year
2005.

xl********************************************************************************
The Academy of Scientific Astrology is based on astronomic principles confirming to the IAU convention. The
calculations are performed on the HORIZONS integrator by Jon Giorgini of NASA JPL, Pasadena CA.
Subject headings: solar system – zodiac, astrology – academic zodiac and precessed ascendant set, magick - RTRRT
Online material: www.lulu.com/astrology

xliUpdating list of largest dwarf planets on the site http://lulu.com/astrology

xliiEris has been delineated as 2003 UB313 in the 12 houses of the horoscope. The original delineation are therefore
unaffected by naming or even its nickname, Xena. Furthermore, “Eris in the 12 houses of the horoscope” has been
separately applied to kids, the adolescent, women and even pets. This variegated approach to delineation follows on
the trail of Quaoar, which has been delineated for love, finance and magick. Our first transneptunian delineation
pertains to 1992 QB1. The major breakthrough was to come with 2000 WR106, Varuna; and whatever was written of
Ixion, Sedna and 2002 TX300 is history.

xliiiThe X zodiac has been published on an early date, august 1st 2005. At the time, much as today we were fully
operative and ready for analysis after working hard on TNO like Quaoar. Gigabytes of material were written and
published around a single transneptunian object because it was so important to reach planetary status from being a
mere transneptunian. The race begun silently in 1992 with the first cubewano, when astrologers were generally
unaware of the new discoveries.

xlivThe Moon has a special “last word” within the academic zodiac since it defines the 22nd constellation.

xlv Zic, Klaudio. 2003. Venus in Special Constellations. Klaudio Zic Publications.

xlviZic, Klaudio. 2004. I Ching Aspectarian. Klaudio Zic Publications.

xlviiZic, Klaudio. 2003. Cassini Lilith or LILIT VERA. Lulu Publications.

xlviiiPrior to the discovery of the first cubewano, the astrologer had only a couple of centaurs to dabble with. Pholus,
Nessus and Asbolus were joined by cubewano 1992 QB1. All delineation was made before the naming thus the
original delineation for e.g. Varuna are copyrighted to Klaudio Zic. All TNO and centaur objects were delineated by
Klaudio Zic as published on http://www.lulu.com/astrology

xlixThat is, all centaurs were delineated as they were discovered until year 2007. As the centaurs were gradually named,
they never really fitted into their original delineation completely, namely all objects were delineated prior to their
naming by a committee. We are planning a major revision of the delineation of all centaurs in one volume. The
centaurs that have been assigned temporary designation but were re-designated later as e.g. SDO, will be included in
this edition. True, we have gradually lost interest in the upcoming centaurean discoveries since giant trans-neptunian
objects kept us transfixed and busy. Gigabytes of material were written and scanned around a single TNO like
Quaoar. When a new giant like Sedna appeared it naturally dwarfed any centaur in importance as it commanded
respect along with our total commitment.

l Zic, Klaudio. 2003. Genesis Ascendant. Klaudio Zic Publications.

li The number was reduced to 22 in August 2006.

lii The further studies of Eris in Phoenix (Phoenix Cycle) were based on this work.
liii The further studies of Eris in Phoenix (Phoenix Cycle) were based on this work.

liv Sets for various epochs are available from the site.

lv The cubewano objects have received their name precisely from their predecessor 1992 QB1. The first cubewano was
nicknamed “Smiley”, then came “Karla” with tradition continuing as “Xena” and “Easter bunny” kept on popping
up. All the KBO and centaur objects were delineated prior to being named, thus no influence of Greek names or
mythology haunts delineation. The incipient delineation included 1993 RO, 1993 SB, 1993 RP, 1993 FW; those
were the first steps into the gloriously flowering field of transneptunian astrology. 1992 and 1993 refer to years so
transneptunian astrology is now 15 years old with all TNO (transneptunian objects: cubewano, plutino, SDO and the
new categories) with H < 5 delineated. Zic, Klaudio. 2006. Transneptunian Astrology VII. Klaudio Zic Publications.
See also Zic, Klaudio. 2003. Dwarf Planets in the 7th House. Klaudio Zic Publications. All the enlisted dwarf
planets were delineated by year 2006. Special publications were dedicated to 2003 EL61 and 2005 FY9. Important as
well abundant space is dedicated to Varuna, Ixion, Quaoar and Sedna.

lvi All centaur objects were delineated as they have been discovered and before being named.

lviiThree awards in Kolkata, India, by the Indian Vedic Heritage.

lviiiHere is an ephemeris strip for the winter sun, showing sun in Libra on November 23rd.

2008-Nov-23 00:00 Lib


2008-Nov-24 00:00 Sco
2008-Nov-25 00:00 Sco
2008-Nov-26 00:00 Sco
2008-Nov-27 00:00 Sco
2008-Nov-28 00:00 Sco
2008-Nov-29 00:00 Sco
2008-Nov-30 00:00 Oph
2008-Dec-01 00:00 Oph
2008-Dec-02 00:00 Oph
2008-Dec-03 00:00 Oph
2008-Dec-04 00:00 Oph
2008-Dec-05 00:00 Oph
2008-Dec-06 00:00 Oph
2008-Dec-07 00:00 Oph
2008-Dec-08 00:00 Oph
2008-Dec-09 00:00 Oph
2008-Dec-10 00:00 Oph
2008-Dec-11 00:00 Oph
2008-Dec-12 00:00 Oph
2008-Dec-13 00:00 Oph
2008-Dec-14 00:00 Oph
2008-Dec-15 00:00 Oph
2008-Dec-16 00:00 Oph
2008-Dec-17 00:00 Oph
2008-Dec-18 00:00 Sgr

The sun spends a week in Scorpius before entering the central zodiacal station of Ophiuchus. It is in Sagittarius during
the New Year's holidays.

lixFirstpublished by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights
Reserved. No part of this material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for
commercial purposes or otherwise, without the written permission of the author, except when permitted by law.

KLAUDIO ZIC PUBLICATIONS

A note for the novel initiate and writer

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology


PURPOSE

In our duty and mission to guide the initiate and writer in assembling the firm principles of astronomy, astrology and reality
rendering. As help is profusely afforded by an abundant body of publications and articles, the actual initiates greatly outnumber our
faithful readers. The following notes are addressed to initiates who are themselves aspiring writers.

COPYRIGHT NOTES

1. Cooperation requests are pending from several bestseller authors, apart for permissions to quote copyrighted material. Our
lawyers are resolving the claims depending on the status of the material and according contracts.
2. Most of the material is legally locked whether under patents pending or revision by new partners such as Samuel Weiser.
3. Some of the new material is being published under International Copyright Law as including Cern, LHC and NASA.
4. As most material is under revision by the according parties, no license can be issued due to the nature of the appropriate
contracts.
5. Several zodiacs are referred to by the registered name of “Academic Zodiac”. In extension of the presently official zodiac,
the Academic Zodiac, several historical zodiacs are included within te same patent, namely the X, P, N, M, G and E series
of zodiacs, whether published (G, P1, P2, X, N1, N2) or in draft form (M, E).
Klaudio Zic

The Academic Zodiac & RTRRT are Copyright © 1995 - 2009 by Klaudio Zic, all rights reserved worldwide.
Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology
klaudio_zic@yahoo.com Subject: RTRRTVIP. Video Log http://youtube.com/RTRRTV

lx The period is one of astronomic discoveries, namely the Axis of Evil, Dark Flux, WMAP cold spot, giant comets
like Wild, brown dwarfs, main belt comets, Apoheles, Earth coorbitals, dwarf planets, centaurs and other classes of
objects.

lxiFirstpublished by Klaudio Zic Publications, 2009, www.lulu.com/astrology. Copyright © 2009 By Klaudio Zic. All Rights
Reserved. No part of this material may be reproduced or transmitted in any form or by any means, electronic or otherwise, for
commercial purposes or otherwise, without the written permission of the author, except when permitted by law.

KLAUDIO ZIC PUBLICATIONS

A note for the novel initiate and writer

Copyright © 2009 by Klaudio Zic, all rights reserved. http://www.lulu.com/astrology

PURPOSE

In our duty and mission to guide the initiate and writer in assembling the firm principles of astronomy, astrology and reality
rendering. As help is profusely afforded by an abundant body of publications and articles, the actual initiates greatly outnumber our
faithful readers. The following notes are addressed to initiates who are themselves aspiring writers.
COPYRIGHT NOTES

6. Cooperation requests are pending from several bestseller authors, apart for permissions to quote copyrighted material. Our
lawyers are resolving the claims depending on the status of the material and according contracts.
7. Most of the material is legally locked whether under patents pending or revision by new partners such as Samuel Weiser.
8. Some of the new material is being published under International Copyright Law as including Cern, LHC and NASA.
9. As most material is under revision by the according parties, no license can be issued due to the nature of the appropriate
contracts.
10. Several zodiacs are referred to by the registered name of “Academic Zodiac”. In extension of the presently official zodiac,
the Academic Zodiac, several historical zodiacs are included within te same patent, namely the X, P, N, M, G and E series
of zodiacs, whether published (G, P1, P2, X, N1, N2) or in draft form (M, E).
Klaudio Zic

The Academic Zodiac & RTRRT are Copyright © 1995 - 2009 by Klaudio Zic, all rights reserved worldwide.
Redistribution of this file in any form is violation of the Copyright Law.
This copyrighted material has been previously published as available from http://www.lulu.com/astrology
klaudio_zic@yahoo.com Subject: RTRRTVIP. Video Log http://youtube.com/RTRRTV

lxiiActually install, since false ego enforces false belief.

lxiiiTwenty Minutes Astrology is an initiation for everyone, particularly people not interested in astrology at all.

lxivThe enemy of man installed false ego and continues to do so even before age three.

lxvThe title should extend at least back to the last Age of Orion, 11000 BC. 2018 alludes to an upgrade of the Orcus
Report.

As stressed, the discovery of (first cubewano) 1992 QB1 , as well as the (2011/2012) precession of Mayan epochs.

You might also like