Professional Documents
Culture Documents
Vaccine: Mirriam G.J. Tacken, Franz J. Daus, Femke Feenstra, René G.P. Van Gennip, Piet A. Van Rijn
Vaccine: Mirriam G.J. Tacken, Franz J. Daus, Femke Feenstra, René G.P. Van Gennip, Piet A. Van Rijn
Vaccine
journal homepage: www.elsevier.com/locate/vaccine
Department of Virology, Central Veterinary Institute of Wageningen UR, Lelystad, The Netherlands
Department of Infectious Diseases and Immunology, Faculty of Veterinary Medicine, Utrecht University, Utrecht, The Netherlands
c
Department of Biochemistry, Centre for Human Metabonomics, North-West University, Potchefstroom, South Africa
b
a r t i c l e
i n f o
Article history:
Received 12 July 2015
Received in revised form 4 September 2015
Accepted 5 September 2015
Available online 19 September 2015
Keywords:
Bluetongue
DIVA
Disabled Infectious Single Animal vaccine
ELISA
Non-structural protein 3
a b s t r a c t
Recently, we have developed a novel vaccine for Bluetongue named BT Disabled Infectious Single Animal
(DISA) vaccine. Due to the lack of non-essential NS3/NS3a protein, BT DISA vaccine is a replicating vaccine,
but without the inherent risks of live-attenuated vaccines, such as residual virulence or reversion to virulence by mutations, reassortment with eld virus, horizontal spread by vectors and vertical transmission.
The immune response induced by BT DISA vaccines is rapidly induced, highly protective and serotype
specic which is dependent on the immunodominant and serotype determining VP2 protein. The BT
DISA vaccine platform provides the replacement of exclusively VP2 from different serotypes in order to
safely formulate multivalent cocktail vaccines. The lack of NS3/NS3a directed antibodies by BT DISA vaccination enables differentiation of infected from vaccinated animals (DIVA principle). A highly conserved
immunogenic site corresponding to the late domain was mapped in the N-terminal region of NS3. We
here established an NS3-specic competitive ELISA (NS3 cELISA) as serological DIVA test accompanying
BT DISA vaccines. To this end, NS3 protein missing putative transmembrane regions was produced in
large amounts in bacteria and used as antigen in the NS3 cELISA which was investigated with a variety
of sera. The NS3 cELISA displayed a high sensitivity and specicity similar to the commercially available
VP7-specic cELISA. Results of previously performed vaccination-challenge trials with BT DISA vaccines
clearly demonstrate the DIVA system based on the NS3 cELISA and BT vaccine free of NS3 protein.
2015 Elsevier Ltd. All rights reserved.
1. Introduction
Bluetongue (BT) has been listed as a notiable disease to the
World Organisation for Animal Health (OIE) [1]. BT is a noncontagious disease of ruminants caused by bluetongue viruses
(BTV) transmitted by Culicoides biting midges [2,3]. BTV causes economic losses by morbidity and mortality but mainly by restrictions
on movement and trade of animals and animal products [4]. Today,
27 BTV serotypes have been identied [59]. BT is endemic in temperate and (sub)tropical climate zones [10], however, has expanded
to areas with a milder climate related to competent vectors [1113].
5540
Fig. 1. Schematic representation of Seg-10 and the encoded NS3/NS3a proteins. Calpactin p11 binding domain (P), late domain (LD), two transmembrane regions (TM1 and
TM2) with a conserved glycosylation sites in-between (NLG149 ), the VP2 binding domain (BD) are indicated. The topological orientation is indicated by intracellular (IC) and
extracellular (EC). Putatively expressed NS3 related proteins are indicated by boxes, whereas untranslated sequences are shown by lines. Numbers indicate the amino acid
position, and numbers between brackets indicate the nucleotide position. Seg-10 NS3D(S2reposition) was used to map epitopes on NS3 (Supplemented data A), and Seg-10
mutant C was incorporated in BT DISA vaccines. NS3TM protein was used as antigen, and contains an in-frame deletion encompassing TM1, EC, and TM2. Streptavidin
tag (Strep) and His10 tag (His) were linked in-frame to the N- and C-terminus, respectively, and are indicated by striped boxes.
5541
BTV8
1-24
TOV
KUW
BTV-n
:
:
:
:
:
*
20
*
40
*
60
MLSGLIQRFEEEKMKHNQDRVEELSLVRVDDTISQPPRYAPSAPMPSSMPTVALEILDKA :
......q.....k.....d.v.......................m............... :
...............RTES.T........GERL.L..G......A.PA..S......... :
................SDQK........AG.R..L..G......A.PA............ :
.VIL.............EQKT.......AG.R..L..G......A.PA............ :
60
60
60
60
60
BTV8
1-24
TOV
KUW
BTV-n
:
:
:
:
:
*
80
*
100
*
120
MSNTTGATQTQKAEKAAFASYAEAFRDDVRLRQIKRHVNEQILPKLKSDLSGLKKKRAII :
..................................................s......... :
............T.....................................G.M....T.. :
....................................................M....... :
.......................................D............M....... :
120
120
120
120
120
Fig. 2. Alignment of the N-terminal 120 amino acids of NS3. Completely conserved aa residues of BTV124 are indicated by dots, and aa positions showing variation (>5 out of
83 full length NS3 aa sequences) are indicated by small symbols. Differences compared to BTV8-NS3 are indicated by capitols for Toggenburg Orbivirus (TOV; BTV25), Kuwait
strain (KUW; BTV26), and BTV-n (BTV27). The late domain (PPRYAPSAP) is underlined.
5542
Fig. 3. Production and purication of NS3TM. Proteins were separated by SDSPAGE and stained by CBB (A); prior to IPTG induction (1); 4 h post IPTG induction (2); 4 h
without IPTG induction (3). Proteins in pooled eluate of puried NS3TM was stained with CBB (B), or identied with anti-His MAbs by Western blotting (C). MW (kDa) of
reference proteins are indicated. Arrows indicate the position of His-tagged NS3TM.
4. Sensitivity
Challenge controls were used to study NS3 seroconversion after
BTV infection. Note that these nave sheep were infected at day
21 and day 84 of the vaccination/challenge experiment presented
in Fig. 4A and B, respectively. Four out of 16 sheep seroconverted
(>20%) at 9 dpi, and all were positive for NS3 Abs at 11 dpi. These
sheep seroconverted for VP7 Abs at 7 dpi (day 28 and day 91, respectively). At 14 and 21 dpi, all nave sheep infected with BTV2 or 8
(n = 12) were positive for NS3 Abs (3190%), and VP7 Abs (9298%).
Reference sera for BTV serotypes 124 were tested positive for
NS3 Abs (4589%), except for reference serum for serotype 4 (Fig. 5).
However, a well-dened sheep serum at 42 dpi with reference BTV4
was positive (BTV4(2), Fig. 5). Sera for BTV2527 were negative (2
to 12%). BTV25 and BTV27(2) were also negative by the VP7 cELISA,
whereas BTV26 and BTV27(1) were positive. An experimental indirect ELISA for BTV NS3 Abs (NS3 iELISA) was also positive for BTV26
and BTV27(1) (Supplemented data B).
4.1. Specicity
Pre-sera of sheep were negative for NS3 Abs, as described above.
EHDV VP7 positive sera of unknown origin for serotype 1 and 2
showed blocking of 53% and 28% by the NS3 cELISA (Fig. 5). However, sera for EHDV1, 5 and 8 were also positive for BTV VP7 Abs
indicating that these animals were also BTV infected. Sera of ve
cattle experimentally infected with EHDV6 were positive by the
EHDV VP7 cELISA [44] and were negative for BTV VP7 Abs (threshold 50%) (Fig. 5). Two out of ve sera were positive by the BTV NS3
cELISA indicating cross reaction of EHDV6 induced Abs. Four out of
ve of these EHDV6 sera were also positive by the NS3 iELISA for
BTV NS3 Abs (Supplemented data B) conrming cross reaction of
EHDV6 induced Abs.
5543
100
90
80
70
60
50
40
30
20
10
0
-10
100
90
80
70
60
50
40
30
20
10
0
-10
14
21
28
days post vaccinaon
35
42
100
100
90
90
80
80
70
70
60
60
50
50
40
40
30
30
20
20
10
10
-10
-10
0
14
21
28
35
42 49 56 63 70
days post vaccinaon
77
84
91
98 105
Fig. 4. Seroconversion for VP7 and NS3 Abs determined by cELISAs. Groups of four sheep were vaccinated with DISA vaccine and challenged with virulent BTV8 indicated with
open and lled arrows, respectively. The mean blocking percentage per group is shown for the VP7 cELISA and the NS3 cELISA by solid and dashed lines, respectively. The
threshold of the VP7 and NS3 cELISA is 50% and 20% blocking, respectively. (A) Groups were vaccinated at day 0 (0 dpv) with BT DISA vaccine 8 containing VP2 of serotype
8 and based on BTV1 (blue), BTV6 (green), and BTV8 (red), with an equal amount of inactivated not-adjuvanted BTV8 (purple) or with lysate as negative control (black). At
21 days post vaccination, all groups were infected with virulent BTV8. (B) Two groups were vaccinated twice at day 0 (0 dpv) and 21 dpv with BT DISA vaccine 8. At 84 dpv,
one group was infected with homologous virulent BTV8 (red) and one with heterologous virulent BTV2 (blue). Two groups served as challenge controls for virulent BTV8
(purple), and virulent BTV2 (dark blue).
Fig. 5. Diagnostic sensitivity and specicity of the NS3 cELISA. Reference sera for the serum neutralization tests for serotype 124, for recently discovered BTV serotypes 2527,
and for available EHDV sera were tested in the NS3 cELISA (lled bars) and VP7 cELISA (open bars). The percentage of blocking [(ODmax ODsample )/ODmax 100%] was
calculated. Test results were interpreted positive (+) or negative () using a cut-off of 50% for the VP7 cELISA (solid line), and 20% for the NS3 cELISA (dashed line).
5544
Table 1
NS3 cELISA test results of eld sera. (A) VP7-positive sera from Dutch sheep that were
suspected to be infected by BTV in 2007/2008 were tested in the NS3 cELISA. Since
these sera were selected for VP7 Abs, no VP7 negative sera were tested (nd). (B)
South African sheep were randomly sampled and tested in the VP7 and the NS3
cELISA.
A
Suspected
VP7
(n = 139)
NS3
127
12
nd
nd
B
Random
VP7
(n = 96)
NS3
8
39
1
48
cELISA and positive for NS3 Abs, whereas 48 out of 96 sera were
negative by both cELISAs.
5. Discussion
The late domain (LD) of NS3/NS3a is highly conserved and
very immunogenic, and therefore important for the DIVA test
accompanying DIVA vaccine in which this part is deleted (DIVA:
Differentiation Infected from Vaccinated Animals). The novel Disabled Infectious Single Animal (DISA) vaccine lacks NS3/NS3a
expression by deletion of LD, and restore of LD expression is therefore excluded [3032,39]. NS3 related expression from mutated
Seg-10 has been reported [37,40], which makes an NS3 iELISA
detecting all NS3 Abs less suitable as DIVA test. A previously
published DIVA system based on a NS3 iELISA and inactivated BT
vaccine is dependent on the purity of BT vaccine with respect to
NS3 protein [21]. The here developed NS3 cELISA is also suitable
as DIVA test in combination with any BT vaccine free of NS3/NS3a
protein or in which LD is not expressed. In addition, a cELISA for
NS3 Abs is preferred as DIVA test, since such cELISA can be used
regardless the variety of ruminant species.
Furthermore, vaccination with live-attenuated or inactivated
vaccines could also result in PCR positivity [36,45,46], but panBTV
PCR tests based on Seg-10 [7,43,4749] will not detect BT DISA
vaccines according to a genetic DIVA approach [30,38].
The NS3 cELISA is not detecting NS3 Abs against BTV serotypes
2527 (Fig. 5), but is suitable to monitor DISA vaccinated populations for pathogenic BTV serotypes 124. Further, EHDV6 infection
can also lead to cross reacting Abs resulting in false positive test
results with the NS3 cELISA. Thus, the NS3 cELISA is not 100% sensitive and not 100% specic/selective for Abs directed against BTV
NS3. BT and EHD are both notiable diseases [49], and positive
results with the NS3 cELISA could be easily differentiated for BTV
and EHDV infections with specic VP7 based cELISAs.
Obviously, VP7 is more abundantly and earlier expressed than
NS3 in infected animals, and consequently VP7 Abs are earlier
detected than NS3 Abs (Fig. 4). However, panBTV PCR tests are
preferred to conrm acute BTV infections. Furthermore, BTV infection in DISA vaccinated animals that were unnoticed with a Seg-1
based panBTV PCR test were detected with the NS3 cELISA (Fig. 4)
[30,31]. These results indicate a high diagnostic sensitivity of the
NS3 cELISA, and show that the NS3 cELISA is an excellent tool to
monitor DISA vaccinated populations for BTV circulation.
NS3 Abs are detected in cattle for >200 dpi, which is much longer
than the infectious period [1] and longer that the period of PCR positivity [43]. On the other hand, this period is shorter than for VP7
directed Abs, which are likely lifelong present after BTV infection.
Taken together, positive results with the NS3 cELISA strongly suggest BTV infection, but EHDV infection cannot be excluded. Testing
for VP7 Abs will be needed to distinguish between EHDV and BTV
infections. Negative results suggest non-infectiousness of the animal, although an acute BTV infection, or a previous BTV infection
cannot be excluded. Testing of paired serum samples of at least
one week apart will differentiate between an acute or old infection.
Alternatively, PCR testing will detect acute BTV infections.
The NS3 cELISA can be further improved by use of conjugated
MAb and a modied NS3 antigen to detect BTV2527 infections.
The ultimate ELISA format should be validated with well-dened
sera raised against more serotypes of both BTV and EHDV, and for
different ruminant species, in particular cattle, sheep and goat.
Summarizing, the NS3 cELISA and Seg-10 based panBTV PCR
tests in combination with BT DISA vaccine is a suitable DIVA system
to adequately control BT outbreaks, and to safely allow transport
and trade of vaccinated livestock.
Acknowledgements
The authors thank dr. Carmen Vela and dr. Paloma Rueda (Ingenasa, Spain) for MAbs directed against NS3 of BTV. Reference sera
for BTV serotype 124 and BTV26 (KUW) serum were kindly supplied by Carrie Batten (the EU reference Institute for Bluetongue,
The Pirbright Institute United Kingdom). Serum for BTV25 (TOV)
was a generous gift from Barbara Thr, IVI Switzerland, and sera
for BTV27 (BTV-n) and EHDV6 were kindly provided by Emmanuel
Breard, ANSES, France. Field sera from South African sheep were
shipped by Christiaan Potgieter, Deltamune, South Africa. This
research was funded by the Dutch Ministry of Economic Affairs
(CVI-project 1600013-01 and 1600020-01).
Appendix A. Supplementary data
Supplementary data associated with this article can be found, in
the online version, at http://dx.doi.org/10.1016/j.vaccine.2015.09.
020.
References
[1] OIE. Terrestrial animal health code. Paris: OIE; 2014.
[2] Taylor WP. The epidemiology of bluetongue. Rev Sci Tech Off Int Epizoot
1986;5:3516.
[3] Verwoerd DW, Erasmus BJ. Bluetongue. In: Coetzer JAW, Tustin RC, editors.
Infectious diseases of livestock. 2nd ed. Cape Town, South Africa: Oxford University Press; 2004. p. 120120.
[4] Purse BV, Mellor PS, Rogers DJ, Samuel AR, Mertens PP, Baylis M. Climate
change and the recent emergence of bluetongue in Europe. Nat Rev Microbiol
2005;3:17181.
[5] Huismans H, Erasmus BJ. Identication of the serotype-specic and groupspecic antigens of bluetongue virus. Onderstepoort J Vet Res 1981;48:518.
[6] Maan NS, Maan S, Belaganahalli MN, Ostlund EN, Johnson DJ, Nomikou K, et al.
Identication and differentiation of the twenty six bluetongue virus serotypes
by RT-PCR amplication of the serotype-specic genome segment 2. PLoS ONE
2012;7:e32601.
[7] Hofmann MA, Renzullo S, Mader M, Chaignat V, Worwa G, Thuer B. Genetic
characterization of Toggenburg Orbivirus, a new bluetongue virus, from goats,
Switzerland. Emerg Infect Dis 2008;14:185561.
[8] Maan S, Maan NS, Nomikou K, Batten C, Antony F, Belaganahalli MN, et al. Novel
bluetongue virus serotype from Kuwait. Emerg Infect Dis 2011;17:8869.
[9] Zientara S, Sailleau C, Viarouge C, Hoper D, Beer M, Jenckel M, et al. Novel
bluetongue virus in goats, Corsica, France, 2014. Emerg Infect Dis 2014;20:
212332.
[10] Gibbs EP, Greiner EC. The epidemiology of bluetongue. Comp Immunol Microbiol Infect Dis 1994;17:20720.
[11] Dijkstra E, van der Ven IJ, Meiswinkel R, Holzel DR, Van Rijn PA, Meiswinkel
R. Culicoides chiopterus as a potential vector of bluetongue virus in Europe. Vet
Rec 2008;162:422.
[12] Meiswinkel R, van Rijn P, Leijs P, Goffredo M. Potential new Culicoides vector
of bluetongue virus in northern Europe. Vet Rec 2007;161:5645.
[13] Mehlhorn H, Walldorf V, Klimpel S, Jahn B, Jaeger F, Eschweiler J, et al. First
occurrence of Culicoides obsoletus-transmitted bluetongue virus epidemic in
Central Europe. Parasitol Res 2007;101:21928.
5545
[32] Feenstra F, Pap JS, van Rijn PA. Application of bluetongue Disabled Infectious
Single Animal (DISA) vaccine for different serotypes by VP2 exchange or incorporation of chimeric VP2. Vaccine 2015;33:8128.
[33] van Oirschot JT, Rziha HJ, Moonen PJ, Pol JM, van Zaane D. Differentiation of
serum antibodies from pigs vaccinated or infected with Aujeszkys disease virus
by a competitive enzyme immunoassay. J Gen Virol 1986;67(Pt 6):117982.
[34] van Oirschot JT. Diva vaccines that reduce virus transmission. J Biotechnol
1999;73:195205.
[35] Sato M, Tanaka H, Yamada T, Yamamoto N. Persistent infection of BHK21/WI2 cells with rubella virus and characterization of rubella variants. Arch Virol
1977;54:33343.
[36] van Gennip RG, van de Water SG, Potgieter CA, Wright IM, Veldman D, van Rijn
PA. Rescue of recent virulent and avirulent eld strains of bluetongue virus by
reverse genetics. PLoS ONE 2012;7:e30540.
[37] van Gennip RG, van de Water SG, van Rijn PA. Bluetongue virus nonstructural protein NS3/NS3a is not essential for virus replication. PLoS ONE
2014;9:e85788.
[38] van Rijn PA, van de Water SG, van Gennip HG. Bluetongue virus with mutated
genome segment 10 to differentiate infected from vaccinated animals: a genetic
DIVA approach. Vaccine 2013;31:50058.
[39] Feenstra F, van Gennip RG, van de Water SG, van Rijn PA. RNA elements in
open reading frames of the bluetongue virus genome are essential for virus
replication. PLoS ONE 2014;9:e92377.
[40] van de Water SG, van Gennip RG, Potgieter CA, Wright IM, van Rijn PA. VP2
exchange and NS3/NS3a deletion in African horse sickness virus (AHSV) in
development of Disabled Infectious Single Animal vaccine candidates for AHSV.
J Virol 2015;89:876472.
[41] Wensvoort G, Terpstra C, Bloemraad M. Detection of antibodies against African
swine fever virus using infected monolayers and monoclonal-antibodies. Vet
Rec 1988;122:5369.
[42] Backx A, Heutink CG, van Rooij EM, van Rijn PA. Clinical signs of bluetongue
virus serotype 8 infection in sheep and goats. Vet Rec 2007;161:5912.
[43] van Rijn PA, Heutink RG, Boonstra J, Kramps HA, van Gennip RG. Sustained
high-throughput polymerase chain reaction diagnostics during the European
epidemic of bluetongue virus serotype 8. J Vet Diagn Invest 2012;24:46978.
[44] Breard E, Belbis G, Viarouge C, Riou M, Desprat A, Moreau J, et al. Epizootic
hemorrhagic disease virus serotype 6 experimentation on adult cattle. Res Vet
Sci 2013;95:7948.
[45] Steinrigl A, Revilla-Fernandez S, Eichinger M, Koefer J, Winter P. Bluetongue
virus RNA detection by RT-qPCR in blood samples of sheep vaccinated with a
commercially available inactivated BTV-8 vaccine. Vaccine 2010;28:557381.
[46] De Leeuw I, Garigliany M, Bertels G, Willems T, Desmecht D, De Clercq K. Bluetongue virus RNA detection by real-time rt-PCR in post-vaccination samples
from cattle. Transboundary Emerg Dis 2015;62:15762.
[47] Orru G, Ferrando ML, Meloni M, Liciardi M, Savini G, De Santis P. Rapid detection
and quantitation of bluetongue virus (BTV) using a molecular beacon uorescent probe assay. J Virol Methods 2006;137:3442.
[48] Leblanc N, Rasmussen TB, Fernandez J, Sailleau C, Rasmussen LD, Uttenthal A,
et al. Development of a real-time RT-PCR assay based on primer-probe energy
transfer for the detection of all serotypes of bluetongue virus. J Virol Methods
2010;167:16571.
[49] OIE. Manual of diagnostic tests and vaccines for terrestrial animals. Paris: OIE;
2014.