Professional Documents
Culture Documents
Military Catalogue Carvell Consulting PDF
Military Catalogue Carvell Consulting PDF
Military Catalogue Carvell Consulting PDF
Introduction Letter
For
This proposal or quotation includes data that shall not be disclosed outside the Government and shall not be duplicated, used, or disclosed--in whole or in
part--for any purpose other than to evaluate this proposal or quotation. If, however, a contract is awarded to this offeror or quoter as a result of--or in
connection with--the submission of this data, the Government shall have the right to duplicate, use, or disclose the data to the extent provided in the
resulting contract. This restriction does not limit the Government's right to use information contained in this data if it is obtained from another source
without restriction. The data subject to this restriction are contained in sheets [insert numbers or other identification of sheets]
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or
quotation.
02/17/2017 Introduction Letter Page i
Carvell Consulting HQ
2207 Concord Pike # 708
Wilmington, DE 19803
Tel: +1 302-351-5955
Fax: +1 302-351-5956
UAE +971 566957624
Greetings:
Carvell Consulting, (CC) is pleased to submit the enclosed Capabilities Statement for
the Iraqi Ministry of Interior and Defense. This Capabilities Statement is in regards to
the supply of various Weapons Systems and Equipment.
We wish to present our company to support you in supplying of various equipment that
the Ministries may need in the field of defense services.
We are established and specializing in security and defense services and supply. Our
network of local, (Dijlah & Furat) and International (Wells Fargo, USA and Emirates
NBD, UAE), Banks are willing to support our operations and awarded Tenders.
Our Headquarters, located in Delaware, USA, with Branch Offices in Alabama, USA,
Baghdad, Iraq, Abu Dhabi, UAE, and soon to open offices in Manila, Philippines, and
Kabul, Afghanistan. As a distinguished supply and service company, we have the
ability to supply the below products from various American, European, and Asian
manufacturers:
Sincerely,
Rodney C. Mayse
CEO
Carvell Consulting
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or
quotation.
02/17/2017 Introduction Letter Page ii
0$1$*(0(17&2168/7,1*$1'6833/<6(59,&(6
MODEL 82A1
MODEL 95
8VHRUGLVFORVXUHRIGDWDFRQWDLQHGRQWKLVVKHHWLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDORUTXRWDWLRQ
7 3DJH
MODEL 82A1
After 30-plus years of making history, the powerhouse rifle that started it all is still
leading the pack. With its low felt recoil and self-loading action, the Model 82A1 offers
rapid, accurate firepower that never slows down. 4
3 5
2
1
12
13
11
F E AT U R E S
1. Front and rear sling loops 6. Accepts side accessory rails 10. Combat ready extractor and ejector
2. Steel receivers with durable parkerized finish 7. 20 (50.8 cm) or 29 (73.66 cm)* match grade 11. 10-round steel magazine (Available with non
(Cerakote Tan available*) fluted barrel detachable magazine for regulated states)
3. Flip up iron sites 8. Chrome line chamber and bore 12. Rear hand grip accepts adjustable monopod
4. 18 (45.72 cm) 27 MOA rail accepts carrying handle 9. High efficiency iconic arrowhead 2-port brake for 13. Ultra absorbent Sorbothane recoil pad
.50 BMG and cylindrical 3-port brake* for .416
5. Semi automatic recoil operated Barrett
6
9
7 8
10
COMES WITH
10-round steel magazine
Carrying handle
Operators manual *Shown with Cerakote Tan finish in .416 Barrett and 29 fluted barrel
MODEL 82A1
Three Decades Down Range S p ecificatio n s
For more than three decades, the Model 82A1 has Model:
been carefully honed, studied and then refined again. 82A1
The result is a feat of engineering so infinitely precise
it is hard to believe its man-made.
Calibers:
As the first and only semi-automatic .50 caliber .50 BMG
rifle available, the Model 82A1 continues to blaze .416 Barrett
new territory. Its chamber is chrome-plated
and dimensioned for both civilian and military Operation:
ammunition. The extractor and ejector are proven Semi-Automatic
to work under any condition, and close tolerances on
every part allow it to function in all environments. Barrel Lengths:
The muzzle brake, dual barrel springs and long .50 BMG
mainspring design make this iconic rifle comfortable 20 (50.8 cm)
and exciting to shoot. 29 (73.7 cm)
.416 Barrett
The .416 Barrett caliber brings new levels of precision Optimizing recoil reduction, the Model 82A1 features a caliber
29 (73.7 cm)
shooting to the Model 82A1. With the enhanced specific muzzle brake. All .50 BMG configurations feature the
accuracy and increased velocity of the .416 Barrett iconic 2-port brake and .416 Barrett configurations are fitted
Barrel Twist Rate:
cartridge, this rifle offers incredible long-range with a cylindrical 3-port brake.
precision. The Model 82A1 .416 is also available with 1 turn in 12 (30.5 cm) for .416 Barrett
a non-detachable magazine for state compliance 1 turn in 15 (38.1 cm) for .50 BMG
purposes in which the magazine can easily be
accessed for loading with a simple tool. For owners Overall Length:
that want to swap their .50 caliber configurations to 48 (121.9 cm)
.416 caliber, upper conversion units are available on 57 (145 cm)
the Barrett web site.
Rail Length/MOA:
The Model 82A1 fits into a regular sized carrying case. 18 (45.72 cm) 27 MOA
Although its transported as a disassembled upper
and lower receiver, it can be ready to fire in under a Weight:
minute. The scope remains mounted on the upper 31.45 lbs (14 kg)
receiver, maintaining zero. The rifles M1913 optics 32.71 lbs (14.8 kg)
rail has a 27 MOA taper to take full advantage of the
scopes elevation travel. Magazine Capacity:
Back up iron sights provided. Nerves of steel are not. 10 Rounds
Perfection isnt accomplished overnight. Nowhere is this more a significantly higher muzzle velocity, the .416 offers incredible
apparent than in the Model 82A1. For more than two decades, this long-range precision.
short-recoil, semi-automatic series rifle has been carefully honed,
studied and then refined again. The result is a feat of engineering The muzzle brake, dual barrel springs and long mainspring design
so impossibly precise, its hard to believe its man-made. make the 82A1 comfortable and exciting to shoot.
Unlike other semi-automatic .50 BMG rifles, the Model 82A1 is The Model 82A1 fits into a regular sized carrying case. Although its
completely reliable. Its chamber is chrome-plated and dimensioned transported as a disassembled upper and lower receiver, it can be
for both civilian and military ammunition. The extractor and ejector ready to fire in under a minute by simply inserting two assembly
are proven to work under any condition, and close tolerances on pins through both receivers. The scope remains mounted on the
every part allow it to function in all environments. upper receiver, maintaining scope zero. The rifles M1913 optics rail is
tapered 27 MOA to take full advantage of the scopes elevation travel.
The new .416 caliber alternative further adds to the allure of the
Model 82A1. With enhanced accuracy and stability, not to mention Emergency iron sights provided. Nerves of steel are not.
S pe c ifi c ations
Model: Model 82A1 and M82A1 CQ Rifle Weight: 30.9 lbs (14 kg) or 29.7 lbs (13.5 kg)
Caliber: .416 Barrett or .50 BMG Safety: Manual Thumb Lever
Rifle Operation: Semi-Automatic Sights: Flip-Up Iron Sights
Overall Length: 57 (145 cm) or 48 (122 cm) Optics Rail: 18.125 (46.03 cm)
Barrel Length: 29 (73.7 cm) or 20 (50.8 cm) Magazine: 10-Round Capacity
Rifling Twist: 1 in 12 (.416 Barrett) or 1 in 15 (.50 BMG) MSRP Starting at: $9,345.00
Configurations
Part No.
Model 82A1 .416 Barrett Rifle System: 29 chrome-lined barrel, Pelican case, one 10-round magazine, carry
* M82A1 416-SYS handle, flip-up iron sights, M1913 optics rail, detachable adjustable bipod legs, sling attach points, cleaning kit
and owners manual.
Model 82A1 .416 Barrett Rifle System, Non-Detachable Magazine: 29 barrel, Pelican case, one 10-round
* 12353 magazine, carry handle, flip-up iron sights, M1913 optics rail, detachable adjustable bipod legs, sling attach
points, cleaning kit and owners manual.
Model 82A1 .50 BMG Rifle System: 29 barrel, Pelican case, one 10-round magazine, carry handle, flip-up
M82A1-SYS iron sights, M1913 optics rail, detachable adjustable bipod legs, sling attach points, cleaning kit
and owners manual.
Model 82A1 .50 BMG Rifle System: 29 barrel, Leupold Mark 4 4.5-14x50, ZERO-GAP Ultra High rings, Pelican
M82A1-K1 case, one 10-round magazine, carry handle, flip-up iron sights, M1913 optics rail, detachable adjustable bipod
legs, monopod, sling attach points, cleaning kit and owners manual.
Model 82A1 .50 BMG Rifle System: 20 barrel, Pelican case, one 10-round magazine, carry handle, flip-up iron
M82A1CQ-SYS
sights, M1913 optics rail, detachable adjustable bipod legs, sling attach points, cleaning kit and owners manual.
1/2016
MODEL 95 TM
The Model 95 may weigh in at a smaller class, but packed into its lightweight bullpup
design is the intense power of a .50 caliber magazine-fed weapon, the pinpoint accuracy
of a bolt-action rifle and the effortless functionality of a perfectly designed machine.
5
4
2
1 3
9
8
10
F E AT U R E S
1. Compact, lightweight bullpup design 5. 11.25 (29.85 cm) 27 MOA M1913 rail 9. Accepts rear adjustable monopod
2. Simplistic bolt carrier assembly with quick release 6. Chrome-chambered 29 (73.6 cm) steel fluted 10. Ultra absorbent Sorbothane recoil pad
lever barrel
3. Ergonomic bolt handle design 7. 3-port high efficiency fanned muzzle brake
COMES WITH
Quick detach adjustable bipod
Operators Manual
Fully loaded. S P EC I F I C AT I O N S
This compact rifle offers the velocity and accuracy Model:
of a 29-inch barrel in a lightweight package with an 95
overall length of just 45 inches. The Model 95 is made
for those who refuse to sacrifice accuracy for power
Calibers:
while allowing the shooter to quickly and accurately
.50 BMG
fire five rounds, reload with a fresh magazine and get
back on target in seconds.
Operation:
Its buttplate, magazine well and trigger housing are Bolt Action
unitized, helping to stiffen the steel lower receiver.
The steel upper receiver is reinforced with an M1913 Barrel Lengths/Types:
Designed specifically for the bolt-action power of a .50 caliber
rail and supports the chrome-chambered, fluted 29 Fluted (73.6 cm)
rifle, the Model 95 high efficiency 3-port fanned muzzle brake
barrel. All Barrett rifles are designed for easy field
tames recoil.
stripping, so the two receivers can be assembled in Barrel Twist Rate:
less than 60 seconds without the use of tools. 1 turn in 15 (38.1 cm)
The bolt carrier itself is a study in innovation Overall Length:
designed for speed, reliability and safety. It slides
45 (114.3 cm)
effortlessly on machined-smooth rails, transporting
a large bolt that locks into the barrel extension on
Rail Length/MOA:
three lugs. This bolt carrier assembly is a simplistic
design with a quick release lever for fast disassembly. 11.75 (29.85 cm ) 27 MOA
The firing pin is driven by dual springs designed for
consistency and lightning-quick lock time. Weight:
23.5 lbs (10.7 kg)
Adopted by militaries all over the world, the Model 95
is not just proven in battle, its also fun to shoot. This bolt carrier assembly is a simplistic design with Magazine Capacity:
a quick release lever for fast disassembly. 5 Rounds
Model 95 3
6
5
7
Scope Base Screw
Barrel Screw
Barrel Screw
8
2
2
4 8 DP .125 x .4375 1
2 9 Cocking Piece 1
24 25 10 Firing Pin 1
1
11 Bolt Carrier 1
12 RP .093 x .375 1
7 5 13 Bolt Pin Lever 1
6 14 Firing Spring 2
15 Bolt Pin 1
16 Cam Pin Pin 2
17 Bolt 1
19 18 Ejector Spring 1
18 26 27 19 Ejector 1
12 13 16 17
14 20 Extractor Spring 1
23
21 Extractor Plunger 1
10
8 22 Extractor 1
35 36 23 Barrel Complete 1
34 38
22 63
24 Barrel Lock Nut 1
20 21 25 Muzzle Brake Shim 1
26 Muzzle Brake 1
37 27 Muzzle Brake Screw 1
15 33
11 64 28 Recoil Pad Screw 2
1 29 Recoil Pad 1
9 39
32 16 30 Lower Receiver 1
30 31 Safety 1
29 31 32 Sear Spring 1
33 Sear 1
34 Trigger Spring 1
41 65 35 Trigger 1
40 36 Trigger Overtravel Screw 1
49 37 Front Lock Pin 1
42
28 38 Yoke Mount Nut 2
50 66 39 Yoke Mount Washer 2
48 43
40 Yoke Mount 2
41 Bipod Shim Bushing 2
44
54 51 42 Bipod Screw 2
57 47
43 Bipod Spring 2
55 45
44 Bipod Detent 2
45 Bipod Pin 2
56 52
46 Bipod Leg Complete 2
46 47 Bipod Yoke 1
58
53 48 Trigger Housing Pin 2
49 Safety Detent 1
50 Safety Spring 1
51 Pistol Grip 1
52 Pistol Grip Stock Washer 1
59 53 Pistol Grip Screw 1
54 Magazine Catch Pin 1
55 Magazine Catch 1
56 Magazine Catch Spring 1
57 Monopod Lock Knob 1
60
58 Monopod Elevation Screw 1
61 59 Elevation Collar 1
60 Monopod Foot Washer 1
61 Monopod Foot 1
62
62 Monopod Screw 1
63 Magazine Complete 1
64 Magazine Floor Plate 1
65 Magazine Follower 1
66 Magazine Spring 1
1/2016
MANAGEMENT, CONSULTING AND SUPPLY SERVICES
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/15/2017 Page 1
Classification: Semi-automatic pistol, M1911
Operating System
- Recoil operated, closed breech, single action
Trigger / Action
- Fires one round each time the single action trigger is squeezed and the hammer is
cocked by the action of the slide.
Cartridge/s
- .45 ACP, .40 S&W and 9mm, Super .38
Barrel Type/s
- Standard with barrel bushing, no ramp, AISI-416 stainless steel
- Bull barrel, no bushing, with ramp, AISI-416 stainless steel
Barrel Length
- 5 inches
Rifling & Grooves
- 1 x 16 twist rate, 6 grooves
Velocity
- Approximately 825 ft/sec (230 grains FMJ)
Energy
-483 J (356 ftlb)
Maximum Effective Range (MER)
- 100 yards depending on wind and drift, 5-inch barrel
Weight (as pictured, magazine empty)
- Approximately 1.2 kg
Length (as pictured)
- 8.25 inches (5-inch barrel)
Height (as pictured)
- 5.25 inches (excluding magazine base pad)
Feed System
- 8+1 rounds, detachable single stack magazine
Body Color / Finish (as pictured)
- Silver hard chrome
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/15/2017 Page 2
Classification: Semi-automatic pistol, M1911
The UDMC 1911 Officer's Model Pistol in caliber .45 single stack with a 3.5-inch bull barrel, double action spring,
Laser Aim sights on the rubber grip, Bomar tritium rear sights, fiber optic front sights and an overall dark matte nickel
finish.
Operating System
- Recoil operated, closed breech, single action
Trigger / Action
- Fires one round each time the single action trigger is squeezed and the hammer is cocked by the action of the slide.
Cartridge/s
- .45 ACP, .40 S&W and 9mm, Super .38
Barrel Type/s
- Standard with barrel bushing, no ramp, AISI-416 stainless steel
- Bull barrel, no bushing, with ramp, AISI-416 stainless steel
Barrel Length
- 5 inches
Rifling & Grooves
- 1 x 16 twist rate, 6 grooves
Velocity
- Approximately 825 ft/sec (230 grains FMJ)
Energy
-483 J (356 ftlb)
Maximum Effective Range (MER)
- 100 yards depending on wind and drift, 5-inch barrel
Weight (as pictured, magazine empty)
- Approximately 1.2 kg
Length (as pictured)
- 8.25 inches (5-inch barrel)
Height (as pictured)
- 5.25 inches (excluding magazine base pad)
Feed System
- 8+1 rounds, detachable single stack magazine
Body Color / Finish (as pictured)
- Silver hard chrome
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/15/2017 Page 3
Classification: Assault Rifle (F-series), Commercial Sporting Rifle (S-series)
United Defense Mfg Corps F5-PVAR, S5-PVAR, F5-DGIS and S5-DGIS rifles are variants of the M4 and comes in two
types: The F-series are the full automatic for military, police and law enforcement use, and the S-series are the semi-
automatic for commercial, civilian and security agency use. These rifles are chambered in the time-tested 5.56 x 45mm
NATO round and designed to hit point targets at 500 meters (MER). The F5 and S5 series take after the M4 and M16 battle
rifle designed by Eugene Stoner. They use two different action designs, the Direct Gas Impingement System (DGIS). The
DGIS is the simpler design between the two as it has less parts and uses the hot gases coming from the gas port of the barrel
and through a gas tube the hot gases are rammed into the bolt carrier group to cycle the round. On the other hand, the
Pneumatic Valve and Rod (PVAR) gas-piston or simply the patented PVAR system. The PVAR or Pneumatic Valve and
Rod System is a bare bones, no frills and very simple designed gas and piston operating system that utilizes a combination
of gas and mechanical energy for a more effective and reliable cycling of the weapon. The PVAR design prevents hot and
high-pressured gases from reaching the bolt assembly and the chamber. This results in a cleaner and reliable operation, as
well as minimal maintenance even in the most rugged environments such as jungles, deserts, snow and salt-water
conditions. This means reduced cleaning time and overall longer rifle life span. The PVARs simplified parts and
mechanism allows reduced recoil and reduced muzzle rise, which enables the firer to refocus instantly on the target for
each and every round fired! The DGIS uses a lightweight thermoplastic handguard and the PVAR uses a one-piece
handguard with a military standard 1913 Pica tinny top rail held securely only at the barrel extension which allows the
barrel to float and reduce barrel vibration while in battery. This allows for greater accuracy and consistency. As designed,
the barrel does not touch any part of the entire length of the handguard except at the barrel extension. The barrel comes in
different lengths: 7.5, 10.5, 11.5, 14.5 and 20 inches.
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/15/2017 Page 4
Classification: Assault Rifle (F-series), Commercial Sporting Rifle (S-series)
Designed
- 2009 for the PVAR series
Manufacturer
- United Defense Mfg Corp, Philippines
Operating System
- PVAR gas and piston, rotating bolt head, Letters of Patent Nos. 1-2009-000176 and 1-2011-000062,
Philippines or the DGIS, rotating bolt head, conventional direct gas impingement system
Bolt Carrier
- Monolithic one piece with a solid punch key for the PVAR and two piece with gas key for the DGIS
Cartridge
- 5.56 x 45mm (NATO)
Barrel Type
- Non-Glare, matte stainless steel bull barrel, AISI-416 Premium or the black parkerized 4140
ordnance grade.
Barrel Length
- 14.5 inches
Rifling & Grooves
- 1 x 7, 1 x 8 or 1 x 9 twist
Muzzle Velocity
- Approximately 3,100 ft/sec (M855)
Maximum Effective Range
- 500 meters (point target) and 600 meters (area target)
Accuracy
- Maximum 1.0 Minute of Angle (MOA) using a match grade ammunition at 100 meters, at bench rest.
Trigger
- Single stage, with option for two-stage for semi-auto precision use.
Flash Hider
- Choice of SHURIKEN flash hider (Letter of Patent No. 1-2013-000230, Philippines) or any type of
tactical compensator or flash hider.
Weight
- 4.5 kg to 5.5 kg depending on barrel length for the PVAR. 3.5 kg to 4.5 kg for the DGIS as it uses a
thermoplastic handguard.
Length
- Depends on buttstock and barrel length
Rate of Fire
- Full-automatic (F-series) and Semi-automatic (S-series)
Feed System
- 30-round detachable magazine
Body Color
- Anodized black
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
Classification: Precision Rifle
The S7 rifle series take after the M110 battle rifle designed by Eugene Stoner. The S7 uses two action designs, the Direct Gas
Impingement System (DGIS) and the patented Pneumatic Valve and Rod System (PVAR). The DGIS has a simpler design between the
two as it has less parts and uses the hot gases coming from the gas port of the barrel and through a gas tube the hot gases are rammed
into the bolt carrier group to cycle the round. The PVAR or Pneumatic Valve and Rod System is a bare bones, no frills and very simple
designed gas and piston operating system that utilizes a combination of gas and mechanical energy for a more effective and reliable
cycling of the weapon. The PVAR design prevents hot and high-pressured gases from reaching the bolt assembly and the chamber. This
results in a cleaner and reliable operation, as well as minimal maintenance even in the most rugged environments such as jungles, deserts,
snow and salt-water conditions. This means reduced cleaning time and overall longer rifle life span. The S7-PVARs simplified parts
and mechanism allows reduced recoil and reduced muzzle rise, which enables the sniper to refocus instantly on the target for each and
every round fired! The PVAR uses a one-piece handguard with a military standard 1913 Pica tinny top rail held securely only at the
barrel extension which allows the barrel to float and preserve barrel harmonics while in battery. This allows for greater accuracy and
consistency. As designed, the barrel does not touch any part of the entire length of the handguard except at the barrel extension. For both
the DGIS and PVAR, the barrel comes in different lengths: 18, 20, 22, 24 and 25 inches. For special orders, UDMC can also produce the
M110-CSASS or the compact SASS with a retractable buttstock and sound suppressor with a barrel length of 14.5 inches. The non-
glare, matte finish of the stainless steel barrel is also an alternative to the standard chrome moly vanadium in black manganese finish.
The two-stage trigger is as crisp as it can be.
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 6
Classification: Precision Rifle
Designed:
- 2013 for the S7-PVAR
Manufacturer:
- United Defense Mfg Corp, Philippines
Operating System:
- PVAR gas and piston, rotating bolt head, Letters of Patent Nos. 1-2009-000176 and 1-2011-000062, Philippines or the DGIS,
conventional direct gas impingement system
Bolt Carrier:
- Monolithic one piece with a solid punch key for the PVAR and two piece with gas key for the DGIS
Cartridge:
- 7.62 x 51mm NATO
Barrel Type:
- Non-Glare, matte stainless steel bull barrel, AISI-416 Premium or the black parkerized 4150 ordnance grade.
Barrel Length:
- Choice of 14.5, 16, 18, 20, 22, 24 and 25 inches
Rifling:
- 1 x 12 twist or 1 x 10 twist
Muzzle Velocity:
- Approximately 2,600 ft/sec
Maximum Effective Range (20-inch barrel):
- 800 meters (point target) and 1,000 meters (area target)
Accuracy:
- Maximum 1.0 Minute of Angle (MOA) using a match grade ammunition at 100 meters, at bench rest.
Trigger:
- Two-stage match grade
Flash Hider:
- Choice of SHURIKEN flash hider (Letter of Patent No. 1-2013-000230, Philippines) or any type of tactical compensator.
Weight:
- Around 7.5 kg for the PVAR, inclusive of the floating Picatinny rail handguard, scope, bipod and a loaded 20-round
detachable box magazine. Weight will be less depending on barrel length and type of scope. 5.5 kg to 6.5 kg for the DGIS as it
uses a polymer handguard.
Length:
- 44 inches (22-inch barrel)
Rate of Fire:
- Semi-automatic or Bolt Action. (Note: However, when Made-to-Order, we can also produce the F7 battle rifle series which
is the full automatic version for use by the Spotter in tandem with the Sniper who uses the Semi-Automatic/ Bolt Action
version.)
Feed System:
- 10 or 20-round detachable magazine
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 7
MANAGEMENT, CONSULTING AND SUPPLY SERVICES
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 1
FlexForce Riot Control Suit
The #FX-1 FlexForce Modular Hard Shell Crowd Control System is the ultimate high-threat level
riot control, domestic disturbance, and cell extraction suit. The FlexForce design provides
substantial protection from blunt force trauma without sacrificing the fit or comfort. The suit is
lightweight and ranks highest in easy to put on or take off in a moments notice. The front and back
hard shell panels have a modular flex design allowing for all shapes and sizes to fit comfortably with
out sacrificing much needed mobility. The forearm guard offers a much more comfortable elbow
portion of the pad, which allows more flexibility. The knee/shin guard has a non-slip surface, which
keeps you planted in position.
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 2
Upper Body and Shoulder Protection
Hard shell front and back panels feature a unique Damascus 3-panel flex design for optimum
movement, fit and comfort
3mm Electrum XK8 hard shell front and back panels
Modular front and back panels are steel riveted together with Cordura nylon connector straps
which attach by Velcro
Shock absorbing Protium foam with a Polyester mesh covers the chest, back, shoulder and upper
arm
Electrum XK8 plate with shock absorbing Protium foam covers both top of shoulder and upper
arm
Polyester mesh lines the inside of the upper body and shoulder portion which offers comfort and
breathability for long term wear
Reflective Name Plate ID labels can be attached to the front panel for identification (sold separately)
Adjustable Straps fasten with durable nylon elastic and Velcro
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 3
Sizing
Each piece of the suit fastens and adjusts quickly with durable nylon straps, Velcro and quick
connect clips which allows each individual a custom fit
Available in sizes MD, LG, XLG, XXLG, XXXLG
Gear Bag
Total Dimensions 24"L x 19"W x 15" H
Interior Dimensions - 24"L x 15"W x 15" H
Two Velcro storage compartments in the front of the bag
Sides of the bag have envelope pouches
Removable padded shoulder strap
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 4
Extrication & Rescue Gloves w/ Hard Knuckles
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
Knee & Elbow Protection
Created by Damascus Gear, leaders in full body protective gear for law enforcement, military,
etc. The most comfortable hybrid knee pad ever built specifically for Law Enforcement or Military use
just so happens to offer some serious impact protection. They have a unique hybrid construction
which combines high and low density materials to deliver maximum "cush", while the contoured
ergonomic shape offers superior knee pad support. Part of the DKX-1s secret is its GEL and GEL
foam center cores which contain two types of shock-absorbing gels bonded together to create
unsurpassed comfort. The GEL also absorbs body weight and disperses it within the pad. One size
fits all. Sold as pair. Available colors include: Black, OD Green
Heavy-duty, hard-shell composite cap which is truly NON-SLIP and plants you firmly on any surface.
The GEL cores and the unique caps then work together to produce the best possible knee zone
protection from blunt force trauma.
Perforated breathable neoprene coated with silicon at the tops of the pads hug the leg above the knee.
1000 denier nylon Cordura braces and protects the rest of the knee area.
Both straps feature silicone coated strips to prevent pads from slipping in motion, and reinforced rivets.
The ergonomic design of the DKX-1 as a unit conforms to the knees like no other and produces superb
mobility. The pads have been extensively designed specifically for law enforcement and military to
produce the highest level of durability and extended knee pad life.
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 6
SWAT Hoods & Sleeves
NOMEX: Created by Damascus Protective Gear, leaders in full body protective gear for law
enforcement, military, and beyond. This Damascus hood (also sometimes called balaclavas) was
designed to provide heat and flame protection and comfort to the head and neck in SWAT and other
tactical situations. It is made entirely 100% DuPont NOMEX, a fire retardant material that will not
sustain a flame. These properties have made NOMEX a requirement or standard in many industries
such as firefighting, motorsports and industrial safety. It is ideal for heat and flash protection when
deploying flash bangs.
3 ounce 100% Nomex
Approximately 18 (45cm)
Made in North America
Size: One size fits all
Black
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 7
MANAGEMENT, CONSULTING AND SUPPLY SERVICES
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 1
906 TAC-ELITE RIOT HELMET WITH CLEAR FACE SHIELD
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 2
EXOTECH UPPER BODY & SHOULDER PROTECTION
Features:
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 3
EXOTECH ELBOW & FOREARM PROTECTOR
The EFP150 Elbow and Forearm Protector is designed to
work with the ExoTech System and features polyethylene
hard-shell protection against blunt force trauma. The interior
has EVA foam padding and polyurethane sponge padding for
comfort, and includes a mesh inner lining. The outer covering
is made of 420-denier nylon for durability and abrasion
resistance. It also features commercial-grade adjusters with
hook and loop fasteners. Available in three sizes: XS/S, M/L,
XL/XXL
Features:
Torso protection consists of durable EVA foam with 7mm sponge foam on the interior for comfort
Shoulder pad features hard-shell plastic plates with durable foam padding
The neck roll consists of 40mm high-density sponge foam
All padding is encased in black polyester mesh rigging. The interior is coated with polyester brushed
tricot for comfort
Adjustable shoulder straps, waist straps and contoured design allow a secure fit comfortable enough
for long-term wear
Will safely absorb blows delivered from blunt objects, but does not provide ballistic protection
Adjustable hook and loop closures and fasteners
Weighs approximately 2 lbs. (.9kg) and packaged in a nylon drawstring bag for convenient storage
Optional reflective POLICE, SHERIFF, or CORRECTIONS labels are available and can be affixed to
the front or rear of the system (see above)
Dimensions: 8.625" L x 3 W x .125 D (21.9cm x 7.6cm x .3cm)
Sizes S, M, L, XL, XL
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 4
EXOTECH HARD-SHELL SHIN GUARDS
The TS70 EXOTECH Hard-Shell Shin Guards feature built-in
knee pads and an upper knee stabilizing strap with protective
padding. Three hook and loop elastic straps on the backside of the
leg provide a secure fit. Three sizes.
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
MANAGEMENT, CONSULTING AND SUPPLY SERVICES
SECPRO
Anti-Riot Gear
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 1
SECPRO POLICE RIOT GLOVES
DESCRIPTION:
DESCRIPTION:
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 2
SECPRO POLICE RIOT HELMET
DESCRIPTION:
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 3
SECPRO POLICE RIOT SHIN GUARD
DESCRIPTION:
The effective and reliable SecPro Police Ultimate Anti-Riot Shin Guard is easily deployed
and or removed for riot control, cell extractions or other tactical situations. The SecPro
Police Ultimate Anti-Riot Shin Guard provides substantial protection from blunt force
trauma.
The contour molded outer shell features impact ridges that disperse the brunt of the
blows, while foam inner padding cushions the body. Soft brush and mesh line the inside
to reduce abrasion and provide long-term comfort.
The hard shell protectors are used for covering and protecting the waist and groin areas.
They are designed to withstand hard blow, and prevent penetration or stabbing by sharp
tools, anti-fire and anti-acidity. SecPro Ultimate Anti-Riot Shin Guard is currently deployed
and passes the rigorous standards of our most elite law enforcement agencies, for quality,
operational flexibility, protection area, energy absorbency, and flame resistance
performance.
Simplicity is the important factor. Each piece of the SecPro Police Ultimate Anti-Riot Shin
Guard fastens and deploys quickly with durable nylon straps and Velcro closures,
allowing a custom fit for a wide variety of body types.
Features:
EVA foam knee padding
Black polyester outer covering
Tricot and sponge knee/foot protector inner lining
Polyethylene knee and foot protector outer shell
PVC knee cap
PVC padded suspension braces
Polyester adjusters with hook and loop fasteners
Moisture-wicking fabric allows maximum comfort
Padded ankle protector
Foot protector fully adjustable/removable
Components securely riveted to outside shell with hook & loop fasteners
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 4
SECPRO POLICE RIOT VEST - SHOULDERS - ARMS
DESCRIPTION:
The effective and consistently reliable SecPro Police Ultimate Anti-Riot Vest is easily
deployed and or removed for riot control, cell extractions or other tactical situations. The
SecPro Police Ultimate Anti-Riot Vest provides substantial protection from blunt force
trauma.
The contour molded outer shell features impact ridges that disperse the brunt of the
blows, while foam inner padding cushions the body. Soft brush and mesh line the inside
to reduce abrasion and provide long-term
comfort.
The hard shell protectors are used for
covering and protecting the shoulder and
arm areas. They are designed to withstand
hard blow, and prevent penetration or
stabbing by sharp tools, anti-fire and anti-
acidity. SecPro Ultimate Anti-Riot Vest is
currently deployed and passes the
rigorous standards of our most elite law
enforcement agencies, for quality,
operational flexibility, protection area,
energy absorbency, and flame resistance
performance.
Simplicity is the important factor. Each
piece of the SecPro Police Ultimate Anti-
Riot Vest fastens and deploys quickly with
durable nylon straps and Velcro closures,
allowing a custom fit for a wide variety of
body types.
Features:
Polyethlyene outer shell
L2500 EVA foam &3mm polyethlyene plate chest/back/arm padding
Sponge foam & polyester tricot chest/back/shoulder lining
Mesh chest/back/shoulder outer covering
Mesh arm protector lining
Moisture-wicking fabric for comfort
Double-riveted polypropylene connector straps with hook & loop fasteners
Commercial-grade elastic adjustment straps with hook and loop fasteners
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
SECPRO POLICE RIOT WAIST GROIN PROTECTION
DESCRIPTION:
The effective and consistently reliable SecPro Police Ultimate Anti-Riot Suit is easily deployed
and or removed for riot control, cell extractions or other tactical situations. The SecPro Police
Ultimate Anti-Riot Suit provides substantial protection from blunt force trauma.
The contour molded outer shell features impact ridges that disperse the brunt of the blows, while
foam inner padding cushions the body. Soft brush and mesh line the inside to reduce abrasion
and provide long-term comfort.
The hard shell protectors are used for covering and protecting the waist and groin areas. They
are designed to withstand hard blow, and prevent penetration or stabbing by sharp tools, anti-fire
and anti-acidity. SecPro Ultimate Anti-Riot Suit is currently deployed and passes the rigorous
standards of our most elite law enforcement agencies, for quality, operational flexibility, protection
area, energy absorbency, and flame resistance performance.
Simplicity is the important factor. Each piece of the SecPro Police Ultimate Anti-Riot Suit fastens
and deploys quickly with durable nylon straps and Velcro closures, allowing a custom fit for a wide
variety of body types.
IMPORTANCE OF RIOT GEAR Quality riot gear is essential in many tactical situations, such as
cell extractions, riot control and other domestic disturbance situations. In military settings, this
gear is often worn by military police as well. The tactical riot suit offers maximum protection for
the suit wearer, but is also designed to offer protection for contact persons as well, minimizing
severe injuries that occur in these tactical situations. It provides officer protection in urban
environments, using intimidation instead of excessive physical force. When this gear is used in
tactical situations, it is designed to offer protection while doing little physical damage to others.
Without the presence of quality riot gear like the SecPro Riot Gear System, tactical teams are
susceptible to blunt force trauma, serious blows and even injury from blades. A riot suit, ensuring
that blades are stopped and wearers are protected from blunt force trauma, offers full waist and
groin protection. The gear also helps to disperse the brunt of blows taken, offering further
protection from injury. Quality systems also include inner padding that keeps the body cushioned,
using lining materials that offer long term comfort while helping to reduce the risk of abrasions.
Features:
THIGH SECTION
Polyethlene outer shell
Laminated EVA foam & L2500 EVA foam
Mesh inner lining
Elastic adjuster with hook and loop fasteners
GROIN SECTION
EVA foam padding with mesh outer covering
Inner Polyethylene shell
Commercial-grade elastic adjusters and connectors
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 6
SECPRO STUN TECH ANTI-RIOT SHIELD
DESCRIPTION:
Features
High voltage, non-lethal, safe yet effective shock conducted via securely fitted
conductors all over the front area of the shield. Visible shock sparks act as an added
deterrent.
Lightweight, 4mm Thick polycarbonate shield.
Guard in full control with press button operation situated in molded handle as well as
on/off indication L.E.D.
Fully rechargeable including nickel-cadmium rechargeable battery with AC/ DC charger
as well as L.E.D indicators.
Optional multi charging stand that holds and charge up to five shields simultaneously.
Sealed detachable electronic housing for easy maintenance.
Fully warranted in accordance with the Force Manufacturers warranty.
Unlike with use of firearms or Batons, no permanent damage or use of unnecessary
force.
SABS tested shock and SABS Tested and Approved Armour.
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 7
SECPRO CORRECTIONS RIOT SHIELD
DESCRIPTION:
Protect your vital areas with this strong, durable Lexan plastic Riot Shield.
DESCRIPTION:
Protect your vital areas with this strong, durable Lexan plastic Riot Shield.
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 8
MANAGEMENT, CONSULTING AND SUPPLY SERVICES
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 1
2100 Series Pistol Loading Machine
The Camdex 2100 Series Loading Machine is speed adjustable to 4400 cycles per hour. The 2100
series will stop for and indicate on the touch screen control if any of ten faults have occurred. The
2100 Series features a total redesign of the control and monitoring system to enhance operator use
and make fault correction fast and easy.
Monitoring Features
CASE LEVEL - Low case level in feed tube automatically shuts off machine.
CASE PROBE - Checks for case feeding, foreign particles and live rounds.
PRIMER POCKET PROBE - Mechanically checks the primer pocket for ringers.
PRIMER SLIDE - Shuts off the machine should a primer jam occur due to dirt or high
anvils.
PRIMER FEED - Shuts off machine should it run out of primers.
PRIMER LEVEL Fiber Optics automatically maintain approximately 60 primers in feed
system
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 2
POWDER PROBE - Checks for both high and low powder charges.
BULLET FAULT - If the machine fails to feed or runs out of bullets, the machine shuts
off.
VACUUM SYSTEM - Checks vacuum pressure to assure primer feeding.
CURRENT SENSOR - Any increase in preset amperage shuts off the machine.
The priming system is also monitored by a vacuum system, which will shut the machine off
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 3
should the machine run out of
primers. The vacuum system is
monitored by the Smart Panel,
which informs the operator of the
location of any of the monitored
faults.
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 4
THE LOADING PROCESS
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
2300 Series Large Rifle Loading Machine
Large Rifle Caliber Loader for 300 WIN MAG to 50 BMG. Camdex PLC control panel with
variable speed motor. Automatic case and bullet feeders. Sequence of machine functions.
Automatic case and bullet feeders
Case Presence
Fiber Optic Primer Detection
Case Neck Rounding
Case neck OD size - carbide
Large Size Powder Canister
Powder drop accuracy +/-
0.15 grains
Adjustable belling
Powder probe
Automatic bullet feeding and
seating single drop
mechanism
Secondary bullet seating
Adjustable crimp
Bullet presence
Fiber Optic Cartridge
Counter at Exit
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 6
Case Sorting Machine
Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 7
0$1$*(0(17&2168/7,1*$1'6833/<6(59,&(6
Overview
Airframes
AVENGER
RDASS
System Elements
Autopilot
Cameras
Communications
Forensic Overview
Forensic - Equipment
Fully Mobility : All operations systems are integrated into Trooper Vehicles
including Helicopters, Video and Battery Equipment
Response Time : Ability to be In the Air in under 5 minutes
Ease : Quick Release Batteries, Cameras, and gimbals for all situations
Training : 5 Day Rapid Training, or 1 2 week safety and operation training
Property UHWP
HSE-UAV
Capabilities
*Please Note: weather, payload and other variables will alter flight times; your flight times will vary
Ground Control Station Create, edit & save GPS flight
plans including auto-launch, headings, altitude, timed-hovers, no-fly-
zones & more. Switch between GS & handheld controller during flight
and incorporate additional map layers. RDASS HP: extreme Tough
Book and military-grade software with available Target Tracking.
0$1$*(0(17&2168/7,1*$1'6833/<6(59,&(6
8QPDQQHG$LUFUDIW6\VWHP
'521(
8VHRUGLVFORVXUHRIGDWDFRQWDLQHGRQWKLVVKHHWLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDORUTXRWDWLRQ
7 3DJH
Unmanned Aircraft System
DRONE
Fixed Wing
A new standard in accuracy, robustness and performance for photogrammetric aerial mapping
allowing you to focus on important issues and make better, and faster decisions.
iiNteractive
t ti Monitoring
it i and
d Operation
O ti Center
C t | Universal
i l Visual
i l Communication | Unified Communication & Collaboration | Automation | CAAS | Professional Service
High Precision Mapping and Surveying Solution
Our Value Unmanned Aircraft System (UAS) is an easy to use, fully
automated, high precision system capable of capturing
Proposition aerial photography with resolutions down to 1 cm.
Featuring Aerial Imaging field software and Business
High-performance UAS GNSS receiver with Center office software, this complete system provides an
P PK tec hn o logy intuitive workflow that allows you to quickly create the
highest quality orthomosaics and 3D models for
36MP, full-frame, h ig h resol uti on applications such as survey grade mapping, coastal areas
ca me ra and power line monitoring, field leveling, site and route
planning, progress monitoring and asset mapping, and
Orthomosaics r es ol utio n do wn to 1 disaster assessment.
cm & 3D models with up to 1,000 pts/m2
Superior Image Acquisition and Accuracy
Survey quality accuracy w ith ou t g rou nd The UAS delivers precise data by integrating a high-
co nt ro l performance GNSS receiver and a superior camera. Post-
Processed Kinematic (PPK) GNSS technology is used to
Ful ly aut om at ed U A S A ccess establish very accurate image locations in absolute
w orkf lo ws for ease of-use and safe coordinate systems, eliminating the need for ground
operation control. As a result, less time is spent in the field and high
precision results can be achieved even in the most
S im ple dat a proce ssi ng with UAS inaccessible areas. With PPK, georeferencing aerial data is
Business Center photogrammetry module more robust and accurate providing a superior level of
reliability and accuracy. Use either your own base station
A dv an ced d ata p ro cessin g with or work with data from reference stations to georeference
UASMaster your deliverables with the highest accuracy possible.
Ideal for S urve yin g, C on struc tio n, The UAS features an industry-leading 36 MP full-frame
A gric ult ure, Min in g, D isa ster sensor camera capable of capturing sharp, high resolution
Mo ni torin g a nd R el ie f, images. The camera achieves a leading level of image
Co ns erv ati on , En gi neering, Forestry resolutionorthomosaics down to 1 cm GSD and point
clouds up to several thousands points per square meter.
an d G ov ern m en t G eo gra ph ic
Ma ppin g
Configure for the Job during flight, and perform flight simulations to
No one project is ever the same that is why you can confirm the plan. The export functionality gathers all
select a camera and lens combination that match your required data into a single file that can be imported
project needs. You have the flexibility to choose into UAS Business Center.
between a near infrared or RGB sensor system, and a
selection of lenses. The lenses include a 35 mm lens
for high accuracy, a 15 mm wide angle lens for Valuable Photogrammetry Deliverables
increased flight coverage or a 25 mm lens delivering Optimized to process data from the UAS, the Business
both accuracy and increased flight coverage. Center Photogrammetry Module creates impressive
deliverables. With a single drag- and-drop, imported
GNSS information, base station or reference station
Trusted Performance data, and onboard images are processed in Business
Center to produce a scaled orthophoto, point clouds,
Triangulated Irregular Network (TIN) models and
contour maps of the area flown. These can then be
used in planning a project, calculating volumes,
excavation planning, drainage planning, disaster or
property damages and many other functions.
HARDWARE
Type Fixed Wing
Weight.2.9 kg (6.4 lb)
Wing Span ..1m(3.3ft)
Wing Area 34dm2
Dimensions ..100cmx65cmX10.5cm(39.4inx25.6inx4.1in)
Materials ..EPP foam; Carbon frame structure; Composite
elements
Propulsion Electric pusher propeller; brushless 1400 W
Battery 14.8V,6600mAh
Camera 36MP Mirrorless Full Frame
GNSS Receiver.. L1/L2 GNSS (GPS, Glonass, Beidou, Galileo)
Controller..UAS Tablet Rugged PC
Solution Applications
o Executive and Command o Surveillance of Coastal or Regions
o Emergency and Disaster o Forestry Manning
Preparedness o Monitoring Reserve Parks &
o Lives and Property Monitoring Protected Areas
o Evacuation and Relief Monitoring o Dam and Utility Grid Monitoring
o Determining the Effect of o Monitoring Illegal Mining Activity
Catastrophy o Border Surveillance
o Search and Rescue o Anti-Piracy Operations
o Surveillance and Monitoring o Geographical Mapping
o Tactical Operations o Multi-Function & Multi-Applications
o Mission Planning o Aerial HD Photography
o Field Operations & Investigations o Aerial HD Video Recording
o Intel Analysis
PERFORMANCE SPECIFICATIONS
Maximized image footprint without compromising OPERATION
resolution, obtained with a custom wide-angle lens Unmanned Aircraft System
and APSC-type sensor. Endurance,........................................................ 40minutes
Maximized coverage per flight and per hour due to Range....................................................................52km(32mi)
large image footprint, sharp turning capability and Cruise Speed.............................................. ..85kph(53mph)
high cruise speed. Maximum Ceiling ......................................5000m(16,404ft)
Reversed thrust technology for a short and steep Pre-Flight System Setup Time..............5minutes T ake off
landing circuit. Type ................................................Catapultlaunch
Powerful propulsion system for steep climbs and high Angle........................................30 Degrees Landing
altitude flights. Type ................................................ .Bellylanding
High airframe service life due to wing robustness and Angle........................................................14 Degrees
maintainability. Landing space (L x W)3
Short setup time with automated procedures in UAS Typical..20 m x 6 m (66 ft x 20 ft)
Access field software. Recommended..50 m x 30 m (164 ft x 98 ft)
Self-check and failsafe procedures for safe operation. Weather limit.55 km/h (34 mph) and Light Rain
One-button export to UAS Business Center to create Communication & Control Frequency...........2.4GHz(FHSS)
deliverables. Communication & Control Range .........Up to 5km(3.10mi)
Optimized data accuracy when processed with UAS
Business Center. ACQUISITION PERFORMANCE
High Precision GNSS receiver to georeference Resolution(GSD) ...........................1cmto25cm(0.4into9.9in)
deliverables accurately and easily. Height above Take-off location (AGL).. 75 m to 750 m
(246 ft to 2,460 ft)
SOFTWARE Absolute Accuracy XYZ(no ground control points).
U AS Acces s Ae ria l Im agi ng appl icat ion Down to 25cm (0.8 2 in)
Project management Relative Orthomosaic/3D Model Accuracy . (1-2x/1-5xGSD)
Mission planning with option for multiple flights
Automated pre-flight checks
Automatic takeoff, flight and landing
Autonomous camera triggering
Automated fail-safe routines
User controlled fail-safe commands
Automated data consistency checks
Export to UAS Business Center
+
Technology Platform for Proactive
Monitoring and Control
iNteractive Monitoring Operation and Control Center | Universal Visual Communication | Unified Communication & Collaboration | Automation| CAAS | Professional Service
Unmanned Aircraft System
DRONE
Hover
iiNteractive
t ti Monitoring
it i and
d Operation
O ti Center
C t | Universal
i l Visual
i l Communication | Unified Communication & Collaboration | Automation | CAAS | Professional Service
Everything You Need for Aerial Data Capture
Multirotor is built to execute tough, everyday jobs quickly,
even in tight spaces. It requires no launcher, is easy to
assemble and includes everything you need to capture
high quality georeferenced photos for applications such as
aerial mapping, inspections and investigation.
FEATURES SPECIFICATIONS
Man packable, compact folding design
Setup in 60 seconds, airborne in 2.5 minutes
Whisper quiet, rugged, all-weather capability
Configurable Failsafe behaviors
Operation via handcontroller and/or full Virtual
Cockpit GCS
Hot-swappable payload options
Industry-leading image stabilization
CONTROLLER FEATURES
For small UAS; fixed wing and VTOL
Stand-alone, untethered operation
OPERATION
Analog or digital link options
E nd urance: 40 min (w/ 200g payload)
Supports synchronized metadata stream
Payload: Multiple, hot-swappable payloads
Onboard video recording and stills to SD card
R ange: 2km line-of-sight, 5km+ with external patch
Small ergonomic design with large outdoor
antennas
readable touchscreen
W eight : 4.85lbs (2,220g) with payload
Wi-Fi link to laptop and video dissemination
Dime nsions (LxWxH)::
Op en: 32x32x7 inches
Ruggedized and weather resistant
Fol ded: 12x9x6 inches Lightweight: 3.5 lb
Ope rating A ltitude : 10-500ft AGL (typical) Long run time (4 hours)
GCS touchscreen handcontroller or laptop-based
Virtual Cockpit
+
Technology Platform for Proactive
Monitoring and Control
iNteractive Monitoring Operation and Control Center | Universal Visual Communication | Unified Communication & Collaboration | Automation| CAAS | Professional Service