Professional Documents
Culture Documents
Who Inspired Pā Ini Reconstructing The Hindu and Buddhist Counter-Claims - Deshpande, M.
Who Inspired Pā Ini Reconstructing The Hindu and Buddhist Counter-Claims - Deshpande, M.
Who Inspired Pā Ini Reconstructing The Hindu and Buddhist Counter-Claims - Deshpande, M.
.
JSTOR is a not-for-profit service that helps scholars, researchers, and students discover, use, and build upon a wide range of
content in a trusted digital archive. We use information technology and tools to increase productivity and facilitate new forms
of scholarship. For more information about JSTOR, please contact support@jstor.org.
American Oriental Society is collaborating with JSTOR to digitize, preserve and extend access to Journal of
the American Oriental Society.
http://www.jstor.org
' An importantexception to this is a Hindi booklet by Bhimsen Shastri (1984). I was able to consult this booklet after my
own paper was substantially complete. I am pleased to see
Shastri arrive at similar conclusions regarding lateness of the
motif of Siva inspring Panini. He has covered the full spectrum
of grammaticaltexts, but his study is limited to showing the inauthenticityof this motif, ratherthan exploring wider historical
or religious issues.
444
445
hand, at the end of the second ahnika of his Mahabhasya, Patafijalisuddenly seems to hint at a revelationlike character of these lists. Here we come across an
importantverse (MB, I: 36):
varnajnanamvdgvisayo yatra ca brahma vartate
tadartham istabuddhyarthamlaghvartham copadisyate
(vrttisamavaydrtha upadesah) and 16 (anubandhakaranarthas ca) (Mahabhdsya [MB], Kielhorn ed., I: 13) offer
2 Srstidhara,
in his
Bhdcommentaryon Purusottamadeva's
sivrtti, says that the verse "yendksarasamamnayam.. ." (see below, p. 447), which attributesthe origin of the listing of sounds
in the Sivasutras to Mahesvara, is from Katyayana (cf. katydyanavdkyena, Bhdsdvrttyarthavivrti,p. 13). However, no other
author attributesthis verse to Katyayana, and there is no trace
of this belief in the Vdrttikasor in the Mahabhasya.
446
tative (yady asau tatra pramanam ihapi pramanam bhavitum arhati / pramanam asau tatra ceha ca [MB, II:
ShasMishra(1974:231). Guruprasada
(1984:27), Harshanath
tri is anothermodernSanskritPanditwho expressesthe same
critical view in his commentaryRajalaksmion Patafijali's
Mahabhasya (pt. I, p. 73).
smar-
'ksarasamamndayoddesena
pravrttavisesandndmanyaparatayd yojane bhdsyavirodhah [Uddyota ad MB (Nirnayasagara ed.), I: 132]). Nagesa further cites a slightly
447
It is importantto place this verse at least in some relative chronology. We may begin by saying that no verse
of the versified Pdninlyasiksd has been cited by anyone
until the time of Bhartrhari.4Did Bhartrhariknow the
rajanakasya na kascit kartdsty evam eva vede paramparyena smaryamanam' iti vydkhyatam [Uddyota, ibid.]).
448
versified Paniniyaiiksa? This is a difficult question. After citing other siksas, the Vrtti on Vakyapadiya 1.107
(Iyer ed., p. 176) says:
acaryah khalv apy ahadtmd buddhydsamarthyirthdn mano yuhkte vivaksayi /
manah kayagnim dhanti sa prerayati mdrutam//
ity evam ddiThe Acarya indeed says"The soul, having configuredthe intendedmeanings with
intelligence, enjoins the mind with a desire to speak. The
mind strikes up the fire in the body, and it sends forth the
wind."
Such and otherThis passage raises complex historical questions not
all of which we can solve here. The first dilemma is
obviously posed by the vexed question of whether Bhartrhari himself composed the Vrtti. At the very least, we
need to assume that the Vrtti was composed by someone
very close to Bhartrhari, if not Bhartrhari himself. For a
recent review of this debate, see Ashok Aklujkar (1993).
The passage is important for several reasons. This shows
that the cited verse was known by the middle of the first
millennium A.D. Secondly, it was attributed to Acarya.
Harivrsabha identifies this Acarya with Panini: acarya
iti paninih (Paddhati on VP, 176). The verse is cited in
the context of the discussion of siksa passages, and it is
found in all the five versions of Paniniyasiksa collected
by Manomohan Ghosh (1938), who includes it in his reconstructed version. All this probably goes to prove that
a version of the versified Siksa attributed to Panini was
known around the middle of the first millennium A.D.
However, there is no evidence that the portions of the
versified Paniniyasiksa connecting Panini to the Saivite
tradition were known to Bhartrhari, or were part of the
most ancient form of this text. There are, in all, three
verses in the different recensions of the versified Paniniyasiksd which make reference to Panini receiving his
grammar or the aksarasamamnaya from Siva:
yendksarasamdmnayamadhigamya mahesvardt
krtsnamvydkaranamproktam tasmai paninaye namah
This verse is found in the Rk, Yajus, and the Paijika
versions, but not in the Prakasa version or the Agnibeen reconstructedfor the original text by Manomohan Ghosh.
This verse, with some difference in wording (e.g., dustah sabdah svarato varnato vad...) is found in the Mahabhasya of
Pataiijali(I: 2), and it seems to have been adaptedand included
in some late versions of the Paininiyasiksai.
449
(Mahabhasyapradipavyakhydnani,
I: 120):
mahddevenaivatrakdrovivrta upadistas tasya varttikakarena prayojanamatramanvdkhydyateva, vdrttikakdrenaiva mahadevopadistasya samvrtasya vivrtopadesah
saprayojanah kartavyataya bodhyate veti prasnah /
evam ca "kim sutra-kdrenaiva vivrtopadesah krtah" iti
vadatd [kaiyatena] "yendksarasamamnayamadhigamya
mahesvarat / krtsnam vydkaranam proktam tasmai
paninaye namah" iti paniniyasiksadau panintyasutrapdthddau ca sarvaih sistaih pathyamanatvena
purdnaprasiddhatvena ca tadupeksanaucitydt / astddhydyyddau kaiscit pathyamdnatvamatrendksarasamamnayasya paninikrtatvayogdt / "vrddhisabdah
sastrddau mahgalarthah prayuktah" iti bhaisyavirodhat
/ mahddevasyasitrakdratvena vaiyakaranairavyavahriyamanatvac ca
[With reference to the sound a listed in the Sivasutra
a-i-u-N], the question is whether the authorof the Varttikas is merely explaining the purpose of the sound a
which is taughtby Mahadeva[= Siva] himself as an open
450
dhirddaic]has been usedat the beginningof the treatise for the sake of markingan auspiciousbeginning."
do notreferto Mahadevaby
Additionally,
grammarians
the title siitrakdra,
authorof the Sutras.
Nagesabhatta,the last luminaryin the traditionof Paninian grammar,shows the full blossoming of many of
the notions which he inherited. He knows that the three
sages of the Sanskrit grammar were munis. He knows
the story of Panini receiving his grammar,and especially
the aksarasamamnaya, from Siva. He also knows the
story of Patafijalibeing an incarnationof Sesa. Introductory verses to many of his works refer to Patafijaliin his
appearanceas a serpent (cf. ndgesabhatto ndgesabhdsitdrthavicaksanah,verse 2ab, at the beginning of Uddyota
ad MB [Motilal Banarsidass ed., I: 1]). He is indeed
aware of Kaiyata's maxim: yathottaram hi munitrayasya
prdmdnyam.While commenting on this maxim, Nagesabhatta says that the later sage is likely to have known a
wider usage of language (uttarottarasyabahulaksyadarsitvdt [Uddyotaad MB (Motilal Banarsidassed., I: 217)];
also see Uddyota ad MB ad P. 3.1.87 [dhinvikrnvyor.. .]
[Motilal Banarsidass ed., II: 100]). If this progressively
wider vision is purely throughchronological succession,
it does not explain why this process must end with Patafijali. In any case, it is clear that, among the three
grammarian-munis,Nagesa shows the highest respect for
Patafijali.At the very beginning of his Pradlpa, Kaiyata
takes up the question of why the bhasyakdra (= Patanjali) should explain the purposes of studying Sanskrit
grammar (bhdsyakdro vivaranakdratvdt vydkaranasya
sdksdatprayojanam aha [Pradipa ad MB (Motilal Banar-
sidass ed., I: 3)]). Commenting on this passage of Pradipa, Nagesabhatta refers to all the three grammarians.
While he refers to Panini by name, and to Katyfyana as
vdrttikakrt,he refers to Patafijaliby the honorific bhagavdn (pdninina ..., vdrttikakrt ..., bhagavdms tu...
[Uddyota ad MB (Motilal Banarsidass ed., I: 3)]). All
these factors, and especially the divine origin of Panini's
grammar,are taken up by Nagesa and woven into a powerful argumentto explain the status and the authorityof
the rules of Sanskrit grammar.
Nagesabhattatakes up the question of why these fourteen strings of phonemes should be called samamndya,
since the terms amnaya and samdmnayaare used only to
refer to Vedic texts. This is answered by saying that
7 Also see Sabdakaustubha,I: 58: iti mdhesvaranyaksarasamdmndyasutrani.It may be noted that Ramacandra,the author
of Prakriyakaumudiand Bhattoji Diksita's teacher in grammar,
does not refer to these sutrasas mahesvara.From all indications,
Ramacandrais a Vaisnava (see K. P. Trivedi's introduction to
his edition of Prakriyakaumudi,I: xlff.), and one wonders if that
has anything to do with this omission. However, the commentary Prasada by Vitthala makes an explicit reference to Panini
receiving the aksarasamamnayafrom Mahesvara, and cites the
verse yenaksara ... in support (Prakriyakaumudi,I: 11).
DESHPANDE:
Who Inspired Pdnini?
since these are received from Mahesvara, they are
indeed a form of sruti received by Panini (cf. nanu
caturdasasiutryamaksarasama-mnayaiti vyavahcranupapattir dmndyasamdmndyasabdayorvede eva prasiddher
ity ata aha--mahesvaraniti / mahesvarad dgatdnity
arthah, mahesvaraprasadalabdhdniti phalitam / evan
caivamdnupurvika srutir evaisa tatprasdat pdninind
labdhd [Laghusabdendusekhara,16-18]). Nagesabhatta
cites the above verse from the Paniniyasiksa as his
authority (pramdna) for this view.8 Toward this end, he
interpretsthe word dcdrya in the Mahabhdsya, referring
to the author of the aksarasamdmndya,as referring to
Mahesvara, and not to Panini (cf. lan-sutre nakdravisaydcdryapravrttir jndpayati ...
451
452
DESHPANDE:
Who Inspired Panini?
original verses of Nandikesvara make no reference to
Patafijali and Vyaghrapad, etc. They refer only to Sanaka,etc., and to Panini. Upamanyu'sextension of the assemblage of sages to include Patafijaliand Vyaghrapad
clearly refers to the stories as they are connected with the
Natarajatemple in Chidambaram,where there is a shrine
dedicated to Vyaghrapadand Patafjali in the courtyard.
These stories are later recorded in the text of Pataijalicarita of Ramabhadradiksita.K. C. Pandey (1954: 51)
dates Upamanyuto "the close of the 11th and the beginning of the 12th centuryA.D." The text of Nandikesvara's
Kasikd itself cannot predate the general appearance of
the Kashmir Saiva texts, i.e., eighth century A.D. In reverse of Pandey's argument, it seems to me that it is
Patainjali'scharacterization of the sounds of the Sivasutras as brahmarasithat allowed Nandikesvarato further
connect these sounds to a Saivaite system. Professor Raffaele Torella, in a personal communication, comments:
"I don't remember seeing any reference to Nandikesvara's Kdsikd/Kdrikdin any Kashmir Shaiva texts
(even where one might most have expected to find it,
like the Paratrimsikdvivaranaor Tantraloka,ch. III). In
fact, the only reference to it that I am aware of is that by
Nagesa. My impression is that this is not an old text (a
forerunnerof the Kashmiri Shaiva doctrines, as Pandey
thinks), but a late one which ratherpresupposes the doctrines of the so-called 'Kashmir Shaivism' at a postexegetical stage (e.g., the first verse of the Spandakarika
is distinctly echoed by a verse of the NK." I thank Professor Torella for his suggestions.
How old is the notion that Panini was inspired by
Siva? This story is already known to Haradattaand is
found in relatively later texts such as Jaya(d)ratha's
Haracaritacintamani (ch. 27) and Ramabhadradiksita's
Patanjalicarita. The fact that the story appears in the
frame of Kathasaritsdgara (tarahga 4, vv. 20ff.; p. 8)
and is linked to the origin of Gunadhya'sBrhatkathdis
very significant. The same connection is seen in Jaya(d)ratha'sHaracaritacintamani (early thirteenthcentury
A.D.). If this connection to Brhatkatha is valid, then the
story of Siva having inspired Panini may be as old as
the Brhatkathd itself. S. N. Dasgupta (1962: 92-93)
says: "to assign it [= Brhatkathd]to the fourth century
A.D. would not be an unjust conjecture,"and he further
(p. 93) points out that both Gunfdhya and Brhatkatha
are closely connected to the Saivite tradition. It would
thus seem that the notion of Panini having been inspired
by Siva may have developed in certain Saivite communities around the middle of the first millennium A.D. It
was originally, in all likelihood, independent of the
Chidambarammythology associating Siva Natarajawith
453
454
vague and false rules-to fix the rules and correct improprieties.As he wanderedabout asking for right ways,
he encountered Isvara Deva, and recounted to him the
plan of his undertaking.Isvara Deva said, "Wonderful!
I will assist you in this." The Rsi, having received instruction, retired. He then laboured incessantly and put
forth all his power of mind. He collected a multitude of
words, and made a book on letters which contained a
thousandslokas.... It contained everything known from
the first till then, without exception, respecting letters
and words.... And so from that time masters have received it and handed it down in its completeness for the
good of the world. Hence the Brahmanas of this town
are well grounded in their literary work, and are of high
renown for their talents, well informed as to things, and
of a vigorous understanding.(Beal 1884: 114-16)
This report informs us of a belief, around A.D. 600
in the northwestern part of the Indian subcontinent, that
it was Siva who inspired Panini. It also has echoes of
Patafijali's Mahdbhasya (I: 5) about the age of men
having become one hundred years and the consequent
necessity of an abbreviated formulation of grammar. It
further indicates continuity of the study of Panini's grammar in the region of Salatura. Then comes a Buddhist
response to Panini:
In the town of So-lo-tu-lo [= Salatura]is a stupa. This is
the spot where an Arhat converted a disciple of Panini.
Tathagatahad left the world some five hundred years,
when there was a great Arhat who came to the country
of Kashmir, and went about converting men. Coming to
this place, he saw a Brahmacarinoccupied in chastising
a boy whom he was instructingin letters. Then the Arhat
spoke to the Brahmanathus: "Why do you cause pain to
this child?" The Brahmanareplied, "I am teaching him
the Sabdavidya, but he makes no proper progress."The
Arhat smiled significantly, .. . (and said:) ". .. No doubt
you have heardof the Rsi Panini, who compiled the Sabdavidya Sastra, which he has left for the instruction of
the world."The Brahmanareplied, "The children of this
town, who are his disciples, revere his eminent qualities,
and a statue erected to his memory still exists." The Arhat continued: "This little boy whom you are instructing
was that very (Panini) Rsi. As he devoted his vigorous
mind to investigate worldly literature,he only produced
heretical treatises without any power of true reason in
them. His spirit and his wisdom were dispersed, and he
has run through the cycles of continued birth from then
till now. Thanks to some remnantof true virtue, he has
been now born as your attached child; but the literature
of the world and these treatises are only cause of useless
455
12 As I have
suggested elsewhere (Deshpande 1993: 8-9),
later Sanskrit Buddhist texts like Lalitavistara show a somewhat generous attitude toward brahmanas.The brahmanas,including their caste and their Vedas, are given a place of high
prominence within an overall Buddhist framework. The late
portions of the Larkavatdrasatra also have hints of the same
phenomenon. Those people who eat meat are said to receive the
punishmentof being born in low-caste groups like Candala and
Pukkasa (Lankavatdrasutra,Mamsabhaksana-parivarta,v. 14,
p. 105), but those who avoid the eating of meat are promised a
birth as a brahmana,or a yogi, besides intelligence and wealth,
(ibid. v. 18, p. 105: brdhmanesu ca jdyeta atha va yoginam
kule / prajniavn dhanavdmscaiva mdmsadydndmvivarjandt).
456
citing Panini's rules. For example, on the Madhyamakakarika8.1, Candrakirticites P. 1.4.49 (kartur ipsitatamam karma). The commentaries, besides occasional
direct quotations of Panini's rules, are also often filled
with Paninian technical vocabulary (cf. pratityasabdo
tra lyabantah prdptav apeksaydamvartate / samutpurvah padih pradurbhavdrtha iti samutpadasabdah
prddurbhdve vartate / . . apare tu bruvate-itir
gama-
cited on
meanshe speaksknowledgeably,"
grammar,'
Candravyakarana
(1.4.93;vol. I, p. 149)
457
458
Taranatha's account clearly confuses the Candravyakarana with a commentary on Panini's grammar. The
interesting point to note, however, is that this narrative
suggests a negative Buddhist attitude toward Patafijali,
while at the same time showing acceptance of Panini
within that tradition. Another important point this narrative brings out is that Candragomin received Patafijali's
Mahdbhdsya in the south, a point also made, with differing details, by the Vakyapadlya and the Rdjatarahgini.
Returning to the relationship between the cults of
Avalokitesvara and Mahesvara, we should note that this
relationship, as manifested in different texts and sculptural/artistic traditions, ranged from hostility and animosity, on the one hand, to accommodation, tolerance,
and even identification between the two, in some traditions. This is perhaps what accounts for the variation in
the Buddhist response to Panini.
The hostility between the Avalokitesvara cult and the
Mahesvara cult is manifest in several important Buddhist texts. In the Karandavyuha, a text dedicated to the
exposition of the figure of Avalokitesvara, the fourth section, called Candrddyutpattih, narrates a conversation
between the Buddha and the disciple Sarvavarananiskambhin about Avalokitesvara's greatness. The Buddha
reports to his disciple the greatness of Avalokitesvara as
narrated to him by the Tathagata Vipasyin (Mahayanasutrasamgraha, I: 265):
bhagavan aha-caksusos candraditydv utpannau, lalatan mahesvarah, skandhebhyo brahmadayah, hrdaydn
narayanah, damstrabhyam sarasvati, mukhato vayavo
jatah, dharani pddabhydm, varunas codardt / yadaite
devdjata dryavalokitesvarasyakdydt,athdrydvalokitesvaro bodhisattvo mahasattvo mahesvaram devaputram
etad avocat-bhavisyasi tvammahesvarahkaliyugepratiddideva dkhydyase
panne / kastasattvadhatusamutpanna
strastdram kartdram / te sarvasattva bodhimargena
viprahina bhavisyanti, ya idrsaprthagjanesu sattvesu
samkathyamkurvanti
The Lord said; "From [Avalokitesvara's]eyes were born
the moon and the sun. From his forehead was born
Mahesvara [= Siva]. Brahma and others were born from
his shoulders. Narayanawas born from his heart. Saras-
vati was born from his jaws. The winds were born from
his mouth, and the earth from his feet. Varunawas born
from his belly. When these gods were born from the body
of Arya Avalokitesvara, then Arya Avalokitesvara Bodhisattva, the great being, said to Mahesvara, the young
god (devaputra):'When the Kali Yuga arrives, you will
become Mahesvara,the great lord. Born from the realm
of beings in distress, you will be called the Adideva, the
foremost among gods, the creator.All those beings, who
will hold conversation with such lowly common folks
(who believe in you as the foremost among gods), will
be deprived of the path to enlightenment."'
In other passages, we get indications of subordination
of Vedic gods, including Mahegvara, to the Buddha or
the bodhisattvas. While the beginning of the Pali Vinaya
(Mahavaggo, Brahmayacanakathd, 6ff.) depicts Brahma
as begging the Buddha that he should not remain silent,
but teach his doctrine for the benefit of the world, the
Saddharmapundarlka (2.115; p. 39) includes among the
supplicants, besides Brahma, the gods Indra, the Lokapalas, I4vara, Mahegvara, and uncountably large groups
of Maruts (brahma ca mam yacati tasmi[n] kale sakras
ca catvari ca lokapalaih / mahesvaro isvara eva ccpi marudgananam ca sahasrakotyah).
Other passages of the Karandavyuha also indicate subordination of Mahegvara. The text says (Mahayanasutrasamgraha, I: 299) that gods such as Brahma, Visnu,
Mahegvara, the Moon, the Sun, the Wind, Varuna, Agni,
and Yama approach Avalokitesvara to worship him
(piijkarmane upasamkramanti) and beg for "the sixsyllabled queen of wisdom" (te nityakalam sadaksarim
mahdvidyardjnilm prarthayanti). However, in the Vaineyadharmopadesa section of the Karandavyuha (ibid.;
p. 268), we are told that Avalokitesvara teaches differently to different beings, assuming different forms (yena
yena rupena vaineyah sattvdh, tena tena ripena dharmam desayati). Among the many different forms Avalokitesvara assumes are Mahegvara, Narayana, Brahma,
Indra, Aditya, and others (cf. mahesvaravaineyanam
sattvdndm mahesvararupena dharmam desayati). The
Saddharmapundarikasutra (p. 252) contains most of the
passage from the Kdrandavyihasitra mentioned above.'4
The Lahkavatarasutra (3.85; p. 78) reports the Buddha
as saying that he is known by different names, but people
14 But above and
DESHPANDE:
Who Inspired Panini?
do not realize that these are only different names referring to the same Tathagata(tais cdbhilapanti mdm,na
ca prajananti tathagatasyaite ndmaparyayd iti). These
names include the following: Brahma, Visnu, Isvara,
Pradhana, Kapila, Bhutanta, Aristanemi, Soma, Bhaskara, Rama, Vyasa, Suka, Indra, Bali, and Varuna.
These are indications of the Buddhist version of "inclusivism," a term which is normally used in reference to
Hinduism. The name Mahesvara is occasionally used
directly as an epithet for the Buddha (cf. Saddharmapun.dartkasutra,4.60; p. 83: anuvartamdnas tatha
nityakalam nimittacdrina braviti dharmam / dharmesvaro Isvaru sarvaloke mahesvaro lokavindyakendrah).
The connections between Buddhist deities like Avalokitesvara and Mahegvara are also manifest in arthistorical and numismatic materials in India and elsewhere. The depiction of Buddhist and Hindu divinities,
besides Greek and Iranian ones, can be seen in Kushan
coinage (cf. B. Chattopadhyay1967: 170ff.). It is perhaps
here that we see the depiction of Siva in many different
forms, besides the depiction of the Buddha, supported
by the same rulers. This, at the very least, allows us to
infer the co-existence of both the traditions in this region. Nalinaksha Dutt (1939: 12) remarks: "The Kashmirian history shows that Asoka built temples both for
Siva and Buddha and since his reign the two faiths, i.e.,
Buddhism and Saivism, flourished in Kashmir side by
side and even claimed at times the same persons as their
devotees."
Such affinity is particularly evident between Avalokitesvaraand Mahesvara.The close connection of Avalokitegvaraand Siva was broughtout by Alice Getty in her
famous work, The Gods of Northern Buddhism, Their
History and Iconography (1928):
is sometimesrepresented
withfiveheads,
Avalokitesvara
in whichcase he resemblesSiva as Mahfdevawithfive
heads;buthis formwithmorethanone headhasusually
doublethatnumber,withthe headof Amitabhaon top,
makingeleven headsin all. He is often representedin
yab-yumattitudewith his sakti,but thereareexamples
wherehe holdsthe yumon his kneein archaicmanner,
as Siva holdsParvati.(p. 59)
She also refers to forms of Avalokitesvara with kapala (p. 60), a third eye, wearing a tiger-skin, a trident,
his throat blue because of poison, a serpent, and a crescent (p. 69). These are all clearly Saivite motifs. Referring to Avalokitesvara, Dietrich Seckel (1964: 224-25)
points out:
Religiousspeculationandpopularpietyinvesthimwith
immensewisdomandthe powerto workmiracles,as a
459
460
DESHPANDE:
Who Inspired Panini?
ern region (pp. 106, 162 ["to give a village to eighty
learned Brahmanas from Kashmir"]), and the fact that
many of the southernSaivite teachers are called KaSmira
Panditas (pp. 105, 108, 139 [kasmiradeva], 155 [kasmirasurisvara]). The connection of the Kashmir Saiva
traditionwith the southernregion may then help explain
the appearance of the Kashmir Saiva text of Nandikesvarakdsikdand its commentaryby Upamanyu, which
seem to link the Paninian tradition to the dance of Siva
Nataraja,the presiding deity of Chidambaram.
How then does one account for all those Paninian
commentators who are Buddhist? It seems to me that
they all belong to the post-Gupta or post-Harsavardhana
period, where gradually the Buddhist tradition is on the
decline, though it does not completely disappear. Buddhist commentators like Jinendrabuddhi'8were perhaps
living in a period when their Buddhist tradition was not
dominant. Yet, one notices a significant difference in
the introductory sections of Haradatta'sPadamanjari
and Jinendrabuddhi'sNyasa. Haradattadiscusses at great
length the Vedic connections of Panini's grammar and
the eternal natureof Sanskritusage. He also discusses at
some length the purposes of Sanskrit grammar,such as
the protection and preservation of the Vedas, suggested
by Patafijaliat the beginning of his Mahabhasya. Compare with this the Kadikavrttiitself. It starts without a
benediction, and without any discussion of the Vedic purposes of Sanskrit grammar.Jinendrabuddhisticks very
closely to the pattern set by the Kasikavrtti. Without
much ado, the Kasikavrtti begins with atha sabdanu?dsanam "thus begins the teaching of words."Haradatta,
while acknowledging that the Kdsikavrttidoes not give
any other purposes, adds a full discussion of those purposes. On the other hand, consider the comment of Jinendrabuddhi(Kdaikdvrtti,I: 14):
vydkaranasyacedam anvarthamndma sabdanusasanam
iti / atas tenaiva sucitatvdtprayojanasyanabhidhanam/
yena hi sabdd anusisyante, tasya taduddese pravrttih /
yasya ca yad uddisya pravrttih, tat tasya prayojanam
bhavati / tad etad uktam bhavati-sabddnusistir asya
18BhimsenShastri
(1979: 13ff.) discussesthe questionof
Jinendrabuddhi's
religiousaffiliation.He rejectsthe claimsthat
he was eithera Jainaor a Buddhist,andarguesfor his Vaidika
identity.I am not convincedof his Vaidikaidentity.Janaki
PrasadDvivedi(1987: 203ff.) has reviewedthis question,but
has includedJinendrabuddhi
In
amongBuddhistgrammarians.
myopinion,his titlebodhisattvadesgya
placeshimwithoutdoubt
withina Buddhisttradition.
461
Sabdanusdsana
"teachingof words"is the literallysignificanttitleof grammar.
Sincethepurpose[of grammar]
is suggesteddirectlyby that[verytitle],it has not been
expressed[overtly].That [science]which teachesthe
wordssets out with thatas its target.Whensomething
sets out witha certaintarget,thatis its purpose.Thisis
whatis said:Theteachingof wordsis its purpose.This
is thedirectpurpose.Otherindirectpurposessuchas the
of the Vedasshouldbe studied
protection/preservation
from the Bhasya.
462
Here, the first explanation is a repetition of the standard traditional explanation, also seen in the Padamanjari. However, the second explanation marks a departure
by pointing out that only the laukika words are useful for
the purpose of conducting the business of the world.
Why would the Vedic words be of intimate interest to a
Buddhist, who was never going to use them in rituals, in
any case? Thus, Jinendrabuddhi has hinted at the secondary nature of the Vedic words from his own point of
view. Is this a pure conjecture? I hope not. Consider the
beginning of Purusottamadeva's Bhdsdvrtti: atha sabddnusasanam / laukikandm, "Here begins the description
of words. Of which words? Of worldly words." With
this declaration at the beginning of his work, Purusottamadeva focuses only on laukika portions of the Astadhayi, omitting the Vedic rules completely. The author
may be continuing here a trend which was merely suggested by Jinendrabuddhi.'9 In any case, what Purusot19 Therecould be additionalreasonsas
suggestedby Srstidhara,
namely that Laksmanasena,the patronof Purusottamadeva,had
BIBLIOGRAPHY
Sanskrit Sources
Abhidharmakosa,by Vasubandhu,with his own Bhasya, and the
commentary Sphutarthd by Yasomitra, vol. I. Ed. Swami
Dwarikadas Shastri. Banaras:Bauddha Bharati.
463
Mahabhasyapradipavyakhyanani.Ed. M. S. Narasimhacharya.
Publications de l'Institut franqais d'indologie, no. 51.1.
Pondich6ry:Institut francais d'indologie, 1973.
Mahdaynasutrasamgraha.Ed. P. L. Vaidya. Buddhist Sanskrit
Texts, nos. 17, 18. Darbhanga:The Mithila Institute, 1961,
1964.
Mahavagga. Nalanda Devanagari Pali TripitakaSeries, vol. I.
Patna: Bihar Government Publications, 1956.
Maijusrimilakalpa. See: Mahayanasutrasamgraha,pt. I.
Pdninlyasiksa (versified version). In Siddhdnta-Kaumudi,pp.
673-74.
Paribhasavrtti,Jinpakasamuccaya, and Karakacakra,by Purusottamadeva.Ed. Dinesh ChandraBhattacharya.SavitiaryaSmrtisamraksana-Granthamfala.
Rajshahi, Bengal: Varendra
Research Museum, 1946.
Paribhasendusekhara,by Nfgesabhatta. Ed. K. V. Abhyankar,
with the commentaryTattvddarsaof Vasudev ShastriAbhyankar, pt. 1. Pune: BhandarkarOriental Research Institute,
1962.
Patanjalicarita, by Ramabhadra Diksita. Kavyamala Series,
no. 51. Ed. Pandit Shivadatta and Kashinath Pandurang
Parab. Bombay: Nirnaya Sagara Press, 1895.
Prakriyakaumudi,by Ramacandra,with the Prasdda commentary, by Vitthala, vols. I-II. Ed. K. P. Trivedi. Bombay Sanskrit and Prakrit Series, nos. LXXVIII, LXXXVII. Pune:
BhandarkarOriental Research Institute, 1925, 1931.
Rajatarahgini, by Kalhana, vol. I. Ed. M. A. Stein. Originally
printed in 1892. Reprint, Delhi: Munshiram Manoharlal,
1960.
Riipavatdra,by Dharmakirti,pts. I and II. Ed. M. Rangacharya.
Madras:G. A. Natesan & Company, 1916, 1927.
Sabdakaustubha,by Bhattoji Diksita, vol. I, fasc. I-IV. Ed. Gopal Shastri Nene and Mukund Shastri Puntamkar.Chaukhamba Sanskrit Series. Banaras:The ChowkhambaSanskrit
Series Office, 1933.
Saddharmapundarikasitra.Ed. P. L. Vaidya. Buddhist Sanskrit
Texts, no. 6. Darbhanga:The Mithila Institute, 1960.
Siddhanta-Kaumudi,by Bhattoji Diksita, with Tattvabodhini.,
by JnfinendraSarasvati. Ed. Wasudev Laxman Sastri Panshikar. 7th ed. Bombay: Nirnaya Sagara Press, 1933.
Tantrdlokaby Abhinavagupta,with commentary by Jayaratha,
vol. XII. Ed. MadhusudanKaul Shastri. Kashmir Series of
Texts and Studies, no. LVIII. Shrinagar:Govt. of Kashmir,
1938.
Vakyapadiya,by Bhartrhari.Ed. Wilhelm Rau. Abhandlungen
fur die Kunde des Morgenlandes, XLII.4. Wiesbaden,
1977.
Other Authorities
Abhyankar,K. V. 1954. Prastavand Khanda. Introductionto the
6 volume Marathitranslationof Patafijali'sMahdbhasya,by
464
History of Saiva Philosophy. The Princess of Wales Saraswati Bhavana Texts, no. 84. Lucknow: Lucknow University.
.1963. Abhinavagupta:An Historical and Philosophical Study. 2nd ed. Chowhamba Sanskrit Studies, vol. I.
Banaras:ChowkhambaSanskrit Series Office.
Scott, David. 1993. "Siva and the East Iranians of Bactria:
Hindu Cross-culturalExpansion, I."InternationalJournal of
Indian Studies, 3.1: 88-106.
Seckel, Detriech. 1963. TheArt of Buddhism.New York:Crown
Publishers, Inc.
Shastri,Bhimsen. 1979. Nyasaparydlocana:Jinendrabuddhikrta
Kasikdvivaranapaijikd ka Alocandtmaka Adhyayana (in
Hindi). Delhi: Bhaimi Prakashan.
1984. A-i-u-n r-l-k adi pratydahra sutrokd nirmdtd
kaun? Nandikesvarakadikasahita(in Hindi). Delhi: Bhaimi
Prakashan.
465