CAREER GUIDE

Northwestern Career Advancement

For undergraduate and graduate students

201416

a
NORTHWESTERN CAREER ADVANCEMENT (NCA)
Make good use of this guide, but dont let it take the place of coming to see us.
Main Office: 620 Lincoln Street, Evanston campus
Express Advising Center: Main Library, Core second floor

Phone 847-491-3700
Email nca@northwestern.edu
Web www.northwestern.edu/careers

b
Dear Northwestern student,
CONTENTS
The entire staff of the newly renamed Northwestern Career Advancement office is 2 Career planning
pleased to present you with the 201416 Career Guide. We hope that this guide will 5 Networking
give you the tools needed to successfully prepare 9 Rsums
for life after Northwestern. Wherever you are in your 22 Cover letters
career development, youll find information within these 26 Interviewing
pages that will help you learn more about yourself, set 32 Finding job/internship
career goals, construct rsums and cover letters, opportunities
secure internship and full-time job opportunities, and,
if desired, pursue graduate school admission.
While the guide covers a wide range of career-
related topics, keep in mind that it represents only a
fraction of our staffs knowledge and expertise. It is
intended to supplement in-person meetings. I strongly
encourage you to meet with a career counselor or your
school-based adviser as early as your first year to explore your interests and find a
suitable career path.
There are a number of people and organizations Id like to thank for making this
career guide possible, including the corporate sponsors who generously provided
financial support to create and print it: Accenture, ALDI, Sodexo, AQR Capital
Management, Deloitte, Grosvenor Capital Management, PwC, Strategy&, Goldman
Sachs, L. E. K. Consulting, and Visa. We value their partnership and appreciate the
many opportunities they bring to our students every year. Im also grateful for the
countless hours guide editor-in-chief Christina Siders and her team, Maggie Heffernan
and Rachel Taylor, devoted to selecting, writing, and editing the content. This resource
would not exist without Christinas leadership and the hard work of our entire staff.
Finally, University Relations deserves praise for bringing our content to life with a
beautiful professional design.
I hope youll refer to this guide often, and I welcome you to visit our office and
attend the many events and programs we host throughout the year. We are here to
help you every step of the way as you advance your career.

Sincerely,

Mark Presnell
NCA Executive Director

1
 01. CAREER PLANNING

Career planning is a continuous
process, a series of decisions you will
make throughout your life. The four
main stages of the Career Development
Model shown in the diagram on this
pageassess, explore, decide, and act,
with time to reflect at each stageare
meant to be continuous throughout
your career, not performed only once.
The four-year plan (next two pages) created by
NCA organizes your career planning while in college
by revisiting the four stages during each of your under-
graduate years. It will help you to translate your aca-
demic and cocurricular experiences into professional
skills and opportunities. Make sure that you work
with your NCA adviser to adapt the plan to your goals
and needs. Not every item will apply to your unique
situation.
Long-term career planning can be daunting, but if
you devote time each year to your career development,
your opportunities will be immense and your goals
will be attainable.
Even though each persons experience is unique,
the following key points apply to everyone:
Start early. Planning ahead opens up the widest
range of opportunities and gives you time to change
your mind along the way.
Reflect on your skills, values, interests, and strengths
before making any decision.
Dont be afraid to change your path. No career
decision is irreversible.

CAREER DEVELOPMENT MODEL

ASSESS
Analyze your interests, EXPLORE
values, and skills to identify Research and investigate
career fields, work environ- a range of career
ments, lifestyles, and job options that are of
functions that you want interest to you.
to explore.

reflect

ACT DECIDE
Obtain hands-on experi- Evaluate your options
ence through internships, and narrow your
full-time and part-time selections to the few that
positions, and campus or are the best matches
volunteer activities. for you.

2

First year
ASSESS
 Identify how your interests, values, and skills align with
career options by taking a career assessment, such as the
Myers-Briggs Type Indicator or Strong Interest Inventory.
EXPLORE
 Get involved in one or two student or service organizations
to explore your interests.
 Take diverse coursework and talk with different academic
departments to explore various majors, minors, and
certificates.
 Research two or three potential careers and industries
through WetFeet, Vault, and the Occupational Outlook
Handbook.
DECIDE
 Meet with your career adviser to create a career plan for
your first and second years.
 Narrow down summer opportunities (research, study
abroad, internships, part-time jobs, volunteer work).
ACT
 Convert your high school rsum into a professional
document and upload it to CareerCat.
 Create a LinkedIn profile and build your network by
requesting connections with personal and academic
contacts.
 Speak with people you know who have careers of interest.
 Pursue summer opportunities with targeted rsums and
cover letters.
01. CAREER PLANNING
Sophomore year
ASSESS
 Meet with an NCA career counselor to clarify your career
interests.
 Think about what you can offer to employers (strengths,
skills, experiences) and begin to develop a career narrative
and professional introduction.
EXPLORE
 Use LinkedIn and Our Northwestern to view profiles of
alumni who studied your major or work in an industry of
interest.
 Conduct one or two informational interviews each quarter
with personal contacts, Northwestern alumni, or industry
experts.
 Increase your leadership experience in student organiza-
tions by chairing a committee, initiating a project, or running
for office.
 Explore options for summer jobs and internships with your
NCA career adviser.
DECIDE
 Decide on summer opportunities to pursue.
 Narrow down and decide on academic major(s), minor(s),
and certificate program(s); meet with University Academic
Advising if you are considering an interschool transfer.
ACT
 Update your rsum in CareerCat, incorporating first- and
second-year experiences.
 Update your LinkedIn profile and connect with new
contacts.
 Participate in career fairs to pursue internship opportunities.
 Apply for summer experiential learning opportunities using
targeted rsums and cover letters.
 If considering graduate school, get to know two professors
to increase your chances of getting strong letters of
recommendation.
3
01. CAREER PLANNING
Junior year
ASSESS
 Reflect on what youve learned from each internship, job,
and student involvement experience.
 Identify your skills and values by doing a Motivated Skills
or Values Card Sort with an NCA career counselor.
EXPLORE
 Research employers of interest using WetFeet, Vault,
Hoovers, LinkedIn, and company websites.
 Evaluate summer internship options with your NCA
career adviser.
DECIDE
 Select a summer opportunity that will provide relevant
experience and skill development for your desired career.
 Identify two or three industries to consider for full-time
postgraduate employment and learn their recruiting
timelines.
ACT
 Continue to network with Northwestern alumni using the
LinkedIn alumni tool.
 Contact the Office of Fellowships for information about
career-related fellowships.
 Develop a polished professional introduction to engage
employers and alumni during networking events.
 Target employers and industries of interest at career fairs.
 Practice your interviewing skills by participating in a mock
interview with your career adviser.
4
Senior year
ASSESS
 Reflect on how your values and interests might determine
your choice of a work setting.
 If you dont have a clear career focus yet, meet with an
NCA career counselor to discuss your options.
EXPLORE
 Research employers of interest using WetFeet, Vault,
Hoovers, LinkedIn, and company websites.
 Expand your knowledge of job opportunities, examine
work settings, and prepare for interviewing by networking
at employer information sessions, coffee chats, career
fairs, etc.
DECIDE
 Select two or three industries to pursue for full-time
employment and learn about and implement the best
search techniques for them.
 If you are interested in highly competitive graduate pro-
grams or fields, develop a postgraduation backup plan.
 Accept offers for full-time employment or graduate school.
ACT
 Tailor your rsum toward industries and employers youre
considering.
 If applicable, begin preparation for graduate school
by taking admissions tests in the fall and preparing your
application.
 Attend career fairs to make full-time employment connec-
tions with specific employers.
 Apply for full-time positions as early as possible and tailor
cover letters to each company and position.
 Follow up with employer contacts from past career fairs,
information sessions, and informational interviews.
 Strengthen your interviewing skills by participating in a
mock interview with your career adviser.
 Identify references and request permission to use them
in applications for employment or graduate programs.
02. NETWORKING
Speaking with people in your field
of interest to explore career options
and gather information is known as
networking. It is about initiating,
developing, and maintaining profes-
sional connections and relationships.
As you engage in career exploration
and professional development, net-
working will be a robust tool for com-
piling information and understanding
how to market yourself to potential
employers. It is the most effective way
to meet leaders and keep abreast of
major changes in a field.
Networking can take place in
any environmentfrom a train ride
to a professional conferenceand
may range from informal dialogues
to structured exchanges. You may
arrange networking meetings, the
most common of which is an infor-
mational interview. Often the first step
in building a professional network,
informational interviewing provides
an opportunity to have a qualitative
exchange one-on-one with a contact.
Unlike in a traditional interview, you
are responsible for directing the con-
versation and asking the questions.
These interviews are particularly
useful when you have little aware-
ness about a career field and limited
work experience or are considering
a career transition. The goal is to
transition your informational interview
contacts into job search advocates who might advance
your application for a position or identify opportunities
not posted online.
It is important to approach networking with the
genuine intention of learning and connecting, not
simply obtaining a position. Your networking contact
should be a source of information that you cannot
find elsewhere. Be prepared for each networking
experience by researching the industry and the com-
pany, reviewing your experiences, and being able to
articulate your career interests and skills. Youll then
approach each exchange with greater confidence,
have more memorable dialogues, and leave a positive
impression. Your questions should show genuine
interest and solicit information that can facilitate a
well-informed career decision. Inquire about your
contacts career story and experiences in the field
and industry. Ask for advice about how to prepare
for a career in the field, relevant courses to take, and
activities that will make you more marketable, as well
as for support for your internship and job searches.
Continued
5
02. NETWORKING
?
DEVELOPING QUESTIONS FOR
AN INFORMATIONAL INTERVIEW
These questions will start you thinking,
but you should tailor your questions to
the specific person and industry.
What is your background? What
was your career path?
What are the major responsibilities
of your position?
If there is such a thing as an average
week, what is it like for you?
What are the positive and negative
aspects of working in this field?
What type of person usually suc-
ceeds in this field/organization?
What do you see as the hot issues
in this field?
What trends do you see affecting
career opportunities?
How can I become a more competi-
tive candidate for this industry?
What steps would you recommend
I take to prepare to enter this field?
How are hiring decisions made?
What professional associations do
you recommend I join?
Can you recommend anyone else
for me to contact?
6
Continued from previous page
Once you understand the value of networking for your career exploration and
professional development, how do you start building and engaging a network?
STEP 1: IDENTIFY CONTACTS AND OPPORTUNITIES
Your list of contacts may include a broad range of people, both inside and out-
side your chosen field. Personal referrals are people in your current network,
such as friends, family, neighbors, coworkers, and professors. You might expand
this network by asking for names of people they know who are employed in
relevant careers. Direct contacts are people you identify through professional
organizations, employer-hosted events, and social networking websites.
Events such as conferences, workshops, panels, and information sessions
also provide opportunities for networking. They happen throughout the year
at a variety of venues, both on campus and off. You could find yourself sur-
rounded by many people with similar career interests and get great insight from
the person seated next to you. Make sure you follow the appropriate protocol
for participation in an event and, if necessary, make travel arrangements. If
payment is required, look for a discounted rate for students.
STEP 2: INITIATE THE CONNECTION
The way you initiate contact will depend on how well you know the person. A
phone call may be appropriate for someone you speak with regularly, an email
for contacts with whom you are less familiar. If you are approaching someone to
whom you were referred, start by introducing yourself and saying how you were
referred. Then say why you are reaching out and what you hope to learn, such
as information about his or her position, career field, and career story. Be direct
in requesting 20 to 30 minutes for an exchange. A face-to-face meeting at the
employment site is ideal, but if thats not possible, another location or the use
of Skype or the telephone may be arranged.
Give your prospective contact two weeks to reply, and then send a follow-
up email if you have not heard back. If your second attempt is unsuccessful,
move on to other contacts who may be more receptive.
STEP 3: PREPARE FOR THE NETWORKING MEETING
You need to be prepared to both ask engaging questions and respond to ques-
tions. Using the many resources available, research the persons industry and
its job categories. Research will result in more targeted questions and more
detailed responses. If you are attending a networking event, conduct research
on the presenters and their backgrounds.
 02. NETWORKING

SAMPLE PROFESSIONAL
INTRODUCTIONS

Knowing what information or advice you are seeking is essential in maximiz- Hello, my name is Monica Lee. I am
ing your time with contacts. Develop a list of 10 to 15 relevant questions. The a senior in communication studies
type of questions you ask may be perceived as an indicator of your preparation, at Northwestern. This past quarter, I
professionalism, and industry knowledge. interned at a sports analytics company,
It is important to be comfortable articulating your skills, values, and career focusing on translating data into social
interests. Consider how your experiences and activities have influenced your media communications. I was excited
career interests and plan how you will communicate this. Prepare a professional to see you were attending the career
introductiona 30-second summary including your full name (if the person fair and was hoping you could share
doesnt already know you); year in school and major; relevant skills, strengths, more about how data intersect with
and experience; and an engaging question so that youll be ready to present communications, both internally and
your experiences in networking situations. See two sample professional intro- externally, at your firm.
ductions at the right.
Hello, my name is Walter Golden.
STEP 4: CONDUCT THE NETWORKING MEETING I will be earning a masters degree
in counseling psychology from
Regardless of the venue of your networking conversation, dress appropriately.
Northwestern University this June.
Arrive early for face-to-face encounters. Begin with your professional introduc-
A highlight of my program has been
tion. You want to make a positive impression and launch a conversation. With
serving as a counselor to at-risk inner-
the goal of being genuine, consider the other person, the details that are relevant
city students in group and individual
to share, and the value and purpose of your inquiry. A brief introduction sounds
settings. After listening to you on this
more genuine than a long one and allows the conversation to start sooner.
panel, I was hoping you could share
Let the dialogue progress naturally. Dont feel compelled to ask every ques-
more details about what prepared

tion on your list, and keep within the specified timeframe. At the end, express
you to be effective in your role as a
appreciation for your contacts time and contribution to your learning and inquire
residential therapist.
about staying connected.

STEP 5: FOLLOW UP
NORTHWESTERNS
Within 48 hours send a personal thank-you note highlighting the value of the OPPORTUNITIES FOR NETWORKING
meeting and mentioning any suggestion or referral the contact provided that
was helpful. Sending a thank-you note opens the door to further exchanges. These are the most common organized
Because one exchange does not build a relationship, you need to consider venues that Northwestern provides for
ways to maintain the connection. A log with each contact name, date, outcome, career-related networking:
and important notes is helpful. Aim to connect with contacts each quarter. Career fairs
Consider mailing seasonal greeting cards, sending email messages, forwarding Employer information sessions
interesting industry news and journal articles, and inviting them to occasional Industry panels
coffee breaks. Conferences
Employer site visits
Guest speakers
Externship programs
Alumni events and resources

7
02. NETWORKING
SOCIAL MEDIA AND JOB/INTERNSHIP SEARCHES
Whether it means building relationships with prospective
employers and career mentors on LinkedIn, tweeting indus-
try knowledge, or showcasing your work on a professional
website, establishing a professional online presence is a
crucial part of the job and internship search today. No
matter where you are in your career development, you can
forge a professional path for yourself on social media using
one or more of these online services.
LINKEDIN
As the worlds largest professional network, LinkedIn helps
you connect with experts in your field, build industry knowl-
edge, and showcase your skills and experience.
Your LinkedIn checklist:
Choose a professional profile photo.
Customize your public profile URL using your name or
an abbreviated version of it. (Your username should be
consistent across all social media channels, if possible.)
Revise your profile regularly, as you do your rsum.
Join groups relevant to your industry of interest.
Follow company pages and locate Northwestern alumni.
Search for jobs or internships by industry, job
function, or location.
Use proper etiquette. Dont contact people you do not
know without a connection or introduction.
TWITTER
A microblogging service, Twitter allows you to communi-
cate short messages (tweets) of 140 characters or less, follow
updates from companies and influencers, and build your
own following.
8
Your Twitter checklist:
Complete a Twitter profile by adding a professional
photo, a 160-character bio introducing you and your
career interests, and a link to your professional website
or LinkedIn profile.
Follow others who can help your professional develop-
ment, such as companies of interest and industry experts.
Search for career opportunities and relevant infor-
mation using hashtags such as #intern, #career, and
#tweetmyjobs.
Brand yourself as an expert by tweeting or retweeting
industry news.
Share your work through photos, videos, and links to
portfolios and blog posts.
Keep all tweets professional and appropriate.
BEYOND LINKEDIN AND TWITTER
Like or add companies of interest or industry experts on
Facebook and Google+.
Develop a blog using WordPress or Tumblr to respond to
news of your industry.
If youre in the arts, upload samples of your work on
Flickr and Issuu or share videos youve created or a video
rsum on YouTube.
Display work samples or your rsum on Pinterest,
where you can also pin items that reflect your industry
and career interests.
Follow Northwestern Career Advancement on Twitter,
Facebook, LinkedIn, and other social media sites (a com-
plete list is on the NCA website) to learn about career tips
and news, program and event listings, job opportunities,
and industry trends.
03. RSUMS
An overview of your education, experi-
ences, and skills, your rsum is used to
market what you offer potential employers
by demonstrating your strengths and skills
and how you would apply them to deliver
value and outcomes.
ACTION VERB + TASKS + RESULTS
Heres an example of how a student described
her work as a server at the Main Street Caf:
Awarded Employee of the Month recogni-
tion based on customer feedback and super-
visory staff reviews.
Trained 15 new hires on restaurant policies,
customer service skills, and problem-solving
techniques.
Created and implemented a comprehensive
marketing plan that resulted in a 30 percent
increase in business from the Northwestern
community.
Managed point-of-sale operations and
addressed customer concerns and inquiries
to ensure superior customer service.
Before writing a rsum, review job descrip-
tions in your area of career interest to find out the
skills sought. This will provide a frame of reference
and help you align your skills with those employ-
ers want. In general, an undergraduate rsum
should be kept to one page in length, though there
may be exceptions in certain industries.
Often the most difficult part of developing a
rsum is learning how to articulate your experi-
ences to impress employers. Every experience,
no matter how trivial it might seem to you, can
develop skills that can transfer to other settings.
To identify and adequately describe your skills,
make a list of each experience, whether a volunteer
position, a full-time job, an internship, or a role in
a student organization. Picture what you did on a
typical day during a busy week, selecting three to
five words from the power verbs list on the next
page to convey the skills you employed that day.
For each verb, expand your statement by asking
yourself who, what, when, why, and how. Whenever
possible, quantify your impact on the customers,
process, or organization. What difference did your
work make? What were your accomplishments?
Continued
9
03. RSUMS

Continued from previous page
Once youve given thought to identifying and describing
what you can offer, you can organize your rsum using some
of the categories below. You may choose to vary this typical
sequence to suit your unique experiences. Many examples of
effective rsums are shown on the following pages.
1 Contact information contains your full name, permanent
and/or school address, telephone number, and email
address, usually in boldface, larger type. Include only one
phone number and one email address. Do not include
personal information such as Social Security number,
physical traits, race, ethnicity, or citizenship.
2 The education section includes your institutions name,
location, degree type, anticipated graduation date,
major(s), minor(s), and GPA. If you have more than one
degree, place the highest or most recent degree first.
Listing relevant coursework and academic honors and
awards is optional.
employed. For each experience, include three to five
bullet-point statements about how you applied your skills
and affected a task or project.
4 A leadership section is increasingly important to
recruiters of undergraduates. Include organization name,
positions you held with dates, projects, significant con-
tributions, and skills and abilities demonstrated. This
section is usually formatted similarly to the experience
section, with bullet points.
5 The activities and community involvement section
showcases your contribution to the on-campus and
off-campus communities, usually organized in a list
format. Include position(s) held, organization name,
and dates for each experience.
6 Honors/awards can be a stand-alone section or
included in their respective categories. For each, include
the name of the honor/award and the date granted. A
brief description is optional.

3 The experience section(s) aligns your experience with
desired opportunities. It may include full-time, part-time,
and summer employment; student teaching; internships;
practicums; academic research; and volunteer work.
Choose headings for the various categories that best
market your experiences. List experiences in reverse
chronological order, providing the company/organization
name and location and your position title and dates
7 Skills is often the final category on a rsum, reiterating
your qualifications or showcasing additional relevant
skills. Language and computer proficiency and training
certifications are among the skills typically listed.
8 Interests is an optional section. Many employers appre-
ciate getting to know you a little better beyond your
formal training and experiences. If you choose to list
interests, be specific, authentic, and appropriate.

BUILDING BETTER BULLETS WITH POWER VERBS

Bullet points should be used in the experience and leadership expedited maximized reported
sections of your rsum and any other section where you can facilitated motivated represented
demonstrate skills that can be transferred to a job. Each bulleted formulated navigated researched
statement should start with a power verb. Be results oriented. fostered negotiated resolved
Ask yourself who, what, when, why, and how to describewith generated operated reviewed
quantification, if possiblethe work performed, your contribu- guided organized revised
tions, and the outcomes. The following are power verbs, and handled oversaw scheduled
your unique experiences may suggest others: identified performed secured
illustrated planned served
accomplished completed developed implemented prepared specialized
achieved conducted directed improved presented strengthened
administered consulted drafted initiated processed supervised
advised contributed encouraged inspected produced supported
analyzed coordinated enhanced integrated provided taught
arranged corresponded established invented published trained
assessed created evaluated investigated recorded validated
collaborated designed examined maintained regulated verified
communicated determined expanded managed repaired wrote

10
 03. RSUMS

1 MADELINE WENDLE 66 Emerson St | Evanston, IL 60201

m-wendle@northwestern.edu | (812) 555-7164
EDUCATION
Northwestern University Evanston, IL; Expected June 2014
2 Bachelor of Arts in Economics and International Studies | Minor: Arabic
Cumulative GPA: 3.73/4.00 | Deans List: 5 of 6 quarters
Relevant Courses: Econometrics, International Finance, Human Rights & Foreign Policy

RELEVANT EXPERIENCE
US State Department Critical Language Arabic Immersion Program, Participant Salalah, Oman; June - August 2013
Studied Arabic through immersion and intensive coursework, including 4 hours of daily formal instruction
Mentored by Omani student at Dhofar University; practiced speaking for 1 hours a day
Introduced to local customs and religion; traveled throughout Oman
Received highest grade in class of 34 students
3
Cook County Juvenile Courts Public Defenders Office, Legal Intern Chicago, IL; June August 2012
Researched topics pertaining to juvenile law to become better aware of relevant cases
Interviewed clients prior to trial and obtained valid information for cases
Docketed files and cross-referenced data to the proper cases for future reference
Created Excel spreadsheets to classify and report information to Public Defenders
Responded to client inquires, fielded calls, and maintained database of 350 contacts

LEADERSHIP EXPERIENCE
Pi Beta Phi Sorority, Vice President of Finance Northwestern University; 2011 Present
Managed finances for 100+ person organization using Quickbooks software, both accounts payable and receivable
Served as the liaison between the chapter and House Corporation; oversee the House Manager
Researched and created $65,000 budget, including alternative means of funds investment
4 Reevaluated and revised budget, leading to a 20% reduction in dues, the largest in Chapter history

Model Arab League, Member Northwestern University; 2011 Present

Served as liaison between Northwestern University league and other regional universities to strengthen
collaboration and ensure strategic goals alignment
Represented Saudi Arabia on Palestinian Affairs Council in regional conference in Oxford, Ohio in February 2011 to
simulate Arab League debate and problem-solving

ACTIVITIES
5 Analytics Team Member, Institute for Student Business Education (ISBE)
Sponsorship Committee, Dance Marathon
January 2012 - Present
September 2013 May 2014
Tutor, Northwestern University Athletic Department September 2012 - Present

HONORS
Gamma Sigma Alpha Honors Society: Greek life juniors and seniors with a GPA of 3.5 or higher
6

Alpha Lambda Delta Honors Society: Freshman students with GPA of 3.5 or higher & in top 20% of class
Pi Beta Phi Core Values Award: Integrity: Illinois Epsilon Chapter, voted by peers to epitomize integrity
Published in The True Body Project anthology; City Beat newspaper; Queen City Forum magazine; and Mic & Mia
website; featured in Cincinnati 20/20 Arts Festival and the Women Writing for Change radio show on WVXU (91.7)

LANGUAGE SKILLS
7 Modern Standard Arabic: professional working proficiency
Egyptian Arabic dialect: conversational
Spanish: professional working proficiency

8 INTERESTS: Waterskiing, Historical Fiction Novels, Jazz Performances

11
03. RSUMS

Frank Thompson

 
Campus Address: Permanent Address:
       
       

EDUCATION
Northwestern University
  Psychology 


3.77/4.00
Honors:  
Relevant Coursework

LEADERSHIP EXPERIENCE
Northwestern University Office of Admissions, 
Tour Guide, 
x 
x 
HIGH SCHOOL experiences
Wildcat Welcome, 
may be included if they are Peer Advisor, 
relevant or convey unique x 
x 
skill sets. They usually are 
x 
removed after the second
year of college. North Canton High School Swim Team,
Captain, 
x 
x 
x  

FRANCESWORK EXPERIENCE
HARPER
Bridgeview Day Camp, 
1500 Chicago Avenue, Apartment 5C, Evanston, IL 60201Lifeguard and Swim

(630) 555-7473 Instructor,

francisharper2017@northwestern.edu
x 
EDUCATION Northwestern University, Evanston, IL x 
x 
Bachelor of Music in Flute Performance, Bachelor of Arts in French; Expected June 2017
Minor in Arts Administration
GPA: 3.89/4.00 Paddington Family Restaurant,  
Host, 
RELEVANT Alumni Relations and Development, Northwestern University, Evanston, IL
x 
EXPERIENCE Clerical Aide, Fall 2012-Present x 
Enhance office productivity by completingx extensive donor mailings, data entry, and prospect research

Edit 800 handwritten thank-you notes for quarterly Thank-a-Thon program and Thank-a-Donor Week
Generate reports and lists, uploadedAContact Reports
CTIVITIES and Mass Updates to CATracks, analyzed data for
Parent and Family Giving and DirectParticipant,
Mail teams 
Organize CATracks IDs, student andVolunteer, 

parent names, 
and sports into a contact information spreadsheet
for Athletics programs
The Atlanta Opera, Atlanta, GA SKILLS
Arts Administration Intern, Summer 2014Computer: 
Language: 
Drafted press releases for each of the Operas 3 mainstage performances for the 2014-2015 season
Utilized Tessitura to complete ticket exchanges and create call lists
Identify and research prospective group sales patrons, resulting in a 10% increase in group sales
Auditorium Theatre of Roosevelt University (ATRU), Chicago, IL
Development Intern, Fall 2013
Oversaw annual Devils Ball and Gala events for 500+ attendees each; created auction signs, proofread
materials, wrote thank-you letters to 45 sponsors and donors, completed day-of event tasks
Researched membership programs at 15 similar venues and organizations
Developed new program proposal for ATRU and presented ideas to Board of Directors
South Arts, Atlanta, GA
Performing Arts Exchange Intern, Summer 2012
Utilized event-planning skills to execute PAE conference of 800 attendees
Managed PAE division of YouTube Channel: uploaded videos and exhibitor updates
Effectively communicated with agents and contractors to answer questions and arrange for services

SELECTED Northwestern University Chamber Orchestra, Evanston, IL This DUAL-DEGREE

PERFORMANCES Fall 2012-Present
Northwestern University Bienen School of Music Student Recital, Evanston, IL
student highlights selected
Spring 2013 and Spring 2014 performances, in addition
Atlanta Flute Club Senior High School Honors Flute Choir, Atlanta, GA
Winter 2010, Winter 2011, and Winter 2012
to leadership experiences,
LEADERSHIP Zeta Tau Alpha, Northwestern University, Evanston, IL to demonstrate unique
EXPERIENCE Sisterhood Chair, Winter 2014-Present
Plan, coordinate, and execute bi-weekly events for 120 chapter members based upon member input and
experience in and passion
expressed need, increasing participation by 20%
Develop and implement new curriculum and ideas for big-little sister program to encourage
for MUSIC.
development of new chapter members
Bienen School of Music Student Advisory Board, Evanston, IL
Member, Fall 2013-Present
Selected by Bienen School of Music faculty to represent 85 members of the Class of 2016
Create community within the Bienen School of Music by promoting communication between students,
faculty, and University administration
Collaborate with 11 students to initiate meaningful conversations among Bienen students regarding
needs, expectations, and desired learning opportunities and present outcomes to faculty each quarter

SKILLS Computer: Proficient in Microsoft Office, Constant Contact, Tessitura

Language: Fluent in French

12
 03. RSUMS

TEJAN COUNT
29 Brookstone Way, Evanston, IL 60201 847.555.2929 count@u.northwestern.edu

EDUCATION
Northwestern University: Weinberg College of Arts and Sciences, Evanston, IL
Bachelor of Arts Degree, June 2015
Major: English Concentration: Literary Criticism and Theory
Certification: Undergraduate Leadership Program GPA: 3.62/4.00
RELEVANT COURSES: Interpreting Culture, Language in the Text, History of the Literary Criticism, Contemporary Theory,
Language and Culture, Modern Rhetorical Theory, Psycholinguistics, and Phenomenology

ACADEMIC PROJECT
Modern Rhetorical Theory: Effective Communication in Business Project Fall 2014
x Critically analyzed contemporary theory of management and its direct effects on 3 consulting firms
x Interviewed 7 Business Analyst Managers to understand the flow of communication
x Provided recommendations to improve communication practices, leading to a 32% increase in work productivity at 1 firm
x Performed extensive research on each consulting firms mission, projects, and obstacles INTERNATIONAL
INTERNATIONAL EXPERIENCE
EXPERIENCE, such as
Study Abroad Participant, Universidad de Buenos Aires, Buenos Aires, Argentina Summer 2014 study abroad, presents
x Analyzed local government and policies surrounding education and contrasted findings against U.S. policies
x Interacted with native residents, including Patagonian grasslands inhabitants: Gauchos
an opportunity to acquire
x Gained exposure to the endangered and extinct languages of Argentina marketable skills for a
x Developed fluency in Spanish language during 2-month experience by living with a Spanish-speaking host family
variety of industries and
LEADERSHIP EXPERIENCE
Vice President, Minority Business Association, Evanston, IL
positions.
Fall 2012-Present
x Support President in operations of student-run group focused on minority students interested in business
x Increase student membership by 70% during tenure as Marketing Advocate (Fall 2011-Spring 2012)
x Foster healthy working relationships with student-run groups, administrators, faculty, and alumni
x Facilitate bimonthly meetings to ensure efficiency and to create an equal learning forum for all members 0HHUD*DQHVK
x Research and analyze current organizational plans and propose new mission-specific direction
)RVWHU$YH8QLW(YDQVWRQ,/PJ#XQRUWKZHVWHUQHGX

Nominated Participant, Undergraduate Leadership Program, Evanston, IL
('8&$7,21 Spring 2011
x Acquired and improved leadership skills and experience through1RUWKZHVWHUQ8QLYHUVLW\(YDQVWRQ,/
a 4-course certificate program        ([SHFWHG-XQH
x %DFKHORURI$UWVLQ(FRQRPLFV.HOORJJ8QGHUJUDGXDWH&HUWLILFDWHLQ0DQDJHULDO$QDO\WLFV
Participated in leadership challenges designed to help identify and build strengths and weaknesses
x *3$ 6$7:ULWLQJ9HUEDO0DWK
Received personal coaching sessions to identify and sharpen personal leadership style
5HOHYDQW&RXUVHZRUN(FRQRPHWULFV3ULQFLSOHVRI)LQDQFH&RUSRUDWH)LQDQFH
x Directed team problem solving assignments designed to simulate  a business work-group environment
6WXG\$EURDG8QLYHUVLGDGHGR6XOGH6DQWD&DWDULQD%UD]LO8QGHUJUDGXDWH/DQJXDJH*UDQW-XQH$XJ

WORK EXPERIENCE :25.(;3(5,(1&(
Sales Associate, Foot Locker, Chicago, IL Fall 2013-Present
(UQVW <RXQJ&RPPHUFLDO$GYLVRU\6HUYLFHV        1HZ<RUN1<
x Utilize interpersonal and customer service skills to enhance customer shopping experiences
6XPPHU$VVRFLDWH         -XQH$XJ
x Consistently exceeded monthly sales targets by at least 40% x $VVHVVHGJURZWKRSSRUWXQLWLHVRIUHOHYDQWUHWDLOJURFHU\IRUPDWVE\FRQGXFWLQJSULPDU\DQGVHFRQGDU\UHVHDUFKWRGHWHUPLQH
x Research newly released products to aid in sales approach to customers
H[WHUQDOPDUNHWGULYHUVDQGIRUHFDVWHGJURZWK
x
&RQGXFWHGDVWUDWHJLFDVVHVVPHQWRIH[LVWLQJVWRUHIRUPDWVE\DQDO\]LQJNH\SHUIRUPDQFHDQGILQDQFLDOPHWULFVIRUHDFKHQWLW\
ACTIVITIES ZLWKLQDFOLHQWVEXVLQHVVDOORZLQJFOLHQWWRSULRULWL]HVWUDWHJLFJURZWKRSWLRQVDOLJQHGZLWKPDUNHWWUHQGV
Omega Psi Phi Fraternity, Inc. x
0RGHOHGSRWHQWLDOJURZWKVFHQDULRVE\V\QWKHVL]LQJUHVHDUFKILQGLQJVDQGHYDOXDWLQJWKHVWUDWHJLFILQDQFLDODQGFDSLWDOVWUXFWXUH
Winter 2012-Present LPSOLFDWLRQVWRKHOSPDQDJHPHQWDFKLHYHGHVLUHGPDUNHWSRVLWLRQE\
Undergraduate Black Management Association )LUVW&KLFDJR$GYLVRUV,QF  
Winter 
2011-Spring  2011      &KLFDJR,/
,QYHVWPHQW%DQNLQJ,QWHUQ         6HSW'HF
SKILLS x (QJDJHGLQDVHOOVLGHWUDQVDFWLRQVWDUWLQJDWWKHHDUOLHVWVWDJHDQGFRQGXFWHGSRWHQWLDOEX\HUVFUHHQLQJFRQWULEXWLQJWRVXFFHVVIXO
LANGUAGE: Fluent in Spanish GHDORULJLQDWLRQZLWKDPDMRUIRRGFRPSDQ\
TECHNICAL: Proficient in Microsoft Package: Word, Excel, Publisher, & PowerPoint
x &RPSOHWHGILUVWSKDVHRIGXHGLOLJHQFHRQGRPHVWLFIRRGLQGXVWU\DQGGHWDLOHGWKHFKDUDFWHULVWLFVRISRWHQWLDOEX\HUV
x &RPSLOHGFRPSDQ\SURILOHVIRUSRWHQWLDOVWUDWHJLFEX\HUVDGGUHVVLQJUHFHQWGHYHORSPHQWVILQDQFLDOYLDELOLW\FRUHVWUDWHJLHVDQG
SRWHQWLDOV\QHUJLHV
:DOJUHHQ&R            'HHUILHOG,/
0DUNHW6WUDWHJ\,QWHUQ          -XQ$XJ
x $VVHVVHGWKHLPSDFWRISDVWSKDUPDF\VFULSWV5;DFTXLVLWLRQVRQ:DOJUHHQVVWRUHVQRQ5;VDOHVDOORZLQJ:DOJUHHQVWR
DFFRXQWIRUWKHDYHUDJHDGGHGEHQHILWRQUHYHQXHZKHQVHWWLQJIXWXUHELGVIRUEX\RXWWDUJHWV
x 3HUIRUPHGGXHGLOLJHQFHRQLQGLYLGXDOVLWHVDQGWUDQVDFWLRQVE\FRQGXFWLQJLQWHUYLHZVZLWKPDUNHWPDQDJHUVUHYLHZLQJ
HVWDEOLVKHGVLWHDQDO\VHVDQGSDUWLFLSDWLQJLQZHHNO\0DUNHW6WUDWHJ\WHDPVVLWHUHYLHZV
x ,GHQWLILHGNH\GULYHUVIRUQRQ5;VDOHVLQFUHDVHE\XWLOL]LQJ*,6DQGPXOWLYDULDEOHUHJUHVVLRQDQDO\VLVLQRUGHUWRLPSURYH
DFFXUDF\LQHVWLPDWLQJSRWHQWLDOVDOHVEHQHILWIRUIXWXUHDFTXLVLWLRQV
/($'(56+,3(;3(5,(1&(
$VVRFLDWHG6WXGHQW*RYHUQPHQW         (YDQVWRQ,/
$FFRXQW([HFXWLYH6WXGHQW$FWLYLWLHV)LQDQFH%RDUG      6HSW3UHVHQW
x $OORFDWHGPLOOLRQWRVWXGHQWJURXSVXVLQJTXDOLWDWLYHDQGTXDQWLWDWLYHGDWD
x 2YHUVDZWKHPDQDJHPHQWRIVXSSOHPHQWDODQGFRQWLQJHQF\IXQGV
x &RQVXOWHGZLWKGHVLJQDWHGJURXSVWRDGYLVHDQGRYHUVHHWKHLUILQDQFHVDQGVHUYHGDVDGYRFDWHLQVHQDWHIXQGLQJSURFHGXUHV
&DPSXV6ROXWLRQV6WRUDJH 6KLSSLQJ,QF        (YDQVWRQ,/
QUANTIFY your 6HQLRU6WUDWHJ\ 2SHUDWLRQV0DQDJHU       2FW6HSW
x 0DQDJHGDQGFRRUGLQDWHGDOODVSHFWVRIDVWXGHQWUXQVWRUDJHDQGVKLSSLQJFRPSDQ\ZLWKRYHULQUHYHQXH
accomplishments and x 2UJDQL]HGDWHDPWRHIILFLHQWO\SLFNXSVWRUHDQGGHOLYHUWKHLWHPVRIVWXGHQWVUHVXOWLQJLQDIDVWHUFRPSOHWLRQUDWH
x 'HYHORSHGDQGH[HFXWHGDWKUHHSURQJHGPDUNHWLQJVWUDWHJ\FUHDWLQJDLQFUHDVHLQRUJDQLFUHDFKDQGD[LQFUHDVHLQ
include the results of HQJDJHG)DFHERRNXVHUV
specic projects, when ,QWHUQDWLRQDO6WXGLHV5HVLGHQWLDO&ROOHJH 
3UHVLGHQW    












(YDQVWRQ,/
0DUFK0DUFK
possible. x $GPLQLVWHUHGEXGJHWRIIRUVRFLDODQGDFDGHPLFDFWLYLWLHVWKDWEHQHILWHGUHVLGHQWVDQGHQKDQFHGWKHLUOLYLQJE\
OHDUQLQJH[SHULHQFH
x ,QLWLDWHGWKHFUHDWLRQDQGLPSOHPHQWDWLRQRIDFRPSUHKHQVLYHDQGLQGLYLGXDOL]HGKDQGERRNIRUDOORIILFHUV
x 7UDFNHGLQGLYLGXDOH[HFXWLYHERDUGPHPEHUVSHUIRUPDQFHDQGSURYLGHGIHHGEDFNDQGOHDGHUVKLSRSSRUWXQLWLHVEH\RQGWKH
5HVLGHQWLDO&ROOHJHVFRQWULEXWLQJWRWKHG\QDPLFWHDPHQYLURQPHQW
6.,//6
&RPSXWHU64/567$7$4OLN9LHZ%ORRPEHUJ'DWDVWUHDP:5'6$03/+70/&&66DOHVIRUFH([FHO:RUG3RZHUSRLQW
/DQJXDJHV+LQGLIOXHQW3RUWXJXHVHIOXHQW

13
03. RSUMS

SIENNA PATEL
x x 

EDUCATION
Northwestern University, 
 
Yale Summer Conservatory for Actors,  
Highlighting specic plays,
PRODUCTION EXPERIENCE
as well as names of the Northwestern University, 
  The Freshman Musicale  
directors, shows experience   The History Boys   
and knowledge to potential   I Love You Because   
Raleigh Ensemble Players Theatre Company, 
THEATER employers.   The Last Days of Judas Iscariot 
 
  Eukiah 
 
The North Carolina Dance Institute,    
  NCDI Summer Showcase  

PERFORMANCE EXPERIENCE
Northwestern U. Danceworks     
Dog Sees God    
  
Into The Woods    
 
Gods Country    
 
Bat Boy     

WORK EXPERIENCE
Carousel Productions,  
Intern,  



North Carolina Dance Institute, 
Substitute Dance Teacher, Front Desk Staff,  
JOAN GOODMAN

j-goodman18@northwestern.edu

 
(319) 555-7452
Current Address: 
Permanent Address:
1234 Ashland Avenue, Apt. 1N 
1234 Dewitt Street
Evanston, IL 60202 Temple Beth Or, Cedar Rapids, IA 50662
Assistant Music Teacher 
 
EDUCATION

Northwestern University, Evanston, IL
Robert McCormick School of Engineering and Applied Science
HONORS June 2015
Bachelor of Science in &KHPLFDO(QJLQHHULQJ,
Cary Academy Excellence in Drama Award, 
Cumulative GPA: 3.46/4.00
Johnnetta Camile Overton Scholarship 

5HOHYDQW&RXUVHV: Engineering Analysis, Thermodynamics, Fluid Mechanics, Heat and Mass
Transfer, Kinetics and Reactor Engineering,
SKILLS Chemical Product Design
Technical: 
&2856(  'HVLJQ7KLQNLQJDQG&RPPXQLFDWLRQ&RXUVH
Computer: 
PROJECTS  &OLHQW3URFWHUDQG*DPEOH3DPSHUV'LYLVLRQ&LQFLQQDWL2+)DOO 
x 'HVLJQHGDQGSURWRW\SHGRGRUHOLPLQDWLRQV\VWHPIRUGLDSHUGLVSRVDO
x /HGWHDPGXULQJFOLHQWPHHWLQJVDQGGHVLJQUHYLHZVZLWKIDFXOW\
x :URWHILQDOUHSRUWDQGSUHVHQWHGSURMHFWWRWKHFOLHQWDWGHVLJQIDLU
&OLHQW7KH5HKDELOLWDWLRQ,QVWLWXWHRI&KLFDJR&KLFDJR,/:LQWHU  
x 'HYHORSHGDJHDUVKLIWLQJV\VWHPIRUELF\FOHULGHUVZLWKWKHXVHRIRQO\RQHKDQG
x ,QFRUSRUDWHGIHHGEDFNIURPFOLHQWWHVWLQJDQGSURIHVVLRQDOHQJLQHHUVWRLPSURYHGHVLJQ
x &ROODERUDWHGZLWKWHDPRIWRGHVLJQVROXWLRQLQZHHNWLPHIUDPH
x $ZDUGHGFRPPXQLFDWLRQVSUL]HIRUILQDOSURMHFWSUHVHQWDWLRQ

EXPERIENCE ABC Corporation, Chicago, IL

&RRSHUDWLYH(QJLQHHULQJ(GXFDWLRQ6WXGHQW December 2013 Present COURSE PROJECTS are a
x Optimize corrosion inhibition on steel while minimizing raw material costs in an
experiment using D.o.E. Fusion software
great way to demonstrate
x Design a new piping configuration for more efficient draining of reactors in the technical, managerial, and
production facility
x Resolve customer problems related to product use by design modification and enhanced teamwork skills.
user documentation
x Evaluate experimental raw materials for improvement of product performance (e.g.,
corrosion protection, wetting, toxicity, foam inhibition, formability) and product cost
x Generate data for the sales team for use in making product recommendations
x Analyze finished goods and raw materials for quality control

Lab Tech Research and Services,Bloomingdale, IL

,QWHUQ June 2012 August 2012
x Developed a company profile database of top 100 biotechnology and pharmaceutical
companies to support industry-based benchmarking initiatives
x Documented experimental findings for multiple research teams and presented trends to
leadership team to inform future decisions

SKILLS /DERUDWRU\ Experienced in metal formability testing, bioluminescence toxicity assay,

automatic titration, and other standard laboratory tests; familiar with Design of Experiments
and FTIR
&RPSXWHU Experienced in MATLAB programming, HYSYS process simulation, and D.o.E.
Fusion statistical software; proficient with Microsoft Word, Excel, PowerPoint, and
Windows Vista/7/XP
/DQJXDJH Conversant in Spanish

14
 03. RSUMS

:(1'</(9,1(
&KLFDJR$YHQXH(YDQVWRQ,/
ZHQG\OHYLQH#XQRUWKZHVWHUQHGX

('8&$7,21
1RUWKZHVWHUQ8QLYHUVLW\(YDQVWRQ,/-XQH
%DFKHORURI$UWVLQ0DWKHPDWLFDO0HWKRGVLQWKH6RFLDO6FLHQFHVDQG(FRQRPLFV0LQRULQ0DWKHPDWLFV
.HOORJJ&HUWLILFDWH3URJUDPIRU8QGHUJUDGXDWHVLQ0DQDJHULDO$QDO\WLFV
*3$_'HDQV/LVWRITXDUWHUV
5HOHYDQW&RXUVHV2SHUDWLRQVDQG6XSSO\&KDLQ6WUDWHJ\&RUSRUDWH)LQDQFH(FRQRPHWULFV&RQVXPHU$QDO\WLFV
'HWHUPLQLVWLF0RGHOVDQG2SWLPL]DWLRQ&RPSHWLWLYH6WUDWHJ\DQG,QGXVWULDO6WUXFWXUH

5(/(9$17(;3(5,(1&(
%DWHV:KLWH//&:DVKLQJWRQ'&
Signify the importance
6XPPHU&RQVXOWDQW-XQH$XJXVW
3URFHVVHGDQGDQDO\]HGRYHUPLOOLRQ0HGLFDLGFODLPVGDWDDQGVDOHVGDWDE\DODUJHJHQHULFGUXJFRPSDQ\XVLQJ67$7$
and scope of your work
6XPPDUL]HGGDWDDQDO\VLVUHVXOWVIRUWHDPPHHWLQJVDQGFOLHQWFDOOVXVLQJ3RZHU3RLQWDQG([FHO
5HFRPPHQGHGQHJRWLDWLRQVWUDWHJLHVWKDWFDQOHDGWRRYHUPLOOLRQSRWHQWLDOVDYLQJVIRUWKHFOLHQWLQDWHDPRI
by providing SPECIFIC
5HVHDUFKHGDFDGHPLFDUWLFOHVDQDO\VWUHSRUWVDQGGDWDEDVHVFUHDWHGPXOWLSOHFKDUWVDQGGUDIWHGRYHUZRUGVIRUZKLWHSDSHU
RQHFRQRPLFFRQVLGHUDWLRQVRISODVPDGRQDWLRQ
numbers, percentages,

&DPSXV&$7$/<67(YDQVWRQ,/
and monetary values,
6WXGHQW&RQVXOWDQW $SULO-XQH
&ROODERUDWHGZLWKWHDPPDWHVWRGHYHORSDQGSUHVHQWDOXPQLUHODWLRQVDQGPDUNHWLQJVWUDWHJLHVIRU5DLQERZVIRU$OO if applicable.
&KLOGUHQDQLQWHUQDWLRQDOQRQSURILWRUJDQL]DWLRQZLWKRYHUDQQXDOEHQHILFLDULHV
&RQGXFWHGEHQFKPDUNLQJDQDO\VLVE\LQWHUYLHZLQJFRPSDUDEOHRUJDQL]DWLRQV
'HVLJQHGGLJLWDOVWDNHKROGHUIHHGEDFNIRUPVWRLPSURYHFRPPXQLFDWLRQDQGJDLQTXDQWLWDWLYHPHDVXUHPHQWVRISURJUDPLPSDFW

1RUWKZHVWHUQ8QLYHUVLW\6FKRRORI&RPPXQLFDWLRQ(YDQVWRQ,/
5HVHDUFK$VVLVWDQW 6HSWHPEHU$SULO
&RQGXFWHGOLWHUDWXUHUHYLHZDQGFRGHGTXDOLWDWLYHILHOGVLQWRTXDQWLWDWLYHYDULDEOHVIRURYHU&KLQHVH1*2V
5HYLVHGDQGGLVWULEXWHGVXUYH\WRRYHUQRQSURILWRUJDQL]DWLRQVLQGLIIHUHQWFRQWLQHQWV
&RQVWUXFWHGRYHULQWHUYLHZTXHVWLRQVIRU&(2VDQGSURMHFWPDQDJHUVRIQRQSURILWVLQ&KLFDJR

:KHUH5DLQERZV0HHW7UDLQLQJDQG'HYHORSPHQW)RXQGDWLRQ&DSH7RZQ6RXWK$IULFD
%XVLQHVV)DFLOLWDWRUDQG&RQVXOWDQW-XQH$XJXVW
(VWDEOLVKHGRQOLQHSURILOHIRUORFDOVHZLQJSURGXFWVLQFOXGLQJSKRWRVDQGRYHUZRUGVRIGHVFULSWLRQ
)RUPHGSDUWQHUVKLSZLWKVHZLQJSURGXFWUHWDLOHUVDQGLQFUHDVHGPRQWKO\UHYHQXHRIWKHSURMHFWE\
$QDO\]HGORFDOHQWUHSUHQHXUVEXVLQHVVSODQVDQGEDODQFHVKHHWVSURYLGHGWDLORUHGEXVLQHVVVWUDWHJ\UHFRPPHQGDWLRQV
     
/($'(56+,3(;3(5,(1&(
5K\WKP'DQFH7URXSH   (YDQVWRQ,/
6HFUHWDU\)HEUXDU\3UHVHQW
0DQDJHGGD\WRGD\LQWHUJURXSFRPPXQLFDWLRQVDQGIDFLOLWDWHGSHUVRQDOL]HGRXWUHDFKWRPHPEHUV
&KRUHRJUDSKHG&KLQHVHHWKQLFGDQFHWULRDQGFRRUGLQDWHGUHKHDUVDOVRYHUDWLPHVSDQRIPRQWKV
&RRSHUDWHGZLWKPRUHWKDQGDQFHUVDQGSODQQHG$QQXDO6SULQJ6KRZZLWKDQDXGLHQFHVL]HRIRYHU
(QKDQFHGZHHNO\QHZVOHWWHUFRQWHQWFRQWULEXWLQJWRLQFUHDVHLQHYHQWSDUWLFLSDWLRQUDWH

$VLDQ3DFLILF$PHULFDQ&RDOLWLRQ(YDQVWRQ,/
3URJUDPPLQJ&KDLU0DUFK0DUFK
/HGZHHNO\PHHWLQJVZLWK-XQLRU([HFXWLYHPHPEHUVDQGPRQWKO\JHQHUDOPHHWLQJVZLWKRYHUPHPEHUVWR
DGGUHVVLPSRUWDQWLVVXHVZLWKLQWKH$VLDQ$PHULFDQFRPPXQLW\
5HGHILQHG([HFXWLYH%RDUGPHPEHUUHVSRQVLELOLWLHVDQGUHVWUXFWXUHGPHHWLQJVLQFUHDVLQJPHHWLQJHIILFLHQF\E\RYHU
([FKDQJHGSURJUDPPLQJLGHDVDQGGHYHORSHGSURJUDPPLQJSDUWQHUVKLSVZLWKOHDGHUVRIVLPLODUJURXSVRQFDPSXVDQGLQ&KLFDJR

$&7,9,7,(6
'HOWD*DPPD)UDWHUQLW\-DQXDU\3UHVHQW
$,(6(&7UHDVXUHU)HEUXDU\0DUFK

6.,//6$1',17(5(676 
&RPSXWHU3URILFLHQWLQ([FHO3RZHU3RLQW:RUGDQG6WDWD
/DQJXDJH)OXHQWLQ6SDQLVK
,QWHUHVWV5RFNFOLPELQJYLVLWLQJPXVHXPVFRRNLQJ)UHQFKIRRG

Qualications and
experience in the
area of interest are
highlighted by noting
specic PUBLICATIONS.

15
03. RSUMS

/HWLFLD'RPLQJR
/HWLFLDGRPLQJR#JPDLOFRP

&DPSXV$GGUHVV        3HUPDQHQW$GGUHVV
2UULQJWRQ$YH(YDQVWRQ,/       *HQRD&W%RXOGHU&2
  

(GXFDWLRQ              
1RUWKZHVWHUQ8QLYHUVLW\(YDQVWRQ,/        $QWLFLSDWHG-XQH
%DFKHORURI6FLHQFHLQ(GXFDWLRQDQG6RFLDO3ROLF\6RFLDO3ROLF\&RQFHQWUDWLRQ0LQRULQ3V\FKRORJ\
&XPXODWLYH*3$0DMRU*3$


:RUN([SHULHQFH             
Experience in NONPROFIT 3URMHFW0DQDJHU,QWHUQ%5LF.//&&KLFDJR,/     
x $GYLVHGWKH$WWRUQH\*HQHUDORQKRZWRDZDUGDIIRUGDEOHKRXVLQJJUDQWVIRUUHFLSLHQWV
  6XPPHU

SETTINGS communicates x &ROODERUDWHGZLWKDWHDPRIWRSODQDFRQIHUHQFHRQVXEXUEDQSRYHUW\IRUPXOWLSOH&KLFDJRRUJDQL]DWLRQV

x &UHDWHGUHFRPPHQGDWLRQVIRUKRXVLQJSROLF\LQLWLDWLYHVLQ.DQVDV&LW\0LVVRXUL
awareness of social ,QWHUQDW2IILFHRI([WHUQDO$IIDLUV1RUWKZHVWHUQ8QLYHUVLW\6HWWOHPHQW+RXVH    :LQWHU
x 6HUYHGIRRGDWWKHIRRGSDQWU\RQFHDZHHNWRRYHUFOLHQWVDQGYROXQWHHUHGLQD+HDG6WDUWFODVVURRPWZLFHDPRQWK
issues, initiative in x 'HVLJQHGDQGFUHDWHGWKHFRQWHQWIRUWKHYROXQWHHUVHFWLRQRIWKHRUJDQL]DWLRQVQHZZHEVLWHZZZQXVKRUJ
x 3XEOLVKHGQHZVOHWWHUVIRUGRQRUVDQG%RDUGPHPEHUV
causes, and contributions ,QWHUQDW&HQWHUIRU)RUFHG0LJUDWLRQ6WXGLHV1RUWKZHVWHUQ8QLYHUVLW\    )DOO6SULQJ
x &RQGXFWHGOLWHUDWXUHUHYLHZVRQWKHUHODWLRQVKLSEHWZHHQKHDOWKLQIRUPDWLRQWHFKQRORJLHVDQGORZOLWHUDF\SRSXODWLRQV
to your community. x :URWHPHPRVRQWKH8QLWHG1DWLRQV5HIXJHH$JHQF\V'LDORJXHRIUHIXJHHVSURWHFWLRQFKDOOHQJHV
x &ROODERUDWHGZLWKFHQWUDODGPLQLVWUDWLRQWRGHYHORSDFURZGVRXUFHPDSRIWKHOLYLQJFRQGLWLRQVRIUHIXJHHVDFURVVWKHZRUOG
,QWHUQDW,OOLQRLV$OOLDQFHWR3UHYHQW2EHVLW\,OOLQRLV3XEOLF+HDOWK,QVWLWXWH    6XPPHU
x 3XEOLVKHGSROLF\EULHIVWRVWDNHKROGHUVRQLVVXHVFHQWUDOWRWKHREHVLW\SUREOHP
x 'UDIWHGDQGVHQWOHWWHUVWRVWDWHJRYHUQPHQWUHSUHVHQWDWLYHVWRHQFRXUDJHREHVLW\SUHYHQWLRQOHJLVODWLRQ
x &RQGXFWHGUHVHDUFKDQGFUHDWHGDQHZVOHWWHURQWKHEHQHILWVRIEUHDVWIHHGLQJFLUFXODWHGWRRUJDQL]DWLRQV
x 3UHVHQWHGWRKHDOWKDGYRFDF\JURXSVRQWKHFRQVHTXHQFHVRIVXJDUORDGHGGULQNV

/HDGHUVKLS([SHULHQFH            
&R'LUHFWRU*OREDO+HDOWK8&R&KDLU'D\RI:RUOG6RFLDO-XVWLFH&KDLU*OREH0HG(YDQVWRQ,/:LQWHU3UHVHQW
x )DFLOLWDWHDPLQXWHZHHNO\OHFWXUHRQDJOREDOKHDOWKLVVXHWRDJURXSRIVWXGHQWV
x 3ODQDFWLYLWLHVDQGHYHQWVWKDWFUHDWHDZDUHQHVVRIJOREDOKHDOWKLQHTXLW\
x 0DQDJHGPHHWLQJVHDFKZHHNLQRUGHUWRPDLQWDLQRUGHUDQGSURGXFWLYLW\LQWKHJURXS
7UHDVXUHU6WXGHQW$GYLVRU\%RDUG6KHLO&DWKROLF&HQWHU(YDQVWRQ,/:LQWHU3UHVHQW
x &UHDWHDQGPRQLWRUEXGJHWIRUVWXGHQWDFWLYLWLHVDQGRUJDQL]DWLRQV
William Carter x 0DQDJH6KHLO6WXGHQW2UJDQL]DWLRQ)LQDQFH2IILFHDFFRXQW0DLQWDLQOHGJHUWUDFNH[SHQVHVDQGGHSRVLWV
700 South Blvd. (847) 555-1500
x 2UJDQL]HDQGEXGJHWIRUPDMRUHYHQWVVXFKDV$OWHUQDWH6WXGHQW%UHDNWULSWR1LFDUDJXDZLWK)DEUHWWR&KLOGUHQV
Evanston, IL 60202 2UJDQL]DWLRQ'HFHPEHU6KHLOIRUPDO6SULQJDQG6SULQJ5HWUHDW6SULQJ
wcarter@northwestern.edu
2XWUHDFKDQG$03(')HOORZ&HQWHUIRU&LYLF(QJDJHPHQW1RUWKZHVWHUQ8QLYHUVLW\  )DOO)DOO
x &UHDWHGRXWUHDFKPDWHULDOVDQGSUHVHQWDWLRQVWRWKHJUHDWHU8QLYHUVLW\DERXWFLYLFHQJDJHPHQWRSSRUWXQLWLHV
EDUCATION x $GYLVHG\RXQJHUVWXGHQWVZLWKFLYLFHQJDJHPHQWRSSRUWXQLWLHVDQGPDQDJHGWKH$UWVDQG0XVLF3URJUDPVIRU(GXFDWLRQLQ
Northwestern University: Weinberg College of Arts and Sciences, Evanston, IL
'HWHQWLRQ&HQWHUVSURJUDP
Bachelor of Science Degree, June 2016 x ,QWHUDFWHGZLWKQLQH\HDUROGPHQDWWKH-XYHQLOH7HPSRUDU\'HWHQWLRQ&HQWHUWRGHYHORSWKHLUPXVLFDODQGO\ULFDO
Major: Economics Minor: Business Institutions Program VNLOOVHYHU\6DWXUGD\RIHDFKDFDGHPLFTXDUWHU
GPA: 3.1/4.0
x )DFLOLWDWHGGLVFXVVLRQDPRQJWKHRWKHUPHQWRUVDERXWWKHMXYHQLOHMXVWLFHV\VWHPDQGJHQHUDOFLYLFHQJDJHPHQW
COURSEWORK: Introduction to Microeconomics; Introduction  to Macroeconomics; Statistics for Social Sciences;
Applied Econometrics; Introduction to Integrated Marketing Communications
9ROXQWHHU([SHULHQFH             
$OWHUQDWLYH6WXGHQW%UHDN3DUWLFLSDQW&RPPXQLW\6HUYLQJV%RVWRQ0DVVDFKXVHWWV   :LQWHU
ACADEMIC PROJECTS x 3UHSDUHGVSHFLILFDOO\GHVLJQHGPHDOVDQGGHOLYHUHGPHDOVDGD\WRWKHFULWLFDOO\LOO
Accounting & Finance: Amazon Analysis Project 6WXGHQW$VVLVWDQW&KULVWRSKHU+RXVH&KLFDJR,/  Spring  2014    :LQWHU6SULQJ
x (QJDJHFKLOGUHQLQSK\VLFDODFWLYLWLHVGXULQJUHFHVVWRSURPRWHKHDOWK\KDELWV
x Critically analyzed 100-page annual report for Amazon to identify Acid Test Ratio, Inventory Turnover, and Return
on Investment in order to increase 2013 profit margin by 87%. x 7XWRUFKLOGUHQLQUHDGLQJERRNVDGD\
$OWHUQDWLYH6WXGHQW%UHDN3DUWLFLSDQW5HIXJHH)DPLO\6HUYLFHV$WODQWD*HRUJLD   :LQWHU
x Compared quarterly reports with competitor eBay and isolated areas of development for company to address
x 7XWRUHGLQDKRXUDIWHUVFKRROSURJUDPIRUFKLOGUHIXJHHVUDQJLQJIURPVXEMHFWVRIZULWLQJWRVFLHQFH
x Gained solid understanding of quarterly balance sheets (assets, liabilities, and share holders equity) and income
x 6WUHQJWKHQHGWKHFKLOGUHQVOLIHVNLOOVVXFKDVGLVFLSOLQHNLQGQHVVDQGRSHQPLQGHGQHVVWKURXJKOHVVRQVDQGVRFLDODFWLYLWLHV
statements (quarterly performance for revenues and expenses)

Introduction to Applied Econometrics: Regression Analysis using STATA Fall 2013

x Utilized internet and other resources to self-teach STATA programming language
x Analyzed demographic data and created a regression chart correlating demographic data to wages

LEADERSHIP EXPERIENCE
Basketball Representative, Student Athletic Advisory Committee (SAAC), Evanston, IL Fall 2013-Present
x Selected by coaches and academic advisors as representative for mens basketball team
x Present issues and opportunities around campus and Evanston community to Athletic Department
x Develop community service events for 150+ Evanston youth
x Relay ideas, questions, and concerns from teammates and other student athletes to campus administrators
x Create promotional videos & e-mails to attract peers to SAAC events

Member, Northwestern University Basketball Team, Evanston, IL Fall 2012-Present

x Elected to be in Leadership Council focused on representing team issues with coaching staff STUDENT ATHLETES should
x Teach the importance of teamwork and clear communication in a highly competitive environment
x Balance academics with 20+ hours of athletic commitment each week focus on the leadership and
x Critically analyze 350 offensive/defensive plays during the course of a season
x Assess opponent schemes and provide counter plays in a fast-paced manner
transferrable skills gained in
x Practice conflict resolution skills to ensure healthy team atmosphere and focus on yearly team goals their sports and positions.
x Earned Academic All Big Ten Honors in 2012 and 2013

Mentor, Peers Urging Responsible Practice through Leadership & Education, Evanston, IL Fall 2012-Present
x Provide an equal-opportunity environment for student-athletes to share issues and opportunities in the community
x Implement new campus resources designed to enhance student-athlete life at Northwestern University
x Chosen by athletic administrators to make influential decisions benefitting student-athletes

WORK EXPERIENCE
Counselor, Northwestern Mens Basketball Camp, Evanston, IL Summer 2014
x Provided basketball skills and encouraged campers to achieve goals through strong work ethic and dedication
x Assessed 25 campers skill levels and developed a personalized training module for campers to increase skills

SKILLS & INTERESTS

Language: Basic knowledge of French and Spanish
Technical: Proficient in Microsoft Office: Word, Excel, and PowerPoint; STATA
Interests: Athletics, Woodworking, and World Religions

16
 03. RSUMS

Rsum writing for graduate students

Graduate students applying to positions outside of academia
often must convert their CVs into rsums, which are pre-
ferred in industry and nonprofit settings. A rsum should
be concise and tailored to highlight relevant skills and
experience.
Some graduate students may not have relevant work
experience, however, and must communicate how their
experiences enable them to perform the required duties of
a position. As a graduate student, you have developed a
wide range of skills that have prepared you for multiple career
options. If your background is not an exact match, identify
the skills you have acquired during any activity in your life
that are transferrable and applicable to a particular position.
Think about all of your experiencesincluding advanced
coursework, research, projects, leadership roles, volunteer
roles, paid positions, and teachingand note the skills you
developed in each. What were your daily tasks? What equip-
ment did you use? What were your results? Dont forget about
your soft skillsteamwork, collaboration, project manage-
ment, and effective communicationwhich are highly valued
by employers. From a careful reading of the job description,
as well as your research of the employer and industry, you
will learn the important skills sought as well as the keywords
and terminology of the field and can tailor your rsum
accordingly.
The following pages show examples of graduate student
rsums.

CV vs. RSUM
At least two pages or longer (no page limit) Concise: one to two pages in length

Comprehensive overview of academic and Summary of skills, education, and experience

scholarly achievements tailored to a particular industry or employer

Written for academic audiences, typically in Written for employers with a range of
your field of study academic and professional backgrounds

Used when applying for positions within Used when applying for positions outside
academic and research institutions and for of academia, particularly in industry and
funding and fellowship applications nonprofit settings

Categories and formats vary widely by Designed as a marketing tool to highlight

discipline your fit for a position and to obtain an
interview

17
03. RSUMS

Bradley J. Oliver
9000 Chicago Avenue #5B Evanston, IL 60202 y (773) 555-4321 y bq-oliver@u.northwestern.edu

EDUCATION
Northwestern University, Evanston, IL Anticipated 2015
Ph.D. Candidate in Neuroscience, GPA: 3.12/4.00, GRE: Q: 790; V: 680; A: 6
Northwestern University Kellogg School of Management, Evanston, IL
Certificate in Management for Scientists and Engineers Summer 2013
Selected (50/150) for an intensive 10-week program for doctoral students focused on management and frameworks.
For nontechnical elds, Carnegie Mellon University, Pittsburgh, PA 2007

highlight TRANSFERRABLE B.S. in Biomedical Engineering, Minor in Fine Arts, Major GPA: 3.23/4.00
RESEARCH EXPERIENCE
SKILLS from your research, Northwestern University, Evanston, IL 2009 Present
such as analysis, modeling, Graduate Student
 Demonstrated the importance of a novel circadian/metabolism gene in regulating the sleep-wake cycle (1 publication).
and project management,  Developed a novel application of statistical modeling for the large-scale study of neurobehavior (5 publications).
 Initiated and championed technology transition to the RNA-Seq platform, resulting in acquisition of $7.8M award.
instead of providing project  Mentored and supervised 8 undergraduates and 5 junior graduate students.
overviews. University of Chicago, Chicago, IL 2007 2009
Research Technologist III
 Assisted in the negotiation of the laboratory's 3-year, $1.6M collaboration with a major pharmaceutical company.
 Managed a team of 5 research technicians and a database engineer on a $3M government-funded project.
 Redesigned the data analysis pipeline and accomplished rigorous testing targets to merit $1.5M funding for phase 3.
LEADERSHIP EXPERIENCE
Advanced Degree Consulting Alliance (ADCA), Northwestern University, Evanston, IL 2013 Present
Executive Board Member
 Lead 50+ applying members through Interview Bootcamp workshop/seminar series.
 Co-author and advise on the development of the ADCA Consulting Case Book, the first written by PhDs for PhDs.
Arts Student Council, Carnegie Mellon University, Pittsburgh, PA 2005 2007
President and Business Manager

AVERY P. MATTHEWS Co-wrote grant applications and budgeted $1,200 in campus funding for student art exhibition.
112 Smithson Drive Chesapeake, VA 23322 (847)
Recruited exhibition
555-4410 opportunities at local businesses (5-8/year) and managed venue logistics for the group.
matthews@u.northwestern.edu

EDUCATION RELATED EXPERIENCE

Northwestern University, Evanston, IL Northwestern University Kellogg School of Management, August 2015 Evanston, IL 2013 Present
Research Internship, Center for Research in Technology & Innovation
Ph. D., Materials Science and Engineering, GPA: 3.56/4.00
The Pennsylvania State University, State College, PA  Co-author a case investigating targeting/positioning strategy
May 2009 for a new product launch published in a top business journal.
Bachelor of Science, Cum Laude, Materials Science and Analyze industry
Engineering, benchmarking
Physics Minor information to determine market conditions and go-to market strategies.
Honors: Schreyer Honors College, Keramos Honorary Fraternity
Pottery Barn, Pittsburgh, PA 2006 2007
RESEARCH & TEACHING EXPERIENCE Sales Team Member
Northwestern University, Evanston, IL  Achieved record-setting sales numbers September through extensive knowledge of 10,000+ products and over 240 hours of training.
2009-Present
Graduate Research Assistant, Department of Materials Science and Engineering
x Collaborated in an interdisciplinary center spanning 8 research groups at 3 universities across 4 disciplines to publish AWARDS
advances in transparent electronic semiconductorsNational Institutes of Health (NIH) fellowship (4 yrs at $75K/yr)
x Coordinated grant review presentation development Young Investigator
and served Award
as a liaison with(6lead
of 100+), 1st Sage Bionetworks Commons Congress
investigators
x Developed novel technique to characterize point defects Carnegie Mellon School
in amorphous of Engineering
thin films full-tuition scholarship
using high-temperature, in situ (4 yrs)
electrical property measurement
INTERESTS & HOBBIES
Science and Engineering Research and Teaching Synthesis, Evanston,yIL
Arts Education March 2010-
Introductory Sommelier Training JuneCompleted
Course 2014 y Volunteer Little League baseball coaching y Ultimate
Workshop Organizer, Spring 2014 Frisbee (founded/captained Carnegie Mellon Intramural Team)
x Developed immersive, hands-on experiments to demonstrate process and importance of university-level research
x Supervised 18 students in group activities and taught basic research methods and techniques
Student Coordinator, Spring 2012
x Rapidly ascertained the essentials of workshop organizers research areas to devise custom teaching methods and demos
x Utilized online forms enhancing the scheduling of 85 students into 15 workshop sessions over three weeks
LEADERSHIP EXPERIENCE
Ready, Set, Go: A Course in Scientific Communication, Evanston, IL January 2014-Present
Co-Founder, Program Administrator
x Authored grant application for $10,000 to pilot a yearlong workshop for graduate student researchers
x Coordinated professionals in theater, journalism, and communication to design intensive 10-week workshop
x Designed and maintained a course website to promote the achievements of workshop fellows
x Analyzed program feedback using web-based forms and presented to a board of graduate school deans
Engelhart Graduate Residence Hall, Evanston, IL March 2010-September 2014
Community Assistant, 2010-2012; Senior Community Assistant, 2012-2014
x Facilitated weekly meetings for a staff of 4 graduate students to plan events and enhance community development
x Reviewed, selected, and trained candidates for a community assistant position
x Planned 30 events over 4 years for a diverse community of 300 residents on budget of $8,000 per year
x Implemented online duty log to track staff efforts, improving consistency of response and scheduling decisions
x Enhanced Engelharts social network presence, contributed to improving event awareness and attendance by 50%
WORK EXPERIENCE
Apple Retail, Norfolk, VA June 2007-August 2009
Apple Specialist
x Engaged customers in friendly conversation to assess needs and provide the optimal solution for their budgets
x Earned Apple Product Professional Gold-Level Certification for product knowledge
HONORS & AWARDS
MGLC Art Fair Winner, Photography 2012, 2014
Walter P. Murphy Fellowship (awarded to outstanding first-year Ph. D. students) 2009 IDENTIFY SKILLS related
MATERIALS SYNTHESIS & CHARACTERIZATION TECHNIQUES
SEM, XRD, ToF-SIMS, XPS, Profilometry, Ellipsometry, Hall Probe, UV-VIS Spectrophotometry, Solid-state synthesis, PLD
to the job description.
COMPUTER SKILLS Showcasing the skills
Proficient
Apple Keynote, Adobe Illustrator, Adobe InDesign, Adobe Photoshop, Adobe Muse, MS Excel, MS Word, MS PowerPoint
can help your rsum
Intermediate
Adobe Premiere, Adobe Dreamweaver, Google SketchUp 8, LabVIEW 7, Wolfram Mathematica 8
surface in an employers
online search.

18
 03. RSUMS

"'#",0#"&#"0
621H
!"!H'%'>H)!&'"!>H
H60208HH!F"!&"!C!"%'*&'%!=(HDH@847AH555F3700H
H

0 0


 0
!H,%&H"H!,'H!H(!%*%'!H+#%!>H!(!H'%H,%&H"H ! !'H+#%!HH
+#%'&H!H&''&'H!,&&>H(!%*%'!>H&&(H%&"('"!>H!!H%&H&&&& !'H!H ''"!H
(%%!',H#(%&(!H&'%B&H%H!H%')H
!,'&H*'H"(&H!H (')%'H!,&&H!(!H!%-H!%H
"!>H%%&&"!>H(&'%!>H!H&"!H'%&H
H


0 0

)"0# "0"$(&?H
 $ $
$$ H
)"#HH ('#H!%H%%&&"!H "H''H#%'&H'H""H"H!%" !'H!'"H'H
"%H%H
'H,H
"(!',H&H"!HH&'H"H "%#H)%&=HHH
(H'H'&'H"H6>000;H)%&H'"H30H#%'"%H)%&=HHHH
%'"0
" ,'&?H  $ $$$
$$ $ HH
" #%H ('#H&&'"!H"%' &H!H>H!(!H 4=8>H #>H.)H,&>H(',%H%#'%"!>HH!H
 #
"&'H(&!H'H%" H*!H&&H!H
(&'%=HHH
" #%H ('#H&!%"&H"HH"%' H'"H!',H'H&'H#%!'H"H"%%',H&&H!&'!&=H
H
0
'!%"0.#%!% ,0' ,&'+-0#%!% ,0 %"&0 '0"'')&/-0( (%>H
0
Highlight any GROWTH OR
$  $
 !"$") %H2012HGH%&!'H
"%&'H!!H#%"% !H"H!'&H!H H#%!H(&' !'&H'"H!&(%H"!'%'H(%!'&H%H '>H%&H"H#,"('H&H
PROMOTION, demonstrating

''>H!H" #!,B&H#%"'H %!H&H !'!=HHH

('" 'H%#"%'!H#%"&&H(&!H(&!&&H '&H!H
H'"H%&H#%"('"!H' H,H45:=H
loyalty and potential to future



('H &H'H!H!,-H#%&%#'"!H#%!H&%#!&=HHH
""%'H*'H ('#H#%' !'&H!(!H&!"%F)H ! !'H'"H!',HH&,&' H"!H%%"%>H ''!HH
employers.
#"'!'H<4H!'H#,"('=H

!,-H"##"%'(!'&H*%H#%!H"(HH(&'H'"H "%H"&,H 'H!'&BH"!'%'H(%!'&>H%&('!H!H!H
&' 'H!!(H&)!&H"H<3=5=H

 %"&-0 %"&0 '0"'')&-0%>H

0
 $#$$ $ $
 !"$#' %H2011HGH,H2013$
%" "'H!H(!%H2H,%&H'"H!%H")%&!H'H#%!H!H(!%*%'!H#%"&&H"%HH!'H%!*&=HHH

!,-H!'H'>H)"#H&&( #'"!&>H%'H#%!H&'%',H!H#%&!'H#%!H'&H'"H+(')&=H

Roy thompson
)"#HH#%"&&H(&!H%"&"'H
&&H''H!'H"##"%'(!'&H*%H!'&BH!%H#%!H"(HH(&'H'"H
"%H"&,H 'HH)!H! %>H%&('!H!H&)!&H"H<8=5H'"H%!&=H
Roy-thomps@northwestern.edu, (817) 555-3400

&&!H*"%">H "!'"%H#%"%&&>H#%")H(!>H!H#H)"#H%%H#'&H"%H15H!,&'&=H
!'!H%"(#H!%H%&#"!&'&H*H& ('!"(&,H"!"%!H!'"H !%H%"=H
19 Orrington Ave. #213, Evanston, IL 60208
$  $#$$
 !"$%(%,H2000HGH#' %H2011H
EDUCATION
+('H&'%'H!'')&H,H!,-!H30H,H&%"%&HH$(%'%H!H#%")!H#%"')H"(!&H'"H#H #%")H
!'&BH'%!H!H%!B&H#%"'',=HHH Northwestern University, The Graduate School and The Family Institute Evanston, IL
%&!'H#!H&!H%" Master of Arts in Counseling,
!'"!&H'"H11H&%"%&H!H&(&&(,H GPA: 3.9/4.0
# !'H#!H")%HH14F "!'H' % =H June 2015
Honors/Awards: Harris Scholar, Mental Health Human Rights Clinic Participant
&!H+F&H'H!,&&H'""&H(&H,H!'H%)&H!H!H&H*!H&!H!H#%"('&H'"H!'&=H
%!H!H&(##"%'H'HH"!H'H(&H"H'&H'""&=H
0 Boston College, College of Arts & Sciences Boston, MA


0 

H
Bachelor of Arts in Psychology, GPA: 3.8/4.0 May 2013
Honors/Awards: Cum Laude; Member of Psi Chi (The International Honor Society in Psychology);

>H>H>H
>H(&!&&H '&>H%"&"'H
&&>H+>H"%>H!H"*%"!'=H
Student Research Award- Undergraduate Research Opportunity Program Fall 2012/ Spring 2013
H

 H
#%'*&'%"0")%&',-H)!&'"!>H
H
CLINICAL AND RESEARCH EXPERIENCE
$$$$
$
 !"$ (!H2014$ The Family Institute, Northwestern University, Evanston, IL September 2013 Present

?HH4=0HEH4=0H Counseling Practicum Trainee
0  Complete 80+ hours of face-to-face counseling and receive 100+ hours of group and individual supervision
")%&',0#0""&#'-0!!#"&>HH  Provide direct clinical service to 15+ weekly clients aged 15-32 years
 Treat presenting issues of depression, anxiety, childhood trauma, interpersonal relationships and body image
 $$$$$
 $#$  $ $!$ "$,H1999$$

?HH4=0HEH4=0H
Past 2 Present Project, Boston University School of Social Work, Boston, MA October 2011 May 2013
Research Assistant
 Collected data, developed recruitment strategies and corresponded with 45+ participants to measure the effects of childhood
experiences on adult development
 Awarded a $2500 grant for a research project entitled Does impulsive personality lead to college binge drinking? Examining
the relationship between impulsivity and binge drinking among college students

WORK EXPERIENCE
Residential Services, Northwestern University, Evanston, IL August 2013 Present
Assistant Residence Director/South Campus Hall Government Advisor
 Collaborate with faculty, staff and students to foster vibrant and inclusive residential environments
 Serve as primary advisor to 3 hall governments and offer guidance, training, and support to 15 lead members
 Coordinate and implement the election process, manage executive board meetings, and facilitate the revision of constitutions

Tufts Summer English Language Programs, Tufts University, Medford, MA June 2013 August 2013
Resident Counselor
 Provided supervision and guidance to 19 international students and 3 student leaders
 Instructed residents on crisis response, identifying binge drinking behaviors, and active listening techniques
 Fostered immersion to life at Tufts University and the United States by creating educational presentations and leading cultural
trips around the greater Boston area

Boston University Orientation, College of Arts & Sciences, Boston, MA March 2012 January 2013
Student Advisor
 Served as a peer mentor and leader to a group of approximately 15-18 incoming students at each Orientation session
 Conducted small group meetings and discussions with students and families, explaining academic polices and requirements

Listing PROFESSIONAL Billings Office of the Clinical Psychiatry Department, Boston Medical Center, Boston, MA
Office Assistant
February 2011 December 2012

 Verified insurance claims of Boston Medical Center psychiatric patients and processed session billing
AFFILIATIONS AND  Managed clinical documents and updated insurance provider information through online office system
MEMBERSHIPS conveys AFFILIATIONS AND SERVICE
a commitment to your eld American Mental Health Counselors Association 2013 Present
Student Support Network, Boston College April 2012
and may help you make UMOJA, Boston College Black Student Union
Cultural Mentorship Program, The Howard Thurman Center for Common Ground, Boston College
2009 2011
2009 2011
connections with employers.

19
03. RSUMS

MAYA L. SANTIAGO
1915 Maple Avenue
Evanston, IL 60201
(847) 555-1234
ml-santiago2@u.northwestern.edu
Profile
When converting your CV to Doctoral candidate in Biomedical Engineering seeking a challenging position in medical device development. Six years of
a rsum, highlight your expertise using innovative research methods to build and test prosthetic devices. Strong communication skills developed
through interacting directly with medical patients to collect data and presenting research to scientific and community
direct and transferrable skills audiences. Demonstrated strong leadership ability planning a departmental research symposium and multiple teaching
experiences.
in a CANDIDATE PROFILE. Education
Northwestern University, Evanston, IL
Ph.D. Candidate in Biomedical Engineering, Anticipated June 2015
Dissertation: Neuromechanical Mechanisms of Prosthetic Knee Joint Control: Associations with Prosthetic Alignment
M.S. in Biomedical Engineering, December 2011
Thesis: An Investigation of Shock-Absorbing Prosthetic Components for Persons with Transfemoral Amputation
Graduate Teaching Certificate Program, 2012-2013
Searle Center for Teaching Excellence
University of Virginia, Charlottesville, VA
B.S. in M echanical Engineering, May 2008
Magna Cum Laude
Research Experience
Research Assistant, Northwestern University Prosthetics-Orthotics Center, Chicago, IL Apr. 2009-Present
Propose novel research protocol to investigate the influence of prosthetic alignment on the gait biomechanics of
persons with transfemoral amputation
Build and test innovative EMG electrodes that make it possible to acquire intrasocket EMG signals
Design custom-made alignment adapters to implement and standardize research protocol
Collect quantitative gait data using a Motion Analysis motion capture system, AMTI force plates, Cosmed treadmill,
iPecs load cell, and Noraxon EMG telemetry system
Supervise and train 5 undergraduate students through a summer research project
Program custom Matlab scripts and perform statistical analyses to analyze gait data
Recruit, schedule, and consent subjects for research studies
Teaching Experience Prepare and maintain Institutional Review Board (IRB) paperwork
Undergraduate
Co-Instructor, Northwestern University Dept. of Biomedical Engineering, Research
Evanston, IL Assistant, University of Virginia,
Jan. 2013-Mar. 2013 Charlottesville, VA Sept. 2007-May 2008
Studied
Taught an introductory biomechanics course (statics and strength the influence
of materials) of different
to 41 sophomore pH solutions on the dynamic swelling of functional hydrogel structures in
engineers
Implemented challenge-based learning methods microfluidic channels
Developed and refined teaching philosophy and portfolioResearch Fellow, National Science Foundation REU, University of California, Los Angeles, CA May 2007- Aug. 2007
Examined
Teaching Assistant, Northwestern University Dept. of Biomedical Engineering, the biomechanical
Evanston, IL effect
Sept.of2012-Dec.
growth factors
2012 on the repair time of flexor tendons in the human hand
Conducted
Supported professor by teaching an advanced engineering section material
for graduate strength tests of tendon sutures using MTS equipment
students
course
Revised teaching materials and updated information for student Presented research results to academic colleagues and corporate sponsors
packets
Offered students recommendations to improve performance in course
Leadership
Community Service Co-Chair, McCormick Graduate Leadership Council, Northwestern University Sept. 2013-Present
Organize a council of 16 student leaders to foster leadership and community among engineering graduate students
Mentor, Get-a-Grip Middle School Science Program, Evanston, IL Sept. 2012-Present
Manage a $7,000 budget from the Deans Office for academic, social, and professional activities
Teach students basic engineering concepts related to the design of a prosthetic arm
Plan and implement 3 seminars on academic career planning for doctoral students
Mentor middle school students during a prosthesis design competition
Symposium Planning Committee, Chicago Graduate Student Research Symposium Sept. 2010-May 2012
Judge, Chicago Public Schools Annual Science Fair, Chicago, IL Jan. 2012
Collaborated with academic departments, faculty, staff and students at 5 Chicago-area institutions to organize an
Evaluated elementary and high school student projects for city-wide science fair competition
interdisciplinary research symposium with over 200 attendees
Volunteer Science Teacher, Kennedy Elementary, Chicago, IL, & Haven Coordinated
Middle School,
travelEvanston, IL andJune
arrangements 2010-2012
meeting schedules for invited speakers and guests
Instructed classes of 25-30 students in basic science and engineering
Created
concepts on timelines
project a monthlytobasis
ensure appropriate deadlines were met by planning committee members
Collaborated with school faculty to develop innovative projects to engage elementary and middle school students
Created schedules and assigned teaching responsibilities for team of 10 graduate student volunteers
Skills
Technical Software: Matlab, Mathematica, Maple, SPSS, SIMM, OrthoTrak and Cortex for motion capture, AutoCAD,
Mechanical Desktop, TurningPoint, FORTRAN 77
Computer Software: Microsoft Office Suite (Word, Excel, PowerPoint), Paintshop, Adobe Suite
Languages: Spanish (fluent), French (proficient)
Selected Publications and Presentations
Santiago, M.L., Yarin, S., Mehta, D. Cross Validation of a Portable, Six Degree-of-Freedom Load Cell for Use in Lower-
Limb Prosthetics Research. (In Preparation).
Mentioning SELECTED
Santiago, M.L. An Investigation of Shock-Absorbing Components in Persons with Unilateral Transfemoral Amputation. PUBLICATIONS AND
Midwest Chapter Meeting, American Academy of Orthotists and Prosthetists, May 15, Atlanta, GA, USA, 2014.
Santiago, M.L. Whats New in Rehabilitation Research. Rehabilitation Institute of Chicagos Annual Nancye B. Holt Rehabilitation
PRESENTATIONS saves
Management Course: Challenges in Leadership and Management, January 10-11, Dallas, TX, USA, 2014. space and implies there
Santiago, M.L., Lewis, D., Fey, T.E. Limb Compliance and Shock-Absorbing Pylons in Persons with Transfemoral
Amputations. International Society for Orthotics, May 19-23, Toronto, Ontario, Canada, 2013. are more.
Santiago, M.L., Horton, J.C., Baldwin, A., Lewis, D. The Effect of Transfemoral Prosthesis Alignment Perturbations on
Gait. Journal of Orthotics and Prosthetics. 68(3):58-64, 2013.
Santiago, M.L. Comparing Shock-Absorbing Prosthetic Components in Unilateral Transfemoral Amputees. Abilities
19(3):6-7. Northwestern University, Chicago, IL, USA, 2011.
Awards
American Academy of Orthotists & Prosthetists Education Research Foundation Fellowship 2013-2014
Whitaker Foundation Graduate Fellowship 2009-2013
Second Place Departmental Award, Northwestern University BME Research Day Poster Presentation 2012
Award for Progress in Engineering Design and Application 2012
University of Virginia Academic Achievement Scholarship 2004-2008
University of Virginia Distinguished Service Award 2008
University of Virginia College of Engineering Award 2007

20
 03. RSUMS

"&'&
 "

I@@
 !'
.&-
=D@D
:
.&+,'&3


F@B@B
:
HDG
EEE
IHGF
:
%%!$$&B@AF<-6&'*, /+,*&6-










#%'*&'%"
")%&'+,
.&+,'&3








B@AF

 


,
*'*%&
,-!+










#!#"
# ,
$*%'&,3








B@@H

 

,
 ,*



#+
!+
#
%!'
%',
'&'&3






B@@F
The scope and breadth
$++!$
,!&
,*!&!&
(*'*%3
+%+,*
*'



of your TEACHING


EXPERIENCES can be

quantied; keep track
'%

"&'%('#%








B@AD;*+&,





#
!
 "#
3


of the number of students
+!&3
/*',3
&
,- ,
E
'*!!&$
+1$$!
'*
!+,'*13
, '*13
&
(*,!
'-*++
in each course, the
(!$!2
!&
!&,*!+!($!&*1
'-*+
+!&3
!&$-!&

$++
'&
%!!&
&
, ,*
&
&

!&,*,
, '*1
&
(*,!
'-*+
'&
%"'*
,/&,!,
&,-*1
!*,'*+
sections taught, and
,
E6D:F
'*
'.*$$
)-$!,1
'
!&+,*-,!'&
!&
$$
B@AD
+,-&,
.$-,!'&+
how you were rated.


#("%
"
##%"'#%







B@AC;B@AD






#
!
 "#
3



'$$'*,
/!,
-$,1
,'
'*&!2

"'
%*#,
/'*#+ '(
,'
$(
 66
+,-&,+
!&,*,


, !&
!&,'
, !*
**
($&&!&
(*'++3
%#!&
, %
%'*
.!$
'&
, 
%!
%*#,




'&!.
&
*,

'*-%
'*
, ,*
&
*%


66
+,-&,+
,'
!%(*'.
, !&

('*,'$!'+
&
+1$$!
&
+ *
!+!($!&;+(!!
*+'-*+
'&
, !&

'*$75
*'*%&
&
'1
'&
&
%!7+
*!&69



8 
'+,
%'-+
 '$*
!&
,
+!&
-**!-$-%
'*
*+ %&
, ,*
'-*+
!&
'$$'*,!'&
/!,
-$,1
&
*-,

 !

#

"#



+(!$
!++-
'&
$, 3
%'!%&,
&

+,-&,+
,'
,,*
%,
, 
(*,%&,7+
$*&!&
'",!.+

!+-$
-$,-*3
-$1
B@AD3
CF5C;D3
AI@;B@B6



%('
"
 #*





8%!,




'-&,13
39

#
 B@AA;B@AC

!'
(*,'*1
 ,*3
(*!&
B@AA6






 


#
!
 "#
3



' 
BE
*-,
+,-&,+
,'
'(,!%!2
, 8*!&!&
-+&
!$$!%+
'%5
&

&,*.!/
/!,
!*
'%(,!,!.

!&
, 
"'
%*#,

'*,
&
&1
!$$!%+39

#
 !'


'&&,
+,-&,+
/!,
*+'-*+
'&
('1
,'
(*,'*1
 ,*3
$$
B@AB6

$(
, %
+,*,!2
, !&
!+!'&+


.$'(
&
$
AE
%-$,!!+!($!&*1
/'*#+
'(+
'&
, !&
'*
FE
*-,
+,-&,+


8 
'%&
$1/*! ,+
+,!.$5

.!/
'
&
*+39

#
 !'
(*,'*1
 ,*3


'&+-$,
/!,
, *+
, *'-
'&;'&;'&
%,!&+3
$++*''%
'+*.,!'&+3
&
,!$

, !&
.$-,!'&
$,,*+

!&,*
B@@I6

*&!2
&
**!
'-,
&
&&-$
'&*&
'*
AE
&/
, !&
++!+,&,+
!&
'$$'*,!'&


/!,
*$
&,*
%($'1+
&
', *
, !&
$$'/+












++'!,!'&
'*
 ,*
!&
! *
-,!'&
&
*'*%&
,-!+

&,*&,!'&$

%*!&
'!,1
'
 ,*
'&+-$,&,+
%*!&
$$!&
'*
 ,*
&
-,!'&








#!$('%-
!*'+',
'*3
'/*'!&,3
&
0$4
*2!4
$-&1
!&
',

&

&.!*'&%&,+

"(&5

$-&,
!&
,!&3
'&.*+,!'&$
!&
(&!+

 
 


When searching for

CAREERS OUTSIDE &%
&&&'"'








B@AB;(*+&,





#
!
 "3
3



ACADEMIA, think
&,*.!/
&
$!%
!*,'*
&
,*&+*!
!&,*.!/+
'*
(-$!,!'&
!&
&
'&$!&

broadly about skills such , ,*
"'-*&$


as leadership, coaching, '*
'&&,!'&+
/!,
#1
!-*+
!&
, 
*,+
&
+'!$
"-+,!
!$+
, *'-
!&,*.!/+
&

*+*
,'
)-!*

*! *
)-$!,,!.
,
+,

and course design. !&
#&'/$
'
**
(, +
.!$$
,'
'%%-&!,1;%!&
*,+
(*'++!'&$+



)&"
!
!%,

 





B@AC



#

3



'$$'*,
'&
/*!,!&
&
*+*
'*

&/
($1
'&
.,*&+7
%&,$
$,
!++-+

'+,*
%-,-$$1
&!!$
*$,!'&+ !(+
%'&
(+1 '$'1
+,-&,+3
.,*&+3
, ,*

(*'++!'&$+3
&
'%%-&!,1
%%*+3
*!+!&
/*&++
'-,
, 
('+,;%!$!,*1
0(*!&



%#%!%









B@AC





#

3



'&!.3
/*',3
&
*'*
!&,*,!.
-!'
,'-*+
'*
, 
*,

&+,!,-,
'
 !'
/!,


,%
'
(*'*%*+

'&+-$,
/!,
, 
*,

&+,!,-,7+
-,!'&
,%3
$(!&
, %
'%!&
%!
,'
!&

*,!.
/1+
'
* !&
, !*
,*,
-!&+4
!&*+!&
, !*
(*'*%
,,&&
1
EEL

21
 04. COVER LETTERS
An important marketing tool, a cover
letter introduces you to a potential
employer and should always accom-
pany a rsum. By clearly highlighting
your strengths and credentials, the
cover letter should capture the employ-
ers interest and ultimately secure you
an interview. You should customize
your cover letter for each employer
and address it to a specific person. If
you dont know the recruiters name,
address your letter to Northwestern
Recruiting Team or Hiring Manager. sending it.
22
A cover letter is written in a business
letter format. It should be kept to one
page of three to five paragraphs, focus-
ing on specific content in depth and not
repeating your entire rsum.
The opening paragraph introduces
you. State your reason for writing and
how you learned about the organization
or position. If someone referred you,
include the persons name and affiliation
with the employer. Demonstrate your
level of interest in and knowledge of
the organization in two to three more
sentences.
The middle paragraphs emphasize
and elaborate on your strongest quali-
fications and key relevant experiences.
Address qualifications specifically listed
in the job description. The cover letter
and rsum together should convey a
complete picture of what you want the employer to
know about you.
The closing paragraph is generally used to express
thanks for consideration, to request an opportunity to
discuss the position, and to indicate how you can be
reached. For long-distance searches, let the employer
know of any plans to visit the area, in hope of arranging
an interview then.
If you are using the heading from your rsum, you
neednt repeat your contact information in the closing
paragraph. Include your name, institution, degree, and
graduation date in the signature.
It is a good idea to solicit feedback on your cover
letter by sharing drafts with NCA staff, professional
contacts, and peers. Ask your reviewers, What did you
learn about my qualifications and interest in the posi-
tion? And, of course, youll want to proofread it before
Youll see three sample cover letters on the pages
that follow.
 04. COVER LETTERS

The highlighted
Baxter Rosi sections demonstrate
1234 Chicago Avenue Apt. 2A, Evanston, IL 60201 brosi4@u.northwestern.edu 847.555.3211 how you can tailor
September 29, 2014 your cover letter to
Jack Smith the job description.
Director of Human Resources
The Boston Consulting Group
300 N. LaSalle Street
Chicago, IL 60654

Dear Mr. Smith:

I am writing to apply for the Associate position at The Boston Consulting Group. Currently, I am a senior at Northwestern
University and a double major in Political Science and International Studies with a minor in Business Institutions. The
Boston Consulting Group stands out to me because of its wide range of capabilities in the global market and the customized
approach it takes to address clients challenges. In addition, the opportunity to chart my own course in a supportive and
challenging environment is very important to me. I have spoken at length about this position with Ann Johnson, a current
Associate with BCG, and our discussions have reinforced my enthusiasm for working at your organization upon graduation.

My internship and leadership experiences, as well as my academic performance, have given me the interpersonal and ana-
lytical skills to succeed at BCG. This past summer I worked at Target Corporation as a business analyst intern. My primary
responsibilities included developing a strategic plan to increase Targets sales and cut costs through better product transition
processes and creating a long-term plan to implement my recommendations. I, along with my other teammates, developed
a plan to address the disconnect between the timing and scope of product transitions compared with the customer shopping
trends and frequency, which led to a potential sales increase of $10 million and receipt savings of $9.3 million. Although the
core of the internship involved quantitative work and trend analysis, the knowledge that I gained through the positive rela-
tionships I built with team members across the division was critical to my success.

In addition to my professional experiences, I have served as a leader at Northwestern in both the classroom and other capac-
ities. Currently, I am the chair of the Northwestern program team for campusCATALYST, a student- run organization that
pairs students with a non-profit to carry out a 10-week consulting project. I began my involvement with campusCATALYST
as a sophomore, when I participated in the program as a community analyst during my winter term. I interned at a non-
profit called GlobeMed, where I analyzed its current and prospective media strategies to determine how it could implement
a more effective media campaign for its upcoming expansion. Last year, I was chosen to join the program team for campus-
CATALYST as a non-profit liaison. My responsibilities included recruiting and managing non-profit clients and the MBA
mentors who worked with the students during their projects. In the spring of 2011, I was elected chair of the organization,
and will be managing the 9-person program team as well as serving as the student liaison to our board of directors.

I believe my education, work experience, and leadership abilities make me a strong candidate for the Associate position.
Enclosed is my resume that further outlines my education and work experience. I am excited to learn more about The Boston
Consulting Group and look forward to the opportunity to discuss this position with you in person. Should you have any
questions, please feel free to contact me at 847-555-3211 or brosi4@u.northwestern.edu. Thank you for your time and con-
sideration. I look forward to meeting with you soon.

Sincerely,

Baxter Rosi
Job posting
Associates work closely with BCG teams and the client organization as they conduct interviews,
analyze data, communicate findings, and drive change. You will become adept at helping clients find
answers to their toughest questions and implement necessary changes. No two experiences are the
same but all offer opportunities and challenges. BCG also offers career paths that include promotion
directly to consultant, graduate school assistance, and career transition opportunities worldwide.
BCG offers you an experience that spans many industries, clients, and business issues, with
learning coming in all shapes and sizes, from intensive orientation programs to ongoing training and
on-the-job apprenticeship. As an associate, you will be challenged to develop firsthand knowledge of
clients critical business issues, building client-management, problem-solving, and communications
skills. You will be given ownership of significant segments of client projects, as well as responsibility
for supporting the broader problem-solving effort. You will conduct interviews with key market players
and industry specialists and analyze clients performance. Your findings, and contributions to team
discussions, will help deliver impact for clients.
In addition to a strong academic record, we seek candidates who are team contributors, having
excellent problem-solving skills, exceptional communication skills, strong quantitative and analytical
skills, and are proven leaders.

23
04. COVER LETTERS

Marie Hough
Slivka Hall 2332 Campus Drive Evanston, IL 60201 (309) 555-2323 Mariehough@northwestern.edu

January 18, 2013

Penguin Group (USA)

Human Resources Department
Attn: Internship Coordinator
375 Hudson Street
New York, NY 10014

Dear Internship Coordinator:

I am a junior majoring in Comparative Literature with a minor in Public Health. Yet, to the librarian at home in
New York, I am still the kid who bribes her friends for library cards each summer in order to evade the 30- books-
per-week-limit. I was also the one who secretly hoped for rainy days in elementary school it meant spending recess
in the library.

Now that I am at Northwestern University, I have had the ability to branch out in my passion for reading. I have
become interested in the legal processes of the literary world, and I am eager to see how a powerhouse publishing
company responds to changes such as the rise in e-books. Since publishing is a field closed off to most students, I am
eager to explore each Penguin Group department in both the Young Readers and Adult divisions, and was excited to
find the posting on CareerCat. I would like to be considered a candidate for your summer internships in the follow-
ing areas: contracts, editorial and subsidiary rights.

My interest in the publishing process began with forays in journalism. During my freshman year, I joined the copy
desk of The Daily Northwestern and studied investigative reporting by editing articles. The following year, I used
what I learned and began working on short clips, an activity culminating in my own investigative article about late-
night dining options in Evanston. I then contacted the editor of Newsday newspaper and he invited me to join its
copy desk that summer as its first undergraduate intern. Although the newspaper industry is a different type of print
publishing, it was fantastic being part of the group revision process. I would walk out of the office each night with
my nose stuck happily in a copy of the next mornings paper.

An internship with Penguin Group would introduce me to a new area of the publishing industryone without which
story pitching and writing would be void. Working in the newsrooms has given me a wider view of research and
writing than any class could have offered. Furthermore, it has given me an irreplaceable set of time-management
skills. I hope to use the skills I have accrued in the long but rewarding journey that goes into introducing a new novel
to the bookshelf.

I would welcome the opportunity to discuss my qualifications with you in more detail. I will be returning to New
York for my Spring Break mid-March and would be available for an on-site interview. Thank you for your time and
consideration.

Sincerely yours,
Marie Hough
Mariehough@northwestern.edu
Job posting
Penguin Group (USA) offers paid internship opportunities in various business
areas such as contracts, editorial, finance, graphic design, managing editorial,
marketing, online marketing, production, publicity, sales, subsidiary rights, and
operations. Internship opportunities are available in our Young Readers and Adult
divisions.
Research and writing experience, along with time-management skills are
highly desirable qualities we look for in candidates.
The internship program consists of three 10-week long sessions. During the
spring and fall, interns work 14 hours per week. During the summer, interns work
28 hours per week.
A series of lunch events are planned for summer interns. Brown Bag lunches
give interns the opportunity to learn about different departments, and group
lunches are designed to allow interns to network with each other as well as
employees across the company.

24
 04. COVER LETTERS

Leah Daniels
2400 Sheridan Road, Evanston, IL, 60201 (650) 555- 9292 leah2018@u.northwestern.edu

March 20, 2015

Benefit Cosmetics LLC

Director of Human Resources
225 Bush St.
San Francisco, CA 94104

Dear Hiring Manager,

A passionate dancer since the age of eight, I have experimented with my fair share of false eyelashes and red lipsticks. Before
every stage appearance, I always make sure to apply what I consider to be my secret performance ingredient: Benefits
High Beam. I discovered this magical highlighter when I visited my local Benefit boutique for the first time. After dabbing
a couple of drops onto my face, I felt my cheekbones and confidence brought to light; I was ready to dance my heart out in
the middle of the store. While only High Beam can elicit my inner Shirley Temple, I experience a similar rush of exhilara-
tion when brainstorming creative marketing strategies and designing promotional materials. Passionate about everything
related to beauty and communications, I would be thrilled to combine my greatest interests through Benefit Cosmetics
Brand and Digital Marketing Internship.

I am a freshman at Northwestern University pursuing a degree in Economics and Dance. I first discovered my interest for
marketing while serving as the Officer of Public Relations for Silicon Valley DECA. Unversed in social media before assum-
ing the role, I eagerly taught myself everything related to Facebook, Twitter, and Tumblr and spent hours creating a new
website for the organization. Through trial and error, I learned how to harness social media to most effectively engage and
connect with our organizations members.

In my subsequent role as Silicon Valley DECA President, I enhanced my communications skills working with 12 student
officers to arrange and promote our organizations first Leadership and Career Development Conference. After surveying
members to determine their professional goals and desired skills, we recruited guest speakers such as Charles Huang,
co-founder of Guitar Hero, to present conference workshops on key career-preparation topics. By expressing the value of
these workshops in creative social media campaigns, we attracted over 1,000 members to our conference. During the event
planning process, I learned how to mass-market a large-scale event, and I realized the importance of leveraging community
support and awareness when promoting a service or product.

As an intern for iCadenza, I gained experience creating strategic social media and product expansion plans. After analyzing
the demographics and social media tendencies of the companys customer base, I created Facebook and YouTube customer
contests to increase market awareness and the companys online presence. In addition, after conducting multiple market,
competitive, and financial analyses, I discovered opportunities for the company to receive an additional profit of $6,150 over
three years by expanding its services to aspiring professional dancers.

I would love to expand my knowledge of the industry by working at Benefit, which presents a uniquely inspiring and
empowering ethos through its product branding. As an intern, I would help Benefit expand its presence among college
students by organizing campus brand events and social media campaigns that would increase customer interaction. I would
value the opportunity to further discuss my qualifications with you. Thank you in advance for your time and consideration.

Sincerely,
Leah Daniels

Job posting
Job Description:
Benefit Cosmetics is looking for an enthusiastic Brand and Digital Marketing Intern for the US team, who is
motivated to obtain real-world experience and exposure within a leading global beauty brand. The intern will
support both the Brand and US Digital Marketing teams in their day-to-day tasks.
As a general overview, the Brand and Digital Marketing department communicates the brand experience
through campaign activations, social media, strategic partnerships, and promotions and facilitates brand expo-
sure to the customer. The Brand and Digital Marketing Intern will be introduced to the inner workings of the
beauty industry and must be prepared to work responsibly in a fast-paced environment. In your cover letter,
please address the goals you plan to achieve with this position and why you want to work for Benefit. Dont
forget to include grade point average, community involvement, and leadership experience on your rsum.

Essential Duties and Responsibilities: Qualifications:

Brand campaign support Organized with the ability to multitask in a fast-paced
Social media and digital campaign support environment
Event support Excellent written and verbal communication skills
Competitive analysis Sees projects to their completion and meets deadlines
Product stockroom maintenance Proficient in Microsoft Office Suite: Excel, PowerPoint,
Administrative duties Word
Must be enthusiastic, motivated, responsible, and have
a sense of humor

25
 05. INTERVIEWING
Interviews are a critical part of the
hiring process for both employers and
candidates. As a candidate, you are able
to obtain information about the job and
the organization, determine whether
the fit is good for you, and impress
the employer. The interviewer can
promote his or her organization, gather
information about you, and assess your
qualifications.
BEFORE THE INTERVIEW
Interview preparation should begin early in your job
search process and will contribute to your success.
Thorough preparation will enable you to speak
confidently about your achievements. Preparation
can be broken down into three main components:
INTERVIEW TIPS
Prepare for the interview
Research the industry and the organization.
Review your rsum.
Prepare questions.
Practice with an NCA staff member.
Bring your rsum, an unofficial transcript, and a list
of references.
Dress appropriately for the job, company, and industry.
Arrive early, at least 10 minutes before the scheduled
time.
Turn off your cellphone.
Engage with the interviewer
Address the interviewer by title (Ms., Mr., Dr.) and last
name unless asked to use the first name.
Offer a firm handshake.
Convey enthusiasm for the company and position.
Maintain strong eye contact.
Ask for clarification if you dont understand a question.
Speak specifically about your role in any successes.
Be honest and avoid exaggeration.
26
Know yourself. Conduct a thorough self-assessment
of your education, experiences, accomplishments,
strengths, weaknesses, interests, and values. Review
what you said on your rsum about the skills you
developed and contributions you made in each
experience.
Research. Learn everything you can about the orga-
nization (e.g., vision, location, size, structure, products
and services, culture, customers, and competitors) and
the industry. This will help you to respond to interview
questions and demonstrate that you are interested in
the organization.
Practice. We encourage you to practice responses out
loud with a friend, family member, or peer to become
more comfortable and confident in talking about your-
self and your accomplishments. Receiving feedback
and constructive criticism is critical to improving
interviewing skills. Mock interviews may be scheduled
with any NCA career adviser and are a great way to
practice. All NCA mock interviews are videotaped to
assess your nonverbal behaviors.
Obtain a business card from each interviewer.
Send a thank-you note to the interviewer(s) within
48 hours.
Avoid faux pas
Do not chew gum and avoid smelling like smoke or
alcohol.
Use moderate hand gestures and maintain appropriate
posture.
Be mindful of your tone of voice and rate of speech.
Let the interviewer finish speaking; avoid interrupting.
Take time to think before answering difficult questions.
Avoid using acronyms, slang, and filler words like um
or like.
Avoid speaking negatively about anythinga previous
employer, a professor, a colleague.
Be mindful of not being overbearing, overaggressive,
or conceited.
Avoid discussing salary, holidays, or bonuses unless
the interviewer raises these topics.

The most common interview format employers use today
is behavioral interviewing, which is based on the idea that
past behavior and performance are predictive of future behav-
ior and performance. The interviewer will typically ask ques-
tions that begin with Tell me about a time when you or
Describe a or Give me an example of when . Your When the interviewer approaches, rise from your seat in
responses should describe how your specific experiences
relate to the job for which youre applying.
Developing a strategic approach to behavioral interviewing
means taking the preparation steps described above even
deeper. Analyze and identify themes within the job posting.
Reflect on your experiences to identify examples of when
you demonstrated the skills, knowledge, and experience
required for the position. By using the STAR approach, you
can structure and organize your responses to behavioral
interview questions, succinctly communicating the important
parts in describing an event:
Situation. Describe the context of the situation.
Task. Describe the task at hand and your specific role
within it.
Action. Describe the actions you employed.
Result. Describe the outcome of your actions.
STAR APPROACH IN ACTION
QUESTION: Please describe a time when you employed
problem-solving skills.
ANSWER: In my internship last summer at the
National Relief Fund, I was asked to devise a better
system for tracking donations earmarked for hurricane
disaster relief (situation). Because the National Relief
Fund is such a large organization, I needed to under-
stand the various ways donations were being tracked
(task). By surveying regional offices, I found that only
78 percent of these offices had database tracking sys-
tems that were upgraded to the level of those at the
national office. I included this information in a report
that recommended an upgrade in these databases for
all regional offices (action). As a result, the executive
director made the decision to move forward with
upgrading systems by August 2014 (result).
05. INTERVIEWING
DURING THE INTERVIEW
Most interviews follow a three-stage pattern:
The introduction. Arriving early shows respect for the
professional who has reserved time to meet with you.
greeting. The walk to the interview room is an opportunity
to develop rapport by engaging in small talk. Once you are
seated, the interviewer may provide an overview of the time
you will spend together.
The information exchange. The interviewer will ask ques-
tions about your experiences, skills, and interest in the posi-
tion. This is your opportunity to prove that you are the best
candidate. Remember that your nonverbal behaviors, such
as how you stand, sit, and listen, also influence the impres-
sion youre giving.
The wrap-up. It is common for interviewers to ask toward
the end of an interview, Do you have any questions for me?
You may ask for more details about the position and the skills
the organization is seeking, but avoid asking questions related
to salary, benefits, and personal topics. At the conclusion of
the interview, express appreciation for the interviewers time
and restate your interest. The interviewer will likely share the
hiring timeline. If you are not offered a business card, ask for
one so that you have the exact email or postal address to
which to send a thank-you note.
AFTER THE INTERVIEW
Analyze in writing how the interview went, what you learned,
and what your impressions were of the organization and the
interviewer(s). A written record of each interview will help you
remember and compare positions later.
Within 48 hours, send a personalized thank-you note to
each person with whom you met (see page 30).
If you do not hear back from the organization within the
timeframe discussed, contact the interviewer(s) again to
express your continued interest and ask about your status.
27
05. INTERVIEWING
INTERVIEW ATTIRE
While your interpersonal skills
and ability to formulate responses
are the most important elements,
appropriate attire supports your
image. The way you dress can
greatly enhance or detract from
the impression you make. Present
yourself in a manner that reflects
a highly polished and professional
image.
For both men and women,
the professional standard is to
wear a matched two-piece suit.
Acceptable colors are darker (e.g.,
gray, navy, or black). Appropriate
size is critical for both comfort
and presentation. Make sure your
suit is pressed for each interview.
FOR WOMEN
Shirt/sweater Wear a con-
servative blouse or a knit
shell underneath your suit
jacket. White or off-white
colors match with many col-
ors. Tops that are revealing,
are high around the neck,
or have many ruffles or frills
are not recommended.
Handbag Carry a small,
simple purse or handbag
that coordinates with your
shoes. It is also acceptable
to bring a small briefcase
or business tote bag.
Shoes Choose close-toed
pumps of leather or fabric/
microfiber that allow you to
walk comfortably.
28
FOR MEN Hair Make sure your hair is
clean and well-groomed.
Tie Whether stripes or
Shirt Long-sleeved shirts
small dots, patterns should
are most appropriate year-
be uniform and subtle.
round. Choose white, light
Deep red, maroon, blue,
blue, or conservative stripes.
navy, gray, and black blend
well with dark suits.
Belt Select a belt that
matches or complements
your shoes and has a
simple buckle.
Socks Socks should com-
plement the color of your
suit and be long enough for Shoes Lace-up, wing-tip
you to cross your legs shoes are the most conser-
without showing bare skin. vative choice and are uni-
versally acceptable. Have
your shoes shined.
Jewelry/accessories
Limit jewelry and accesso-
ries to five pieces. You do
not want them to distract
from what you are saying.
Skirt/pants A dress, skirt,
or pants may be worn with
a blazer. A dress or skirt
should cover your thighs
when you are seated; a
good rule of thumb is that
it reach at least the middle
of your knees when you
are standing.
Hosiery Always wear
hosiery in a neutral shade
or a shade that coordi-
nates with your suit.

Common interview questions
Although you cant predict exactly what an interviewer will
ask, questions about decision making, analysis and problem
solving, initiative, interpersonal skills, teamwork, communica-
tion, and leadership are among the most common. Use the
following list as a general guide as you prepare.
Personal
Tell me about yourself.
What short-term and long-term goals have you set for
yourself? How are you planning to achieve them?
Who or what has had the greatest influence on the
development of your career interests?
What two or three things are most important to you in
a position?
What two or three accomplishments have given you
the most satisfaction?
What are your strengths and weaknesses?
What has been your greatest challenge?
Are you willing to relocate or travel as part of your job?
Education
Why did you choose your major?
Do you feel your GPA reflects your academic ability?
How has your major helped you prepare for this position?
What is the most important lesson you have learned in or
outside of school?
How do you think you have changed personally since you
started college?
Knowing what you know now about your college experi-
ence, would you make the same decisions?
What has been your favorite or least favorite course? Why?
Employer
What expectations do you have for your future employer?
Why are you interested in this organization?
Why are you the best person for this position?
What can you contribute to this company?
What challenges are you looking for in a position?
How have your educational and work experiences
prepared you for this position?
What do you expect from a supervisor?
05. INTERVIEWING
Experience
What are your team-player qualities? Give examples.
Describe your leadership style.
What is your approach to handling conflict? Solving
problems?
How do you motivate others?
Describe a leadership role of yours and tell why youve
committed time to it.
What work experience has been the most valuable
to you?
What was the most useful criticism you received, and
who provided it?
How did you decide which extracurricular activities to
join? What did you gain from these experiences?
What contributions have you made to a group project?
What types of situations put you under pressure? How
do you deal with pressure?
What have you found most frustrating in your work
experience?
Behavioral
Take me through a project where you applied __________
skills.
Describe a situation when you displayed your critical
thinking skills.
Describe a project or situation that best demonstrates
your analytical skills.
Describe a situation where you had a conflict with
another person and how you handled it.
Give an example of a problem you solved and the
process you used to arrive at the solution.
Describe an idea that you developed and implemented
that you felt was particularly creative or innovative.
Tell me about a difficult decision you have made.
Tell me about a time you set a goal and failed to reach it.
Give an example of a situation in which you failed and
how you handled it.
Tell me about a time when you had to persuade another
person to concur with your point of view.
Tell me about a project you initiated.
Tell me about a team project that you are particularly
proud of and what your contribution was to the project.
29
05. INTERVIEWING

POSTINTERVIEW THANK-YOU NOTES

A personalized thank-you note is your final chance to stand
apart from other applicants and to have additional contact
with the employer before a hiring decision is made. Send a
thank-you to each interviewer within 48 hours of the interview.
A thank-you note may be handwritten or emailed. When
determining which is more appropriate, consider the employ-
ers hiring timeline and the culture of the organization. If
the interviewer indicated that you would hear back within
the week, email a thank you. A handwritten note is best if
the organizational culture is conservative. Write the note on
good-quality paper or stationery, keeping to one page, and
make sure your writing is legible.
The content is as important as the format. In addition to
expressing your appreciation for the interviewers time, a
thank-you note gives you another opportunity to summarize
your strengths, talk about highlights of the interview, confirm
your continued interest, and cover anything you did not
mention during the interview. Although your thank-you note
should center on professional content, you can reference a
personal topic that was discussed during the interview that
may help you stand out from other applicants. There is
no shame in name-dropping in your correspondence with A thank-you note should
recruiters and interviewers. Whether emailed or handwritten, accomplish the following:
your note should be proofread to ensure there are no errors.
Do not be surprised if an employer does not reply to a 1 Show your appreciation for the interviewers
thank-you note. A thank-you note is a professional courtesy time and information.
on your part and not a call to action for an employer.
2 Recap specific conversational highlights.

3 Reiterate your relevant skills and qualifications.

4 Follow up on a question that you werent pre-

pared for or confident about answering during
the interview, if applicable.

5 Highlight especially relevant or interesting

aspects of the organization; this is a great
opportunity to reflect on the organizations
mission.

6 Communicate your continued interest and

enthusiasm for the opportunity.

30
 05. INTERVIEWING

Dear Mr. Smith,

1
Thank you for taking the time to interview me yesterday for a position as a 2015 Corps
Member of Teach For America. I enjoyed learning more about the positive impact Teach
For America is making across the country, and I look forward to contributing to the
movement.
I left the interview with a heightened interest in the opportunity after learning more
2 about the growth you experienced as a Teach For America Corps Member. During the
interview, you asked what I hope to gain as a Corps Member. Upon further reflection, I
hope to enhance my teaching abilities while also securing my place in history as an educa-
4
tor, motivator, and leader.
Teach For America is where I want to launch my career within education. I am pas-

5
sionate about educational reform, and I am committed to ensuring access to a strong
education for all students. My leadership experiences at Northwestern have prepared me
for the challenges that I will face in the classroom. I am eager to make a real impact on
the world around me, and I am looking forward to utilizing my strengths as a leader to 3
motivate my students throughout their education. I believe that education is the key to our
worlds future, and I hope to instill a love of learning in my students.
Since the interview, my enthusiasm for Teach For America has only continued to grow.
6 Thank you for providing me with the opportunity to interview for this transformative role.
I look forward to hearing from you.

Sincerely,
Elizabeth Locke

Dear Ms. Wilde,

Thank you for taking the time to interview with me yesterday for the posi-
1 tion of Financial Services Representative with Pacific Insurance.
After speaking with you, I am even more excited about this opportunity
2 and I am confident that I can contribute to the initiatives of the Financial
Services team. Specifically, I am eager to use the skills I have developed in
my role as Vice President of Finance for Alpha Beta Gamma and the knowl-
edge I gained from my internship at Sue Reality. My organizational and 3
interpersonal skills will allow me to deliver the exceptional service that your
clients expect and deserve.
I would like to reiterate my strong interest in the position of Financial
Services Representative and joining your team. Thank you for providing me 6
the opportunity to interview, and I look forward to hearing from you soon.

Sincerely,
Susan Love
847-555-9876
susanlove@northwestern.edu

31
 06. FINDING JOB/INTERNSHIP OPPORTUNITIES
The most successful job and internship
seekers employ a variety of strategies.
They start the process early, focus their
pursuits, and develop an action plan.
They commit energy and time to the
search.
As a first step, you must define your end goal. You
will want to find the balance between being too broad
and too specific in your interests. When you focus too
broadly, your search may feel overwhelming, as every-
thing is a potential opportunity. When you focus too
narrowly, your search may feel like finding a needle in
a haystack. Instead, start by reflecting on what you are
looking to gain from the experience and what you want
in your future job or internship. Once you have defined
these, there are strategies for your action plan:
IDENTIFY OPPORTUNITIES ONLINE
The effectiveness of this common search strategy will
increase if you use some of these resources:
CareerCat and INET list employment opportunities
exclusively for Northwestern students. Northwest-
erns online search systems allow our students
to apply for full-time, internship, part-time, and
summer employment opportunities posted by
employers.
32
Niche job boards are maintained by professional
associations, chambers of commerce, regional
entities, and others. These websites are valuable
because they extract positions aligning with career
interests or geographical preferences.
Megasites are clearinghouses for opportunities of all
sorts. These sites extract a large variety of position
types and industries in diverse geographic regions.
Sites to use include Internships.com, Idealist.org,
and Indeed.com.
It is important to visit these websites frequently,
since opportunities are added daily. If a position
interests you, visit the employers website as well and,
if possible, submit your materials directly.
Do not rely solely on these websites, however;
many positions are not posted publicly, and for those
that are, competition will be great because of the large
number of applications.
SOURCE EMPLOYERS
Employer sourcing involves researching the potential
employers in your desired industry to target and pursue
opportunities. Develop a comprehensive list, including
employers that you are already aware of and those
that surface in your research. Online resources helpful
in developing your target list include Hoovers, Career
Search, LinkedIn, and Vault.
Visit the website of each employer on your list to
learn about current opportunities. If you find an oppor-
tunity, adjust your application materials accordingly
and submit your application. If there are no current
opportunities, network to establish a connection in
anticipation of future opportunities.
MOBILIZE YOUR NETWORK
Networking, the most important strategy in finding
employment opportunities, is discussed in detail in the
networking section. Establishing genuine networking
relationships is a constant process that should begin
well before your job or internship search and continue
even after you have secured a job.
 06. OPPORTUNITIES

Hiring activity cycles by industry

To effectively plan your search, it is important to know when different industries hire new employees and interns. Hiring
cycles vary by company and industry. Please consult with an NCA staff member to prepare strategies well in advance of
your desired industrys hiring cycle.
The tables below reflect typical hiring timeframes for internships and for full-time positions for June graduates. NCA
receives job and internship postings throughout the year for every industry.

AUG SEP OCT NOV DEC JAN FEB MAR APR MAY JUN JUL

Finance

Consulting
INTERNSHIPS

Engineering

Education, nonprofit

Government **
*

Advertising, marketing,
media, PR

Start-ups

AUG SEP OCT NOV DEC JAN FEB MAR APR MAY JUN JUL

Finance

Consulting
FULL-TIME JOBS

Engineering

Education, nonprofit

Government * **

Advertising, marketing,
media, PR

Start-ups

*Several government agencies have early application deadlines due to security clearances.

33
We would like to thank the sponsors
of Northwestern Career Advancement:

The Arch Level

Accenture
ALDI
Sodexo

Wildcat Level
AQR Capital Management
Deloitte
Grosvenor Capital Management
PwC
Strategy&

Purple and White Level

Goldman Sachs
L. E. K. Consulting

Rock Level
Visa

2014 Northwestern University.

Produced by University Relations.
11-14/7M/AE-MG-GD/1660-1