Rules released for
safe road tests of
self-driving cars
BUSINESS, PAGE 17
FRIDAY, April 13, 2018
President Xi Jinping, also general secretary of the Communist Party of China Central Committee and chairman of the Central Military Commission, reviews the PLA Navy’s parade on Thursday in the South China Sea. Right: The naval parade was
the nation’s largest, and included powerful vessels such as an aircraft carrier and nuclear-powered ballistic missile submarines and advanced aircraft. PHOTOS BY LI GANG AND MO XIAOLIANG / XINHUA
Xi reviews display of China’s naval prowess
Armada in the South China Sea
has 48 ships, subs and 76 aircraft
By ZHAO LEI
zhaolei@chinadaily.com.cn
The Navy carried out its
largest-ever parade on Thurs-
day morning in the South
China Sea, according to the
military. The massive display
was reviewed by President Xi
Jinping.
The spectacular parade,
involving more than 10,000
Navy personnel, was held to
mark the achievements of the
People’s Liberation Army Navy
‘Shared future’ vision provides answers
By AN BAIJIE
anbaijie@chinadaily.com.cn
The just concluded annual
conference of Boao Forum for
Asia is the first such meeting
since China’s commitment to
building a community with a
shared future for mankind was
written into the country’s Con-
stitution last month.
The vision, together with
China’s proposal to build “a
new type of international rela-
tions”, represents the country’s
effort to search for the answer
to a simple question: What
kind of future does humanity
wish to create?
In his keynote speech at the
opening of the conference on
Tuesday, President Xi Jinping
further explained the concept
Lam sets out vision of new-economy hub
By EVELYN YU in Hong Kong
evelyn@chinadailyhk.com
Hong Kong is set to trans-
form itself from an economy
based on traditional financial
services into a hub for innova-
tive, new-economy compa-
nies, Chief Executive Carrie
Lam Cheng Yuet-ngor told a
high-powered forum on the
internet economy on Thurs-
day.
The third Internet Economy
Summit, themed “New Impe-
tus for the New Economy”, dis-
cussed multi-pronged
strategies to harness innova-
tion and technology.
Leading internet companies
Is cake his secret?
Japanese retiree, 112, world’s
oldest man, has sweet tooth
WORLD, PAGE 14


over the past several years and
to strengthen the armed forces’
determination to build a
strong country and a world-
class military.
Xi, who is also general sec-
retary of the Communist Par-
ty of China Central
Committee and chairman of
the Central Military Commis-
sion, reviewed the warships
and aircraft from onboard the
CNS Changsha destroyer in
waters off Hainan province’s
southern coast. He was
of a community with a shared
future for mankind, which is
characterized by treating each
other with respect and as
equals, promoting dialogue
and sharing responsibility,
engaging in cooperation for
win-win results, upholding
inclusiveness and seeking har-
mony without uniformity, as
well as treating nature with
respect and treasuring the
planet.
He called for people around
the world to work together
toward a community with a
shared future for mankind and
to make Asia and the world
peaceful, prosperous, open and
beautiful.
The vision has increasingly
gained consensus worldwide.
On March 23, the United
and “unicorns” have become
heavyweight driving forces in
many economies, shaking up
the business landscape world-
wide with their disruptive
technologies. Authorities in
Hong Kong are set to revamp
the city, which has flourished
on traditional financial servi-
ces for decades, into a magnet
for new, high-growth indus-
tries that are at the cutting
edge of technology.
“Internet has led the world
into the digital era and created
a whole new economy as well
as countless business opportu-
nities,” Lam told the govern-
ment-initiated forum. “We
must keep reinforcing and
accompanied by all other
members of the Central
Military Commission.
In a speech after the parade,
the president demanded that
the Navy race against time and
make all-out efforts to become
a world-class force because of
the task’s pressing nature for
the country.
He stressed that a mighty
navy is an important pillar of
the great rejuvenation of the
Chinese nation, and he said the
Party and the Chinese people
are proud of the PLA Navy.
Xi asked members of the
Navy to uphold the Party’s lead-
ership, deepen military reform,
enhance innovation in science
Nations Human Rights Coun-
cil adopted the resolution titled
“Promoting Mutually Benefi-
cial Cooperation in the Field of
Human Rights” by a vote of 28
in favor, one against and 17
abstentions.
The resolution supports the
fostering of international rela-
tions based on mutual respect,
fairness, justice and mutually
beneficial cooperation, with
the aim of building a commu-
nity with a shared future for
mankind.
Yu Jianhua, head of the Chi-
nese mission to the UN, intro-
duced the resolution to the
council, saying, “We live on the
same planet, share common
interests and face the same
challenges, and we have
become an interdependent
upgrading our capability, as
well as providing a conducive
ecosystem for innovation and
technology development in
Hong Kong.”
Hong Kong policymakers
have introduced a flurry of ini-
tiatives to meet the needs of
the new economy. The Hong
Kong Stock Exchange is set to
overhaul its listing rules, open-
ing the doors to new-economy
firms that have yet to turn a
profit.
This sends a clear signal
that authorities are ramping
up reform efforts; for the first
time Hong Kong provides gen-
erous tax deductions of as
much as 300 percent for
and technology, develop new
types of fighting forces, build
modern naval warfare systems
and improve the capability to
undertake diversified military
operations.
He also ordered that the
Navy continue to focus on
combat training and remain
on high alert to safeguard
national interests and make
more contributions to the
peace and stability of the
region and the world.
An armada of 48 ships and
submarines including the CNS
Liaoning aircraft carrier took
part in the unprecedented
demonstration of the coun-
try’s naval prowess. The ves-
We live on the
same planet, share
common interests
and face the same
challenges.”
Yu Jianhua, head of the Chinese
mission to the UN
Inside
Comment > p9
community with a shared
future.”
Liu Huawen, a researcher of
research and development
expenditure enterprises incur.
The new economy was a key
part of Lam’s maiden Policy
Address delivered last year.
Since taking office on July 1
last year, Lam and the new
administration have come up
with a holistic approach —
ranging from more resources
for R&D and nurturing a tal-
ent pool to venture capital and
popular-science education —
to shore up Hong Kong’s com-
petiveness in innovation and
technology.
“I have set a goal to double
Hong Kong’s R&D expendi-
ture as a ratio to GDP to 1.5
percent by 2022 — or about
Player is No 1
Hollywood sci-fi movie tops
box office over holiday LIFE, PAGE 24
sels were mainly combat ships
such as Type 052D guided-
missile destroyers, Type 054A
guided-missile frigates and
Type 056 corvettes. Support
vessels like the Type 901 sup-
ply ship and Type 920 hospital
ship also participated.
At least two nuclear-pow-
ered ballistic missile subma-
rines took part in the parade.
Seventy-six naval aircraft
flew over the ships and sub-
marines. They included heli-
copters, fighter jets,
bombers and electronic war-
fare aircraft.
More than half of the
ships and submarines
involved in the parade had
international law at the Chi-
nese Academy of Social Scien-
ces, said the adoption of the
China-sponsored resolution
shows that the country’s wis-
dom is playing an important
role internationally.
“Chinese efforts in human
rights protection have been
recognized and have received
support from more countries,”
he said.
Visionary proposal
The proposal of building a
community was put forward
by Xi in March 2013, when he
spoke at Moscow State Insti-
tute of International Relations
during his first trip overseas as
president. Human society is
becoming a community of a
shared future, Xi said in his
speech.
During annual conferences
See Mankind, page 5
HK$45 billion a year,” the chief
executive pledged at the sum-
mit.
Lam told the forum that she
believed the four key technolo-
gy areas highlighted in the Pol-
icy Address — healthcare
technologies, artificial intelli-
gence and robotics, smart city
and fintech — can become
new economic drivers for
Hong Kong’s future develop-
ment.
The Internet Economy
Summit is an annual flagship
summit co-organized by the
Office of the Government
Chief Information Officer and
the Hong Kong Cyberport
Management Company.
Inside
See more > p3
www.chinadailyhk.com
been delivered to the Navy
since late 2012, when the
18th CPC National Congress
was held, according to the
military. The Navy has com-
missioned around 100 ships,
mostly large combat vessels,
and an unknown number of
submarines since then.
After the parade, Xi
watched the takeoff training
executed by four J-15 carrier-
borne fighter jets from the
Liaoning.
The last time the PLA Navy
hosted a parade was in April
2009, when it celebrated its
60th birthday. Twenty-five
Chinese ships and subma-
rines and 31 naval aircraft as
Ex-Chongqing chief
confesses at graft trial
TIANJIN — Sun Zhengcai,
former secretary of the Chong-
qing Municipal Committee of
the Communist Party of Chi-
na, stood trial on bribery char-
ges on Thursday at the First
Intermediate People’s Court of
Tianjin Municipality.
Sun also is a former mem-
ber of the Political Bureau of
the 18th CPC Central Com-
mittee.
An indictment by the first
branch of the Tianjin People’s
Procuratorate charges that
between 2002 and 2017, Sun
took advantage of his posts to
provide help for certain units
and individuals in project pro-
curement, enterprise opera-
tion and adjustment of official
positions, and accepted mon-
ey and property worth 170
million yuan ($27.04 million),
either by himself or through
“certain affiliated persons”.
During that period, Sun
served as CPC chief of Shunyi
district in Beijing, Standing
Committee member and sec-
retary general of the CPC Bei-
jing Municipal Committee,
© 2018 ChinaDaily , All Rights Reserved , Vol. 22 — No. 6537
A member of
the Asia News
Network

 $7
well as 21 vessels from 14 oth-
er countries participated in
the parade off Qingdao,
Shandong province. The
parade was reviewed by
former president Hu Jintao.
In another development,
the military will perform live-
fire drills in the Taiwan
Straits on Wednesday, accord-
ing to an announcement of
the Fujian Provincial Bureau
of Maritime Safety.
The administration re-
leased the coordinates of the
drill zone — a rectangular
area off the province’s east-
ern coast — on its website on
Thursday, asking ships to
stay out of the area.
agriculture minister, secre-
tary of the CPC Jilin Provin-
cial Committee, Political
Bureau member of the CPC
Central Committee and Party
chief of Chongqing Munici-
pality.
Prosecutors, along with
Sun and his defense attor-
neys, examined the evidence.
Both sides questioned the two
witnesses who testified in
court and fully expressed
their opinions, according to
the court’s statement.
In his final statement, Sun
said he deserved his punish-
ment and he had no objec-
tions to the charges.
He admitted his guilt,
repented for his wrongdoing
and said he would sincerely
submit to the court’s judg-
ment, according to the court’s
statement.
More than 130 people,
including lawmakers, politi-
cal advisers, journalists and
others attended the trial.
The court ruling will be
announced at a later date.
XINHUA
INSIDE
Blowup may
end career of
Juve’s Buffon
Sports, p16
 Friday, April 13, 2018

CH I N A DAI LY H O NG KO N G EDI TI O N

2 PAGE TWO
Looking ahead
Candid camera: Head over heels
Events and stories coming up in the next few days

Media briefing to highlight English-speaking finals to be

latest import, export data
On Friday, the State Council Information
Office will hold a media briefing in Beijing.
Huang Songping, spokesman for the
General Administration of Customs, is
expected to discuss import and export
figures for the first quarter. The event is
open to reporters from home and abroad.
International film festival to
hit screens across Beijing
The Beijing International Film Festival, one
of the country’s top movie events, will open
on Sunday. A total of 328 films are sched-
uled to hit the big screens across the capital
during the festival. The annual event, in its
eighth edition, will run until April 22.
held in Hangzhou university
Organized by China Daily, the grand finals
of the 21st Century National English-speak-
ing Competition will be held from Friday to
Sunday at Hangzhou Normal University in
Zhejiang province.
Henan set to serve up
women’s tennis open event
The Zhengzhou Women’s Tennis Open will
be held in Henan province from Saturday to
April 22. More than 100 players from 24
countries and regions will take part. The
event features both singles and doubles
draws. The tournament offers total prize
money of $125,000 and 160 ranking points
for the singles champion.

On chinadaily.com.cn
Visit for breaking news and exclusive content

Photos: Poignant images of Lifestyle: Fashion week sets a

Titanic disaster aftermath trend for young designers Palestinian youths practice their acrobatic skills in the Gaza Strip on Tuesday. SAID KHATIB / AGENCE FRANCE-PRESSE

On the Young
106th Chinese
anniversa- fashion
ry of the
day the
Titanic set
designers
are find-
ing their
Secret confessions of a new frog dad
sail from wings in
Southamp- the profes- I recently became a father, acts and what do I get in and I’m supposed to feed
ton on her sional and I have a confession to return? Zero. Nada. Not so them like it’s no big deal.
doomed world, as make: I’m not sure I like my much as a “thank you” or “What about your parents,
voyage, our website presents a recently more have returned to China after studying son very much. “see you later”. what’s going on with you
unearthed set of images from over a centu- abroad. During this year’s Shanghai Fash- First of all, he was born a And I’m also worried he two?” I ask them.
ry ago. The photos show how ion Week, from March 28 to April 3, one teenager, which is a hellish might have fallen in with a But they’re as bad as my
passenger liner Carpathia rushed to aid the section provided an exclusive platform for experience for any parent. bad crowd. There’s a little son. No answers.
ship after it struck an iceberg in the North young designers to show their expertise. The sullen silences. The mouse chick he hangs I’ve asked other parents
Atlantic. Images from the collection give a Rather than labeling themselves as “inter- indifference. around with sometimes. about this and they report
view from the deck of the Carpathia as national designers”, they preferred to The disap- Occasionally, when he can be similar incidents of inso-
lifeboats from the Titanic approached, and emphasize their cultural background. They pearing for bothered, he sends me post- lence. Apparently there is
another shows officers from the Carpathia are creating works based on their own days on end cards of them together, also a turtle who’s a major
working that day posing for a picture. tastes and ideas, instead of shadowing with not a traipsing around temples or culprit but I haven’t met him
Other shots from the tragic event show foreign designers and brands. word of hot springs, on my dime. But yet.
several survivors of the disaster. explanation I’m guessing they must argue On the plus side, my son is
Graeme or apology. I a lot because she often refus- quite creative. He’s always at
Culture: Dance drama creates Elder hear myself es to travel with him, judging his desk, writing. I have no
Biz: Tmall to set up baby care a wave of passion for Fujian Second turning into by the number of times he’s idea what, of course, he nev-
rooms in major cities Yang Liping, Thoughts my own alone in the pictures. er lets me read anything.
Tmall, an online retail platform operated by one of father, shout- But the one I really don’t My son, ignoring me as usual There’s always the possi-
Alibaba, announced recently that it plans to China’s most ing: “You treat this place like trust is a butterfly. That one inTravel Frog, a mobile game bility that I’m just jealous.
build or renovate 1,000 baby care rooms in famous a hotel!” Which is fine if is a total gold digger, leading created by Japanese company My son has a far better social
the next two years in major cities including dancers, has you’re on your own, but in him astray with her fancy Hit-Point. life than I do. Maybe I’m the
Beijing, Shanghai, and Hangzhou in Zheji- stepped into public? Not so much. Espe- wings. He doesn’t see her PROVIDED TO CHINA DAILY one with the problem.
ang province. The first such room was another role cially when you’re yelling it very often, probably because Because my son doesn’t seem
opened in Beijing. Before entering the as director at a phone screen. People on she’s off with one of her oth- looks suspiciously like a to have a care in the world.
room, parents can buy a diaper in a vending of a dance the subway tend to back er, richer boys. knife, but I try not to think
machine outside. The room is equipped drama on away. I’ve tried to warn him about that. Contact the writer at
with basic facilities such as a diaper-chang- ocean culture. Pingtan Impression focuses All he does is take. I spend about her, that she’s using And don’t get me started graeme@chinadaily.com.cn
ing table and a sofa. on the history of the sea and culture in every leaf of clover I have on him for his clover leafs, but on the snail kid or that bum-
Fujian province. “I want the audience to see food and gifts, and place he ignores me, as usual. He blebee. What a couple of Online
Society: Guangzhou guide and feel the traditional culture. The soul of them lovingly in his back- just slumps at the table, eat- freeloaders! They show up at Scan the code
Pingtan Impression is about local tradition pack as he prepares for ing the food I’ve made him the front door at all hours, to hear an audio
dogs give new leash of life and I hope we can use this dance drama to version.
Qian Xiao- another one of his vanishing or sharpening a pencil that completely unannounced,
show it,” Yang said.
hong runs a
blind
massage Rankings: Nine Chinese cities This Day, That Year
parlor in make top 100 financial hub list
Guangzhou, London remains the globe’s most attractive
Guangdong financial center, followed by New York and 1988, in China Daily (right). held there in
Since then, Hainan has 2001 and the
province, Hong Kong, according to the 23rd Global years become a magnet for invest- 18th edition
but her life Financial Centers Index. The index applied
has taken a five indicators in the assessment of the
on ment and has developed a just conclud-
new path since the beginning of the year. competitiveness of global large tourist infrastructure. ed on
That’s when she became the first person financial centers: Editor’s Note: This year The province’s GDP Wednesday.
aided by a guide dog called Duola from a Business environment, marks the 40th anniversary reached nearly 4.5 trillion The city
training camp in the city. Duola is one of human capital, of China’s reform and open- yuan ($716.6 billion) last also served
the “graduates” from the first training base infrastructure, financial ing-up policy. year, about 78 times of the as the venue
for guide dogs in Guangzhou. But Qian also development level and level in 1987, according to for the third
faced difficulties in her new life with Duola. reputation. Nine Chinese On April 13, 1988, the local authorities. BRICS Leaders Summit in receive more than 1.3 million
She said that she and Duola had been cities, including Hong Scan it! National People’s Congress, With the rapid economic 2011. overseas tourists in 2020.
blocked from boarding by public buses and Kong, Shanghai and Read the country’s top legislature, development and good cli- While attracting global The number of overseas
some passers-by liked to touch the dog. Beijing, made the list. more on gave Hainan island provin- mate, Hainan has proved attention, the island has been tourists to the province
“They must realize that a guide dog is not a Visit our website to find chinadaily. cial status and announced it itself an excellent host for making great progress toward exceeded 1.1 million last year,
pet, it is working,” Qian said. out more. com.cn had been designated a spe- major events after a series of its goal of becoming a world- up nearly 50 percent year-
cial economic zone, as seen high-profile activities. class tourist destination. on-year, according to statis-
in the item from April 20, The first Boao Forum was It has set a target to tics from local authorities.

FRI - SAT APRIL 13-14

-6/2 Beijing 7/10 D 6/19 C Shanghai 15/20 D 17/17 R
-1/17 -9/11 Changchun 0/14 C 5/10 D Shenyang 1/14 D 4/13 D
9/19 Changsha 17/19 R 14/17 Sh Shenzhen 23/29 C 24/29 C
Chongqing 19/20 R 14/18 D Shijiazhuang 10/12 D 7/18 O
7/10 Dalian 8/16 D 6/13 R Suzhou 12/21 R 8/20 S
6/19 Fuzhou 21/30 D 22/32 D Taipei 23/30 C 23/31 C
6/18 Guangzhou 23/30 C 24/30 C FRIDAY
Taiyuan 9/16 D 3/14 S
9/14 Guilin 20/27 Sh 17/19 D Tianjin 8/11 R 4/16 O SATURDAY
12/20
10/17 Guiyang 17/28 O 10/16 T Urumqi -1/17 S 9/19 S
15/17 Haikou 24/36 C 24/35 C Wuhan 15/21 R 12/17 D
9/18 15/20
17/17 Hangzhou 17/23 Sh 17/20 R Xi'an 9/11 D 5/19 O
22/36 Harbin -3/13 Sh 3/9 R Xiamen 22/31 C 23/32 C Abu Dhabi 23/38 C 25/36 C BuenosAires 16/19 S 10/22 S
19/35 23/30 Hefei 16/19 T 10/17 T Xining -1/3 R/Sn -3/9 R/Sn
23/30 23/31 Bangkok 28/36 D 28/36 S Caracas 25/26 D 26/27 D
24/30 Hohhot 7/14 C 0/13 C Yantai 8/15 O 6/11 R Colombo 25/31 D 25/32 D Chicago 7/13 D 9/10 R
23/38 Hongkong 24/30 C 24/30 C Yinchuan 8/14 O 2/14 C Dubai 25/36 C 27/36 C Houston 23/24 D 23/24 D
24/30 Jinan 8/17 D 6/17 D Zhengzhou 10/11 R 9/19 O
23/39 24/30 Hanoi 22/35 D 23/30 S Las Vegas 15/18 S 11/19 S
Kunming 13/26 C 12/24 Sh Zhuhai 23/29 C 23/28 C Islamabad 15/31 C 17/31 C Los Angeles 12/19 S 13/20 S
Lanzhou 3/10 D 3/12 C Jakarta 26/32 D 26/32 D Mexico city 16/19 S 17/20 C
28/36 Lhasa 4/17 Sh 3/17 C
28/36 Karachi 25/38 C 24/38 O New York 6/15 D 15/20 D
Lijiang 10/22 C 9/21 C Kuala Lumpur 24/29 D 24/29 D Ottawa -3/4 Sn -3/0 Sn
25/34 Macao 23/27 C 23/26 C Rio De Janeiro 24/25 C 24/25 D
26/37 25/34 27/35 Manila 27/35 D 25/35 D
25/35 Nanchang 21/25 R 14/17 R Mumbai 23/34 S 22/33 D San Francisco 9/13 S 8/15 S
26/37 Nanjing 15/19 Sh 12/16 Sh Athens 13/23 D 13/24 D
Berlin 10/13 D 9/14 D New Delhi 22/36 S 19/35 C Sao Paulo 16/24 C 16/20 C
Nanning 23/33 C 21/29 O Pyongyang 3/19 O 8/15 D Vancouver 2/7 R 6/9 R
24/29 Qingdao 10/13 O 9/14 D Brussels 6/11 C 4/12 O
24/29 Geneva 6/9 D 5/10 D Riyadh 18/31 S 15/29 S Washington 14/22 S 16/22 C
Sanya 25/33 C 24/34 T Seoul 6/18 O 9/14 R
Istanbul 13/21 S 10/19 D
25/28 London 0/2 R/Sn 1/6 R/Sn Singapore 25/28 D 25/28 D
25/28 Madrid 3/7 Sn -1/11 R/Sn Sydney 22/32 S 22/32 S Cairo 16/33 S 18/30 S
Moscow 0/12 R/Sn -1/12 R/Sn Teheran 14/16 D 12/13 D CapeTown 15/22 D 17/25 D
26/32 Paris 8/11 D 7/14 D Tokyo 12/20 C 10/17 C Johannesburg 10/21 D 10/22 S
26/32 Rome 12/13 D 11/14 D Wellington 12/15 D 12/15 D Lagos 27/27 D 25/28 D
Vienna 10/13 D 9/16 C Yangon 23/38 C 23/39 S Nairobi 16/26 D 17/26 D
 CH INA DAILY HONG KONG EDIT ION Friday, April 13, 2018
TOP NEWS
Premier Li Keqiang escorts Prime Minister Mark Rutte of The Netherlands before an honor guard in the Great Hall of the People in
Beijing on Thursday. The two men discussed free trade and other topics. FENG YONGBIN / CHINA DAILY
Dutch share multilateral trade goals
By HU YONGQI
huyongqi@chinadaily.com.cn
China would like to work
with the Netherlands and
other EU countries to safe-
guard the multilateral trade
system guided by the World
Trade Organization and firm-
ly support multilateralism
and free trade, Premier Li
Keqiang told visiting Dutch
Prime Minister Mark Rutte
on Thursday.
The international commu-
nity is confronted with uncer-
tainties and instability and
countries should make eco-
nomic globalization a more
open, inclusive and balanced
one, Li said.
Li congratulated Rutte on
his election victory last year.
“You are welcome to visit Chi-
Despite objections, looted Chinese
urn sold at UK auction for $581,000
By BO LEUNG in London
boleung
@mail.chinadailyuk.com
A rare, 3,000-year-old
bronze vessel thought to have
been looted from the Old
Summer Palace in Beijing in
1860 has fetched 410,000
pounds ($581,000) at auction
in Kent, in the south of
England.
The water vessel, dating
from the Western Zhou
Dynasty (c. 11 century-771 BC),
was sold at The Canterbury
Auction Galleries despite pro-
tests from China’s State
Administration of Cultural
Heritage, which said that it
strongly opposed and con-
demned the sale of looted
property.
China’s national cultural rel-
ics watchdog demanded the
item be withdrawn from sale
Nation ready for heavier trade friction
By ZHONG NAN
and REN XIAOJIN
China is prepared and will
not hesitate to fight “till the
very end” if the United States
insists on unilateralism and
protectionism, the Com-
merce Ministry said on
Thursday.
Government officials from
the two countries have not
engaged in any negotiations
concerning the trade friction,
said Gao Feng, Commerce
Ministry spokesman.
“There are procedures to
follow for negotiations to get
started. But the US side has
not shown any sincere will to
negotiate yet,” Gao said.
“China is well prepared for
further actions taken by the
US and will resolutely fight
na again,” the premier said.
“Your participation in the
Boao Forum for Asia (in Hai-
nan province) and this official
visit demonstrates the impor-
tance you have attached to
relations with China.”
The Netherlands is a vital
trade partner with China
under the framework of the
European Union, Li said.
President Xi Jinping paid a
state visit to the country in
2014 and both countries
announced the beginning of
an open and pragmatic com-
prehensive partnership, the
premier said.
The two countries should
enhance cooperation in agri-
culture, finance, and technol-
ogies, in addition to people-
to-people exchanges, Li said.
China would like to import
and called for buyers to boycott
the auction.
Despite China’s objections,
the sale of the Tiger Ying,
named because of its tiger
motif, went ahead with the
opening bid at 120,000
pounds. There were eight tele-
phone bidders and the ham-
mer came down at more than
three times the opening bid.
It is thought that only six
similar vessels, known as ying,
exist and five of those are in
museums. Ying refers to an
ancient type of water vessel.
Hajni Elias, a Chinese art
and cultural historian who
helped research the origins of
the Tiger Ying, described it as
“special and unequaled”.
“We cannot underestimate
the wealth and sophistication
of the late Zhou culture that
created such an outstanding
bronze vessel,” she said. “Only
back if the US insists on unilat-
eralism,” Gao added.
Gao also said the country’s
continued opening-up meas-
ures announced this week
have nothing to do with the
trade friction with the US.
“I hope some people in the
US do not misjudge the situa-
tion,” Gao said.
Such major strategic deci-
sions are made based on an
accurate estimate of the coun-
try’s current development lev-
el in order to elevate opening-
up in the new era to a higher
level, Gao said.
“No one has the right to say
why China does anything. The
opening-up strategy came nat-
urally during the develop-
ment, and I don’t think China
is doing so to deal with the
trade war. The motivation is
more agricultural and high-
tech products from the Neth-
erlands and welcomes
investments made by Dutch
companies, he said.
Li called on the Nether-
lands to take a greater role in
the Belt and Road Initiative
and promote negotiations on
a bilateral investment treaty
between China and the EU
for balanced economic ties.
Li said China will open its
door wider and hopes other
countries, including the Neth-
erlands and other EU nations,
further open up as well to
achieve win-win outcomes
and economic diversity.
Rutte said the Netherlands
firmly supports free trade
and opposes protectionism. It
safeguards multilateral trade
systems tied to the WTO. The
Chinese bronze water vessel
— Tiger Yin — had been taken
from the Summer Palace.
CANTERBURYAUCTION / BNPS
men of high status, such as
kings, nobles and officials were
able to obtain them.”
Documents found by the
auction house suggest that
Royal Marines Captain Harry
Lewis Evans (1831-83) took the
vessel from the Old Summer
Palace, also known as the Yuan-
mingyuan, at the end of the
Second Opium War, when it
was destroyed and sacked by
for better development,” said
Bhattacharya Amar, a senior
researcher at the Brookings
Institution, a US think tank.
“China is facilitating global
trade through the Belt and
Road Initiative. What we have
seen in the trade frictions
between China and the US is a
negative side where people say
global trade causes problems.
You need certain rules to the
game so that both sides of
trade feel they benefit,” he said.
The trade unilateralism and
protectionism employed by
the administration of US Pres-
ident Donald Trump will push
more countries to unite and
protect the World Trade Orga-
nization’s rule-based multilat-
eral trading system, said Tu
Xinquan, director of the China
Institute for WTO Studies at
EU country would like to
enhance strategic alignment
with China and reach an
EU-China investment treaty
as soon as possible, he said.
Rutte said the Netherlands
sent four trade missions to
China during his visit, the
biggest ever organized by his
country.
“The Netherlands is Chi-
na’s third-largest European
trading partner. … The base is
strong and there is so much
we can do in the future,” the
Dutch prime minister said.
The prime minister said his
country has maintained high-
level ties with China and both
countries should strengthen
high-level dialogues and
pragmatic cooperation to
move bilateral ties and China-
EU ties to a new stage.
British and French troops in
1860.
In letters home, Evans
described the looting of the
Yuanmingyuan and wrote, “I
succeeded getting bronzes and
enamel vases that will, I hope,
some day find their way to [his
home in UK].”
Chinese academics have
called the ransacking of the
Old Summer Palace a symbol
of shame for people in China
for many years.
In a statement last week, the
State Administration of Cultur-
al Heritage said, “We hope the
related institutions will abide
by the spirit of international
agreements, respect the feel-
ings of the people in the coun-
try where the relic is originally
from and not trade looted rel-
ics.” The agency had not com-
mented on the sale by
deadline.
the University of International
Business and Economics in
Beijing.
The US policies have led to
negative impacts for all par-
ties, especially to manufactur-
ing powerhouses like China,
Germany, the Republic of
Korea and India, Tu said.
The Commerce Ministry
also said that China will com-
plete a revision of the negative
list for foreign investment in
the first half of this year. Areas
not on the negative list are
presumed to be open to for-
eign investors.
Contact the writers at zhong-
nan@chinadaily.com.cn
Inside
Comment > p9
Online healthcare
on its way, Li says
Premier, State Council let hospitals
interact with patients via internet
By XU WEI
xuwei@chinadaily.com.cn
China will greenlight inter-
net medical services conducted
by medical institutions as part
of a broader push to promote
Internet Plus healthcare, those
at a State Council executive
meeting chaired by Premier Li
Keqiang decided on Thursday.
Medical institutions will be
allowed to provide online diag-
nostic services for some com-
mon and chronic diseases in
patients’ follow-up visits to
their doctors, according to a
decision made at the meeting.
The top two levels of hospitals
within the country’s three-tier
system will be encouraged to
provide online services, includ-
ing consultations, reservations
and test result inquiries.
“The development of Inter-
net Plus Healthcare is a major
initiative to enhance our coun-
try’s public health services. It
will also help facilitate overall
economic and social develop-
ment,” Li said.
“As China joins the ranks of
middle-income countries, the
demand for health services has
increased substantially. Inter-
Lam to intensify focus on innovation
By HE SHUSI in Hong Kong
heshusi@chinadailyhk.com
Chief Executive Carrie Lam
Cheng Yuet-ngor on Thursday
said her government would
intensify and upgrade Hong
Kong’s innovation and tech-
nology development to trans-
form the Guangdong-Hong
Kong-Macao Greater Bay Area
into an innovation and tech-
nology hub.
Addressing the Internet
Economy Summit, Lam said
the special administrative
region would make full use of
the planned Hong Kong-
Shenzhen Innovation and
Technology Park in the Lok
Ma Chau Loop. It would carry
out complementary develop-
ments with other mainland
cities to achieve this goal.
Lam said her administra-
tion had set aside HK$50 bil-
lion for I&T development; HK
Team effort
Workers set up the giant circus tent for Cirque du Soleil’s KOOZA clown and acrobatic show at the Central
Harbourfront Event Space on Thursday. The show will run from April 19 to June 3. ROY LIU / CHINA DAILY
Duterte apologizes for 2010 hostage crisis
By CHINA DAILY
in Hong Kong
Philippine President Rodri-
go Duterte apologized on
behalf of his country for the
tragic 2010 hostage crisis in
Manila, which left eight Hong
Kong people dead.
Duterte, who is on a three-
day private visit to Hong Kong,
said he would ensure such an
Internet Plus
Healthcare is a
major initiative to
enhance ... public
health services.”
Premier Li Keqiang
net Plus Healthcare can help
alleviate the problem of inac-
cessible and expensive public
health services that have long
been a big concern for the gen-
eral public,” he said.
According to the Healthy
China 2030 Blueprint released
by the Party Central Commit-
tee and the State Council, Chi-
na’s Cabinet, in October 2016,
efforts will be made to foster
new industries, new forms and
models of business in the
health sector and to develop
internet-based health services.
One decision coming out of
the meeting says the intelligent
review for health insurance
$10 billion of this will be used
for technological research
infrastructure.
On Wednesday, the Legisla-
tive Council’s Public Works
Subcommittee passed an
appropriation worth almost
HK$800 million for early
infrastructure work on the
Lok Ma Chau Loop.
The park adjacent to Shenz-
hen will be the largest-ever
innovation and technology
project in Hong Kong. The
cooperative venture between
the SAR and Shenzhen is seen
as a major research center in
the Bay Area.
Cheung Chi-kong, executive
director of the One Country
Two Systems Research Insti-
tute, echoed Lam’s comments.
He said the Lok Ma Chau
Loop, as well as the Chung
Ying Street shopping area on
the Shenzhen-Hong Kong
boundary, could be perfect
incident never happens again.
He made the remarks while
meeting members of the Fili-
pino community in the special
administrative region on
Thursday.
Benigno Aquino III, presi-
dent at the time when the inci-
dent occurred, refused to
apologize, saying a formal
apology would only create
legal liability for Manila.
3
will be vigorously applied and
the one-stop settlement will be
advanced. The real-time shar-
ing of prescription and drug
retail sales within medical
institutions will be explored, as
well, and the system of Internet
Plus healthcare standards will
be further refined.
Interconnectivity and shar-
ing of medical information will
be accelerated, those at the
meeting determined, and the
quality supervision of medical
services and information secu-
rity will be strengthened.
“We must waste no time in
pushing forward the measures
once the decision is made,” Li
said. “In recent years, top-level
hospitals in major cities have
seen steady increases in the
number of outpatients. Medi-
cal bills have become a heavy
burden on families and high-
end medical resources still fall
short of meeting the growing
demand of the public.”
To solve the problem, he said,
a two-pronged approach must
be taken. One is to establish
medical partnerships such as
healthcare consortia to
enhance cooperation and coor-
dination between major hospi-
tals and community clinics.
The other is to bring forward
Internet Plus Healthcare to
facilitate the sharing of quality
medical resources.
experimental zones for inno-
vative policies in the Bay Area.
Cheung made these
remarks at a seminar on Hong
Kong’s role in the Bay Area
organized by the institute in
cooperation with the think
tank Center for China and Glo-
balization. He suggested the
government enhance talent
mobility by providing conve-
nient visa policies, work per-
mits and simplified tax
systems.
Houston Huang Guobin —
JP Morgan’s head of global
investment banking for China
— who is based in Hong Kong
agreed. He said the SAR hasn’t
done enough to retain first-
class high-tech talents to work
and settle down in the city.
He said improved policies
could help talents focus on sci-
entific research and encour-
age them to start their own
business.
Seven Hong Kong tourists
and their tour guide were
killed when a former Filipino
police officer hijacked a Hong
Thai Travel coach and opened
fire after a standoff with police
on Aug 23, 2010.
Manila authorities were
widely criticized for their
botched handling of the
hijacking — which also left
seven people injured.
4
CHINA
Friday, April 13, 2018
CHINA DAILY HONG KONG EDITION
Science academy launches cloud platform
Powerful data-crunching tool will allow
researchers to accelerate achievements
By ZHANG ZHIHAO
zhangzhihao@chinadaily.com.cn
The Chinese Academy of
Sciences launched one of its
most advanced scientific
cloud platforms on Thursday,
to provide scientists with
accessible, accurate and
secure data services to drive
research and innovation, offi-
cials and scientists said.
The China Science and
Technology Cloud, or CSTC,
draws data from the acade-
my’s research institutes and
High-tech bank
without clerks
opens in Shanghai
By WANG ZHENGHUA
in Shanghai
wangzhenghua@
chinadaily.com.cn
An “unmanned”, fully
automated bank outlet that
opened on Monday in Shang-
hai is receiving positive feed-
back from customers —
especially younger ones.
The facility, installed by
China Construction Bank’s
Shanghai branch on Jiuji-
ang Road in the downtown
district, is self-service —
replacing the counters and
busy clerks at conventional
banks — using robots,
ATMs, a foreign exchange
machine and an assortment
of multimedia tools.
It comes at a time when
concepts like mobile inter-
net, big data and artificial
intelligence have become
inseparable to Chinese peo-
ple’s everyday lives. Visitors
attracted by the human-free
concept arrived in streams
on Thursday.
Hong Yumei, a tourist
from Fujian province who
came into the facility to with-
draw some cash, said she was
lured both by the self-service
and guidance of robots.
“At conventional bank out-
lets you have to tolerate the
long faces of clerks from time
to time,” she said. “But here I
don’t have such problems.”
Cao Dongliang, who works
for a healthcare company,
said he believed the concept
will be well-received, so it’s
not a publicity stunt.
“In addition to financial
services, I hope the self-ser-
vice bank will integrate a
wide range of civil services
and become more diversi-
fied,” Cao said.
Lu Bin, a clerk from anoth-
er bank, said she wasn’t con-
cerned that the self-service
bank would eliminate her job.
“I am glad that the emer-
gence of an unmanned bank
will help reduce customers’
reliance on human opera-
tors. It’s not a concept that’s
Customers interact with a robot at an “unmanned” bank outlet
in Shanghai on Thursday. GONG QIANQI / FOR CHINA DAILY
major scientific installations,
as well as many of China’s top
universities and private inno-
vation centers.
“Big data, cloud computing
and artificial intelligence are
now the three chariots driving
cutting edge information tech-
nology worldwide,” said Wang
Shuzhi, deputy director of the
academy’s general office.
The CSTC combines all
three fields into a single, mas-
sive platform that “will pro-
vide strong data and cloud
computing services to help
sprung into being suddenly.
Many people already deal
with wealth management
and money transfers on their
mobile phones,” she said.
The 165-square-meter out-
let is divided into reception,
financial services, civil
affairs services and intelli-
gent socialization sectors.
China Construction Bank
said the variety of self-service
machines — assisted by cut-
ting-edge technologies, such
as robots, voice recognition,
augmented reality, face recog-
nition, voice navigation and
holographic projection — can
process more than 90 percent
of the cash and noncash busi-
ness of a conventional bank.
Customers visiting the
bank for the first time need
to slide an ID card or bank
card to get in through a
turnstile. Then their facial
information is collected and
they can proceed with
almost any kind of transac-
tion. They do not need to
show their credentials or
mobile phones again.
Another highlight of the
automated bank is a robotic
guide that can understand
and reply to all kinds of ques-
tions in Mandarin. When
asked if it can speak Shang-
hai dialect, the robot
answered: “I am a new
Shanghainese and I do not
speak the regional dialect.”
In addition to the robots, a
few bank employees and a
security guard were around
to provide help.
“We are here because it’s
newly opened and people
may have all kinds of ques-
tions and need assistance,”
said an employee who asked
not to be named, citing com-
pany rules. “But we don’t put
our hands on any of the
machines, as conventional
clerks do.”
Online
See more by
scanning the
code.
China become a technological
powerhouse,” he said.
It was created at the acade-
my’s Computer Network
Information Center.
Applications are divided
into five broad categories:
data resources, cloud comput-
ing with AI and supercomput-
ers, research software support,
research community net-
works and outreach to foreign
scientists and platforms.
“The CSTC aims to become
the go-to platform to satisfy
most data and cloud service
needs from scientists and
innovators in China,” said Liao
Fangyu, director of the infor-
mation center.
“We have entered an age in
Repair work
Workers shore up a section of a railway bed that collapsed in Wuhan, Hubei province, on Thursday. The collapse occurred at about 1 am and
resulted in the suspension of 20 trains on the Beijing-Guangzhou line. High-speed trains running between the two cities were not affected.
The collapse was triggered by nearby construction work, according to the Wuhan Railway Bureau. MIAO JIAN / FOR CHINA DAILY
Specialist prosecutors improve court efficiency
By ZHOU WENTING
in Shanghai
zhouwenting@chinadaily.com.cn
Shanghai courts have
improved their efficiency in
handling complex cases, ran-
ging from juvenile crime to
finance, after setting up teams
of specialist prosecutors,
according to a senior official.
The city established four
small groups in Pudong New
Area in March last year to
focus on the rising number of
cases involving finance, intel-
lectual property, abuse of pow-
er and juveniles.
Over the past year, the
Flowers on moon? Chang’e 4 will 100,000
place ‘mini biosphere’ experiment people
China’s Chang’e 4 lunar
probe is expected to conduct
many groundbreaking tasks
after its launch later this year,
including the first biological
experiment on the lifeless
lunar surface, after making a
soft landing on the far side.
The probe will carry a tin
containing the seeds of pota-
toes and arabidopsis, a small
flowering plant related to cab-
bage and mustard — and
probably some silkworm eggs
— to see how they respond in
the “lunar mini biosphere”.
Chongqing University led the
project with 27 other Chinese
universities participating.
The cylindrical tin, made
from a special aluminum alloy,
which scientific discoveries
often require crunching a
large amount of data. This is
only possible with powerful
computing hardware and soft-
ware,” Liao said. “The CSTC
will bolster China’s innovation
capabilities and help create
more original and influential
scientific achievements.”
Li Jun, a researcher at the
center and one of the key com-
puter engineers behind the
cloud service, said the plat-
form already has more than
600,000 registered users and
will continue to improve to
satisfy ever-growing research
needs.
“The platform is the cor-
nerstone of the academy’s
number of cases concluded by
these groups has far sur-
passed that of their col-
leagues, according to Zhang
Bencai, director of the Shang-
hai People’s Procuratorate,
the city’s top prosecuting
authority.
“Such groups also allow
prosecutors to quickly
become more professional in
cases of a particular type, put-
ting them on a fast track to
becoming experts,” he said in a
recent interview with China
Daily.
“Moreover, approval and
administrative procedures for
the leaders of each group have
is 18 centimeters tall and has a
diameter of 16 cm. The tin will
also contain water, a nutrient
solution, air and equipment
such as a small camera and
data transmission system.
Researchers hope the seeds
will grow and blossom on the
moon, with the process cap-
tured on camera and transmit-
ted to Earth.
Although astronauts have
cultivated plants on the Inter-
national Space Station, and
rice and arabidopsis have been
grown in the Tiangong 2 space
lab, those experiments were
conducted in low-Earth orbit.
Liu Hanlong, chief director of
the experiment and vice-presi-
dent of Chongqing University,
Big data, cloud computing and artificial intelligence
are now the three chariots driving cutting edge
information technology worldwide.”
Wang Shuzhi, deputy director of the Chinese Academy of Sciences’ general office
effort to improve its data-re-
lated services and applica-
tions,” he said. “It also
promotes data sharing and
transparency, so the next gen-
eration of young scientists
can use our data to help their
research.”
Zhou Guangqing, a time. It also allows research-
researcher at the academy’s
Institute of Atmospheric
Physics, said the cloud plat-
form allowed faster and more
accurate climate simulations,
thanks to its wealth of data
and muscular processing
powers.
“Data about Earth’s climate
is so massive and complicated
that scientists typically rely on
math models to glimpse into
been streamlined as much as
possible.”
The requirements for the
team leaders were strict, he
said. Each person had to have at
least 10 years of experience as a
prosecutor and at least six years
in the particular case field.
Team assistants also have to
be potential successors, Zhang
added, and the leader must be
a role model to lead and teach
them, so as to cultivate future
professional talent.
Wu Juping, who leads the
team specializing in financial
crimes and intellectual prop-
erty, said her team members
include two prosecutors with
said that since the moon has no
atmosphere, its temperatures
range from below -100 C to
more than 100 C.
“We have to keep the temper-
ature in the mini biosphere
within a range from 1 C to 30 C,
and properly control the
humidity and nutrition. We
will use a tube to direct the nat-
ural light on the surface of
moon into the tin to make the
plants grow,” said Xie Gengxin,
the experiment’s chief designer.
“We want to study the res-
piration of the seeds and pho-
tosynthesis on the moon,” Liu
said.
“Why potato and arabidop-
sis? Because the growth period
of arabidopsis is short and
complex physical or chemical
phenomena, which can lead to
a large margin of error,” Zhou
said.
Using the platform, scien-
tists can simulate climate
change on a larger scale or
across a greater period of
ers to add data from other sci-
ence fields — marine science
or the carbon cycle, for exam-
ple — into the simulation to
create “a more accurate and
comprehensive big picture”,
Zhou said.
“The platform will play a
major role in improving our
weather research and disas-
ter predictions, which will be
invaluable to society,” he said.
nearly 10 years of experience
in the field, two assistants with
excellent work performance
and a secretary.
Wu said that as leader of the
group she is authorized to
decide on case management
and administration in 22 are-
as, including how to prosecute
a case.
“I independently made deci-
sions for more than 80 percent
of the cases handled by my team
last year and in most of them
the accused were eventually
found guilty in court,” she said.
Shi Jinglan, a prosecutor
for more than two decades
and leader of another team,
wrote down their hopes for
China’s lunar and space
exploration.
convenient to observe. And
potatoes could become a
major food source for future
space travelers.”
Members of the public, espe-
cially young people, are being
encouraged to participate in
the Chang’e 4 mission. The
China National Space Admin-
istration launched a contest
for students across China in
2016, collecting ideas on the
design of the craft’s payload.
The lunar mini biosphere
experiment was selected from
more than 200 submissions,
according to the CNSA.
Briefly
BEIJING
Innovation forum
opens for ASEAN
The 2018 ASEAN-China
Year of Innovation and
Forum of Innovation kicked
off in Beijing on Thursday.
The events were co-orga-
nized by China’s Ministry of
Science and Technology, the
Ministry of Foreign Affairs
of Singapore and the
ASEAN Secretariat. “The
development of China
needs the engagement of
ASEAN members, and so
does the development of
ASEAN members,” said
Wang Zhigang, minister of
the science and technology.
LIAONING
Former vice-mayor
is investigated
A former executive vice-
mayor was involved in seri-
ous violations of law and
discipline, according to the
website of the Central Com-
mission for Discipline
Inspection. Yuan Keli, 58,
former Standing Commit-
tee member of the Dalian
Municipal Committee of the
Communist Party of China
and former executive vice-
mayor of Dalian, Liaoning
province, is currently facing
a disciplinary review and
supervisory investigation.
JIANGSU
Bus-car crash
kills seven
A bus rolled and struck a
car on an expressway on
Thursday, killing seven peo-
ple, according to the local
government. The crash
happened at around 4 pm
on an expressway section in
Lianyungang’s Donghai
county. The bus crossed the
median and struck the car
head-on, according to the
county government. Seven
people have been con-
firmed dead; the number of
people injured was not
clear, but those hurt were
taken to the hospital.
XINHUA — CHINA DAILY
said the pilot project had giv-
en them a stronger sense of
responsibility in each case.
Zhang said teams specializ-
ing in cases related to the
Shanghai Free Trade Zone and
those involving destruction of
environmental resources will
be established this year.
Shanghai’s judicial authori-
ties have also said they will
carry out calculations to set a
reasonable number of cases
that a judge should be able to
deal with in a year.
“The average number of cas-
es handled by a Shanghai
judge climbed to 261 last year,
which topped the country, and
judges said they felt a lot of
pressure,” said Liu Xiaoyun,
president of Shanghai High
People’s Court.
Tidal forces on Earth have
slowed the moon’s rotation to
the point where the same side
always faces the earth, a phe-
nomenon called tidal locking.
The other side is not visible
from the earth.
With its special environ-
ment and complex geological
history, the far side of the
moon is a hot spot for scientif-
ic and space exploration. How-
ever, landing and roving there
requires a relay satellite to
transmit signals.
The Lunar Exploration and
Space Program Center of the
CNSA has invited the public to
write down their hopes for
lunar and space exploration,
and those hopes and the
names of participants will be
carried by the relay satellite
into deep space. More than
100,000 people have taken
part, the center said.
XINHUA
 CHINA DAILY HONG KONG EDITION Friday, April 13, 2018
Mankind: Xi’s concept
used in UN resolutions
From page 1
of the Boao Forum for Asia
from 2013 to 2015, Xi proposed
to create the mentality of a
community with a shared
future, march to a community
with a shared future, build a
community with a shared
future for Asia and build a com-
munity with a shared future for
mankind.
On Jan 18, 2017, Xi made a
keynote speech at the United
Nations Office at Geneva titled
Work Together to Build a Com-
munity with a Shared Future
for Mankind, offering China’s
solutions to cope with global
challenges.
“Building a community with
a shared future is an exciting
goal, and it requires efforts
from generation after genera-
tion,” Xi said. “China is ready to
work with all the other UN
member states as well as inter-
national organizations and
agencies to advance the great
cause of building a community
with a shared future for man-
kind.”
The president’s speech drew
strong and positive feedback
from the international commu-
nity. A month later, the Chinese
concept of building “a human
community with a shared des-
tiny” was incorporated into a
UN resolution for the first time
at the 55th UN Commission for
Social Development.
While delivering a speech at
the closing meeting of the first
session of the 13th National
People’s Congress in March, Xi
said that China will contribute
more Chinese wisdom, Chi-
nese solutions and Chinese
strength to the world and push
for building an open, inclusive,
clean and beautiful world that
enjoys lasting peace, universal
security and common prosper-
ity.
“Let the sunshine of a com-
munity with a shared future for
humanity illuminate the
world,” Xi said.
Pushing forward building a
community with a shared
future for mankind was
enshrined in the amendment
to the Constitution during the
session of the top legislature.
Xi, as the chief architect of
China’s major-country diplo-
macy, has been personally
involved in planning and con-
ducting “brilliant” head-of-
state diplomacy, Foreign
Minister Wang Yi said at a
news conference on the side-
lines of the first session of the
13th National People’s Con-
gress.
Xi has visited 57 countries
and received more than 110 for-
eign heads of state, which not
only has deepened the world’s
understanding of China, but
also enhanced China’s profile
and influence and facilitated
the solution to many global
problems, Wang said.
Xi also will attend the BRICS
Summit in South Africa, the
Asia-Pacific Economic Cooper-
ation Economic Leaders’ Meet-
ing in Papua New Guinea and
the G20 Summit in Argentina
this year, Wang said.
Put into practice
Through such efforts as pro-
posing and implementing the
On province’s birthday, poverty reduction captures the spotlight
TIDES OF
CHANGE
IN HAINAN
By MA ZHIPING
and LIU XIAOLI in Haikou
Hainan province is taking a
series of steps to help eradicate
poverty by 2020, in line with
the central government’s pov-
erty reduction plan.
In the past five years, the
local government helped
617,000 people got out of pov-
erty, and another 83,000 peo-
ple will follow suit this year.
Of Hainan’s total population
of 9.3 million, about 477,000
remained below the poverty
line in 2017. The national pov-
erty line is an annual income of
2,300 yuan ($366) per capita.
Hainan, China’s youngest
Belt and Road Initiative, China
has translated the proposal of
building a community with a
shared future into practice.
The initiative, comprising
the Silk Road Economic Belt
and the 21st Century Maritime
Silk Road, aims to build trade
and infrastructure networks
connecting Asia with Europe,
Africa and beyond via overland
and maritime routes.
Since Xi put forward the ini-
tiative in 2013, China has
signed cooperation documents
with more than 80 countries
and organizations, carried out
industrial collaboration with
more than 30 countries and
helped build 75 economic and
trade cooperation zones in 24
countries.
In May, representatives from
130 countries, including 29
heads of state or government
and scores of international
organizations, participated in
the Belt and Road Forum for
International Cooperation in
Beijing, where more than 270
projects aimed at enhancing
the global cooperation net-
work were finalized.
China has also shouldered its
responsibility in dealing with
global challenges such as cli-
mate change.
In a speech to mark Chinese
Lunar New Year on Feb 16,
French President Emmanuel
Macron called China an “ally”
of France in the fight against
climate change. Macron hailed
Beijing’s involvement in help-
ing to solve the issue as “a radi-
cally new” choice made by “our
Chinese ally on this subject”.
Guo Yezhou, vice-minister of
the International Department
of the CPC Central Committee,
said at a symposium on March
24 that building a community
of a shared future for mankind
is the most prominent element
of China’s major-country diplo-
macy in the new era.
The proposal has not only
integrated China’s traditional
culture with the contemporary
trend of international rela-
tions, but also reflected Xi’s val-
ues and his responsibility, he
said, adding that the proposal
has been supported and
acknowledged by more and
more countries as well as politi-
cal parties.
The proposal of building a
community of a shared future
is put forward by China, but it
needs joint efforts from the
whole world to achieve the
great goal, he said.
Building a community of a
shared future for mankind and
establishing a new interna-
tional order has great signifi-
cance not only for China’s
rejuvenation but also for glob-
al peace and development,
said Guo Shuyong, head of the
International Relations and
Public Affairs College of
Shanghai International Stud-
ies University.
The proposal of building a
community of a shared future
should be integrated with real
practices, such as building the
Belt and Road, so that the
world can better understand
the proposal and benefit from
it, he said.
Xinhua and Zhu Yue
contributed to this story.
province, celebrates its 30th
anniversary on Friday.
Many measures targeting
poverty have helped to
improve residents’ incomes,
such as the development of
high-efficiency agriculture and
highlighting rural tourism,
which yielded better jobs, new
farm produce and markets for
many once-poor farmers. It
beautified many villages as
well.
In 2017, about 2.84 billion
yuan was poured into the agri-
culture, tourism, healthcare,
education and transportation
systems with the goal of reduc-
ing poverty on the island.
Shatu, once an impoverish-
ed village in the island’s north-
western area, has now become
a village of sweet potatoes with
some global stature.
Farmers in the village used
New anti-cancer weapon: Nanotech
Nontoxic treatment comes with zero
side effects, unlike chemotherapy
By ZHOU WENTING
in Shanghai
zhouwenting@
chinadaily.com.cn
Scientists in Shanghai say
they have made a break-
through in researching an
alternative to chemotherapy
that would treat tumors in a
safe, efficient way with zero
side effects for patients.
Chemotherapy has long
been used in the treatment of
cancer and involves one or a
combination of drugs being
introduced to the patient’s
bloodstream to kill cancer
cells. Yet it affects healthy cells,
too, causing lower immunity to
Big data, satellites aid in conservation of nature
By CAO CHEN in Shanghai
caochen@chinadaily.com.cn
Conservationists are turn-
ing to high-tech tools and big
data for wildlife monitoring
and management in China.
“The past 10 years have seen
wildlife data accumulate rap-
idly,” Li Binbin, assistant pro-
fessor of environmental
science at Duke Kunshan Uni-
versity, said at the Workshop of
Intelligent Technology and Big
Data in Nature Conservation,
which was held earlier this
week in Shanghai.
For example, in the field
monitoring and protection of
giant pandas, Amur tigers,
cheetahs and black rhinos,
“classification of these species
at the individual, sex, age-class
and species levels can be done
through footprint identifica-
tion,” said Li.
“It is a noninvasive method
that’s more accurate than
Tourists harvest sweet potatoes in the town of Qiaotou in Chengmai,
Hainan province, last year. YUAN CHEN / FOR CHINA DAILY
to grow low-productivity rice
and other crops, earning
incomes of less than 3,000
yuan a year in 2008, before
they were encouraged by the
local government to grow
sweet potatoes instead.
infection, fatigue and hair loss.
On Tuesday, a team from the
Shanghai Institute of Ceram-
ics, which is part of the Chinese
Academy of Sciences,
announced it has devised a
therapy using inorganic, non-
toxic nanoparticles that can
travel around the body and tar-
get only tumors, leaving
healthy cells unaffected.
“Laboratory testing on mice
has shown that tumors shrank
by 85 percent after receiving
the therapy,” said Shi Jianlin,
lead researcher at the institute.
For the tests, researchers
give two nanoparticles —
Fe3O4 and SiO2, the latter
being a transport agent — and
measuring bite size and more
cost effective than the fecal
DNA method — two tradition-
al identification approaches
for pandas,” she said.
“The database gradually
grows, and the model can
identify the new individual
more accurately,” said Li. “It
will help to preserve biodiver-
sity and implement effective
conservation strategies.”
The accuracy rate for identi-
fying individual giant pandas
is as high as 91 percent, Li said.
Such high-tech tools and big
data are also used for monitor-
ing other species.
“When identifying bird spe-
cies based on audio recordings
of sounds, it often happens
that multiple birds sing togeth-
er against a noisy background,
resulting in poor data quality,”
said Li Ming, associate profes-
sor of the big data research
center at Duke Kunshan Uni-
versity.
The government organized
training courses for the farm-
ers to help standardize potato
growing, conducted branding
promotion activities and set
up an online sales platform
and a sweet potato research
glucose oxidase through intra-
venous injection to mice.
The particles target tumor
cells owing to special microen-
vironment of acidity and high
glucose content, while the
chemical compounds com-
bined will trigger reactions in
tumor cells and produce a
highly toxic active substance
that will kill the cells, Shi said.
He said his team of scientists
has also created a nanoparticle
called Mg2Si, which is nontox-
ic in a neutral environment of
healthy tissue and only trig-
gers a reaction in the acid envi-
ronment of a tumor.
“The reaction will consume
a large amount of oxygen mol-
ecules in the tumor cells and
block the vascular system in
the tumor cells so as to prevent
the supply of oxygen molecules
and nutrients from outside.
“This problem can be solved
through audio processing by
the specific high-tech tools we
are developing, where the sig-
nals of different birds have dif-
ferent temporal frequency
ranges.”
An audio recorder based on
a microphone array with spe-
cific directionality is also being
researched, Li said.
“These will help determine
how birds migrate, their specif-
ic locations, as well as provide
sources for the authorities to
improve wildlife habitats.”
Other intelligent technolo-
gy, such as remote sensing,
geographic information sys-
tems and global navigation
satellite systems can also be
used for real-time monitoring
of natural and human threats,
such as forest fires, according
to Liu Jingnan, principal of the
university and an academician
of the Chinese Academy of
Engineering.
institute that is developing
quality potato seedlings.
“The efforts have helped to
increase the annual income
per household to 100,000
yuan, jumping 33 times from a
decade ago,” said Yang Ying-
chun, a Shatu resident. He
expects a harvest worth
150,000 yuan from his 1-hec-
tare sweet potato farm this
year.
Sweet potatoes have helped
reduce the number of impov-
erished households to 36 in
2016 from 1,390 in 2007 in Qia-
otou, which has 29,000 resi-
dents.
While in the central areas of
the island, where a number of
national-level poverty-stricken
counties and cities are located
— such as Baisha, Baoting and
Wuzhishan — the “poverty
reduction plus tourism” model
Super striders
Athletes run on stilts during an invitational event featuring
traditional ethnic minority sports in Gaoyou, Jiangsu prov-
ince, on Thursday. About 200 people participated in
events including stilt races and team competitions.
YANG BO / CHINA NEWS SERVICE
The tumor cells will eventually
starve to death,” he explained.
Papers on the research were
published in Chemical Society
Reviews in February, Nature
Nanotechnology in December
and Nature Communications
in August.
“This contribution reports a
nice overview of nanoparticle-
triggered catalytic chemical
reactions for cancer therapy.
The authors provide a com-
plete state of the art of the topic
emphasizing the different
approaches that can be used,”
reads one peer review in
Chemical Society Reviews.
Chen Qinfen, a doctor spe-
cializing in hematology at
Fudan University’s Huashan
Hospital in Shanghai, said the
new therapy sounds exciting.
“During and after chemo-
therapy, patients of lymphoma
91 percent
Maximum accuracy
in identifying individual
giant pandas using
their footprint
Drone applications in the
wild are also accessible to com-
bat poaching and illegal log-
ging, and for counting wildlife,
said Tian Yi, product opera-
tions manager of Da-Jiang
Innovations Science and Tech-
nology, a leading Chinese com-
pany in the civilian drone and
aerial imaging technology
industry.
“Our recent study found that
the current list of protected
species and relevant research
fails to cover all endangered
species,” said Wang Hao, lec-
turer at Peking University’s
School of Life Sciences.
is bringing benefits.
Shijin village in Baoting Li
autonomous county on the
island’s eastern side, has devel-
oped rural tourism by tapping
the spectacular views of its
lush green mountains, as well
as the colorful culture of Li eth-
nic people, the original resi-
dents of Hainan. The village’s
efforts have raised per capita
income from 2,000 yuan about
10 years ago to more than
13,000 yuan.
Sanya, the resort city at the
island’s southern tip, has
established a smart database
management system includ-
ing the situation of each
impoverished household —
income, health condition, fam-
ily members and employment
— can be followed by scanning
a code in front of the house-
hold name.
CHINA 5
and leukemia will suffer from a
decrease in blood platelets or
white blood cells, or impair-
ment in the liver, kidney or
nervous system. More than
half of leukemia patients die of
complications after chemo-
therapy,” she said.
“The particular advantage of
nanoparticles is that they are
small enough to enter the cyto-
plasm and nucleus, which
makes the treatment more
precise and efficient.”
Shi stressed on Tuesday that
the research is still at the stage
of lab tests and in the future his
team may have to pick the
most applicable approach for
clinical trials.
“Lab tests also proved that
our therapies are able to pre-
vent tumor metastasis. We
hope it will also make contri-
butions clinically,” he said.
For example, 51 percent of
mammalian species have not
been included in research
papers.
“However, it is surprising
that 97 percent of the distribu-
tion data on birds, one of the
species with a large amount of
information, is provided by the
public,” Wang said.
“Nature lovers, grassroots
researchers and local residents
are the best information con-
tributors, yet the data they col-
lect needs further professional
analysis,” he said. “It means
professionals involved in data
collection and research of
wildlife should further cooper-
ate with the public.”
Zhang Junjie, director of
the Environmental Research
Center at Duke Kunshan, also
called for the cultivation of
interdisciplinary talent in
natural sciences and data
analysis to improve nature
protection.
“With the system, we can
provide targeted measures to
help each family rise out of
poverty,” said Zhang Lei, an
official in charge of local pover-
ty alleviation.
Hainan has also invited agri-
cultural experts to the villages
to give lectures and provide
training for farmers. It has
organized night school TV pro-
grams since 2016, with topics
covering new farming tech-
niques, poverty alleviation pol-
icy explanations, industry
development analyses, build-
ing confidence and benefiting
thousands.
Regular arrangements are
made for farmers to visit other
areas and broaden their vision.
Contact the writers at
mazhiping@
chinadaily.com.cn
6 CHINA
Retiree helps visually impaired
broaden their horizons
Partially blind former doctor acts as the ‘eyes’ of her friends on travel adventures
By TAN YINGZI in Chongqing
tanyingzi@chinadaily.com.cn
A retired doctor in Chong-
qing is helping visually
impaired friends “see” the
world by volunteering as a
travel guide.
Cai Meiqi, 66, who was born
partially blind and has very
weak vision in her left eye, has
led tours around China and to
neighboring countries such as
Singapore, Malaysia, Thailand
and Japan in the past decade.
Thanks to such adventures,
she has helped the sightless
experience things for the first
time in their lives, such as tak-
ing a plane journey, walking
on sandy beaches, running
through grassy fields and
standing atop mountains.
Cai started her post-retire-
ment career in 2007 after
meeting several visually
impaired individuals during a
massage training program.
She showed her managerial
abilities during class activities
and gained the trust of the stu-
dents.
“They asked me to lead
them to explore the outside
world. They said that their
lives are not just about surviv-
al,” said Cai, who practiced tra-
ditional Chinese medicine.
China has the largest popu-
lation of visually impaired
people in the world, an esti-
mated 8 million, according to
the World Health Organiza-
tion.
Touched by the courage and
passion of others, she began to
contact travel agencies. But
none of them would make spe-
cial accommodations for visu-
ally impaired clients at that
time. She decided to organize
trips herself.
“Let me be your eyes, and
follow me to ‘see’ the world,”
she told them.
Their first trip was a day
tour for about 40 people to the
botanical garden at Chong-
qing’s Nanshan Mountain. Cai
guided them around the gar-
den, told them what she saw
and let them touch and smell
cherry blossoms and other
flowers.
“I was so afraid they would
get lost or hurt,” she said. “But
I found they really cherished
the chance to travel and they
were so disciplined.”
To ensure the safety and
smooth operation of the tours,
Cai has made some rules: a
partially blind person must
pair with a completely blind
one, and no one should be left
alone under any circumstan-
ces.
When traveling outside
Around China
SICHUAN
Mother sues after
door scars her son
A woman has demanded
200,000 yuan ($31,760) in
compensation from a store in
which her 4-year-old son was
seriously wounded when a
glass door shattered in Cheng-
du last month. Surveillance
footage showed that the glass
door inside a shopping mall
suddenly broke apart, raining
shards of glass onto the boy’s
face after he pushed the door
open. The mother, who was
shopping for a cellphone,
grabbed her son and rushed to
the hospital. She said she is
worried the incident, which
has left her son with facial
scars, could affect his develop-
ment. The store manager has
argued that both the store and
the mother should shoulder
responsibility for the accident,
Cai Meiqi (front) guides her visually impaired friends to visit a scenic area on the outskirts of Chongqing.
Chongqing, she takes only
about 10 people with her to
ensure she can look after them
properly.
She usually brings two whis-
tles to send signals to her
teammates during the trips. At
some crowded scenic spots, if
other guides use one type of
whistle, Cai will use another to
differentiate her sound.
To save on costs, Cai spends
a great deal of time searching
for cheap transportation,
accommodations and dining
options.
It took her about three years
to prepare for a trip to Xia-
men, a coastal city in Fujian
province. In March 2015, she
finally made the trip with 13
team members.
“When I touched the trees,
felt the ancient streets under
my feet, heard the ocean
waves, felt the wind from the
mountains and heard birds
singing in the forest, I seemed
to really ‘see’ nature’s beauty,”
said Zhang Hong, who has
participated in many tours
organized by Cai.
They like to ask others to
take photos for them so that
they can show them to their
family and friends.
contending that parents
should watch over their chil-
dren at all times in public pla-
ces.
WWW.SHANGHAIIST.COM
HUBEI
Scissors pierce
worker’s skull
A village worker, surnamed
Shen, is in intensive care after
undergoing surgery to remove
a pair of scissors that got
lodged in her skull in Xiang-
yang on April 4. The freak acci-
dent happened while Shen, 57,
was shearing a Chinese toon
tree, using a bamboo pole with
a pair of scissors attached to
Cai’s special travel group
has attracted much attention
from the public and often
receives generous help from
warmhearted tourists, train
and flight attendants, as well
as restaurant and hotel man-
agement. In recent years, a
local travel agency welcomed
them to join its tours at home
and abroad.
“We have received so much
help from others,” she said.
“We want to give back to socie-
ty as well.”
Cai has set up a volunteer
team with her visually
impaired friends called Light
of Love. During their trips and
when they have spare time,
they often provide free mas-
sage services and mini con-
certs.
“Some of my team members
are very talented musicians.
Some can write songs and oth-
ers have very good singing voi-
ces,” she said.
For Cai and her teammates,
travel has a special meaning.
“We derive confidence and
dignity from our journeys,”
she said.
“When we come back, we
can carry on with more cour-
age.”
the end. When the pole
snapped, the scissors fell and
hit her head. Shen, who did
not feel much pain, chose to
take a public bus to the hospi-
tal — over an hour away. Doc-
tors said the scissors were only
2 to 3 millimeters from her
brain and that she was fortu-
nate as they had entered her
skull at a slight angle.
CHUTIAN METROPOLIS DAILY
GUANGDONG
Teen confesses to
starting four fires
A 15-year-old boy has been
sentenced to 10 months
behind bars, suspended for a
year, for committing arson in
Guangzhou and sharing pic-
tures of his crimes on WeChat.
Baiyun District People’s Court
handed down the verdict after
the teenager was found guilty
of using a cigarette lighter to
ignite paper boxes in a house
in Jianggao township four
times in March last year. The
boy, who shared the photos of
the fires online, was detained
at a cybercafe on March 30. He
said he committed the crimes
“just for fun”.
GUANGZHOU DAILY
PHOTOS PROVIDED TO CHINA DAILY
Cai (left) and members from her Light of Love volunteer team give
free massages to attendants on a train during a trip to Northeast
China last year.
Elderly waste collector pays for
books for rural children in Sichuan
Liu Tuchi has donated tens
of thousands of books to rural
children in five villages in
southwestern China and built
more than 15 reading rooms
over the past 13 years — all with
just the small income he earns
collecting and selling trash.
The 87-year-old gets up at
dawn every day and sifts
through rubbish bins, seek-
ing anything that could be of
value. “After selling the gar-
bage, I go to bookstores to
find books,” Liu said. When
he has enough books, he
sends them directly to chil-
dren in the villages.
He has worn out five back-
packs in nine years carrying
tons of waste on his back. His
granddaughter and her
roommates have bought him
a small trolley to replace his
backpack.
Liu was a senior official
with the health department
of Suining, Sichuan province,
before retiring in 1993. He
was inspired to start helping
students after seeing a prima-
ry school in remote Qilong
village in 2005.
“I was shocked by the poor
conditions,” he said, adding
that he saw old classrooms,
broken desks and a muddy
playground, while students
had barely any books other
than their class textbooks.
“On such a playground,
children were covered with
dust on sunny days and mud
on rainy days,” Liu said.
He withdrew more than
5,000 yuan ($790) of his sav-
ings and raised more than
8,000 yuan from his family
and friends to donate books
to the school. He also paid to
concrete over the muddy
playground.
Together with local author-
ities, Liu bought more than
1,700 books to help stock
“reading corners” in every
classroom. “In rural areas,
children should not be left
behind, especially in their
education,” he said.
His work has opened a new
chapter in his life. With only a
small pension, Liu collects
and sells waste such as water
Friday, April 13, 2018 CHINA DAILY HONG KONG EDITION
Israeli venture
capitalist flying
high in China
By WANG KEJU
wangkeju@chinadaily.com.cn
Amir Gal-Or has been
avoiding crashes his whole
working life — either in the
cockpit of a plane or making
investment decisions in his
office.
The 56-year-old former
Israeli Air Force pilot won
the first business license to
run a foreign venture capital
company in China in 2004
after 10 years working in the
same field in Israel.
“Both of my choices were
strongly opposed by my par-
ents at first, to become a
fighter pilot or to start my
business in China, which in
their opinion were too risky,”
Gal-Or said. “But my
achievements in two careers,
on the other hand, proves
that I’m good at controlling
risks.”
He said the 24 years he
spent as a pilot taught him
how to control and reduce
risks in a chaotic situation
and how to accomplish a
goal with only limited infor-
mation.
In 1993, while still serving
in the air force, Gal-Or start-
ed a new adventure, launch-
ing a venture capital
company in Israel. Because
the local market was small,
he said venture capital and
innovation in Israel was nev-
er about the country itself,
but instead going out. Until
2003, he focused on the Unit-
ed States.
Meanwhile, China was a
rising world power whose
rapid development required
science and technology. Gal-
Or spotted the trend, real-
ized the value of melding
Israel’s research and devel-
opment skills with China’s
manufacturing prowess, and
set up shop in China in
2004.
“Our strategy contrasts
with the reluctance of many
foreign investors to share
advanced technology with
China for competitive rea-
sons. And some would-be
investors in China have
steered clear over concerns
about intellectual property
theft,” he said.
His company invested in a
Chinese firm in 2004 and
helped it acquire technology
for packaging semiconduc-
tor chips. He said the know-
how came from an Israeli
manufacturer that was una-
ble to make money from its
invention because there was
no supply chain it could join
there.
The Chinese buyer, China
bottles, cans and newspapers
— an occupation that his fam-
ily supports.
“My father has always been
a good person, and we all
understand and support his
decision,” said his daughter,
Liu Naxin.
She works for a magazine
in Beijing and helps her
father contact nonprofit
organizations, which provide
help in choosing the books.
As for secondhand books,
he gets many from recycling
stations, and checks them
page by page, cleaning them
carefully and ironing out dog
ears.
His perseverance and spirit
are inspirational to his
friends. The health authority
in Suining has set up a store-
house for the waste the elder-
ly man collects. Some of his
neighbors also help transport
and sell the waste for free,
while others send their old
newspapers and magazines
directly to his house.
In 2008, Liu Tuchi started
to build reading rooms, as he
Amir Gal-Or, Israeli venture
capitalist based in Beijing
Wafer Level CSP, boosted
yields, reduced production
costs and found a niche in
packaging the sensors used
in cellphone cameras — a
market valued at more than
$7 billion a year.
“With the huge market
and friendly investment
environment in China, it
provides so many opportuni-
ties for foreigners like me or
even our next generation to
fulfill one’s potential and
realize their dreams,” Gal-Or
said.
Gal-Or’s wife and four chil-
dren moved to Hong Kong in
2007 and then Beijing in
2012. His son, Raz, who stud-
ied at Peking University, has
attracted more than 2.1 mil-
lion followers on Sina Weibo,
with videos about foreigners
sharing their experiences
and opinions of living in Chi-
na. He now runs his own vid-
eo production workshop
with more than 20 employ-
ees.
“That’s the magical part
about China,” Gal-Or said.
“It’s identifying and embrac-
ing individual values no mat-
ter where you come from.
Everyone could find a way to
take root and thrive. People
used to talk a lot about the
American dream, but I think
now it’s the Chinese Dream.”
On Sept 30, he received
China’s Friendship Award,
the highest honor granted by
the central government to
foreign experts who make
outstanding contributions to
the country’s modernization,
and met Premier Li Keqiang
at the Great Hall of the Peo-
ple.
“There is something in the
Jewish mentality to a certain
level that communicates
well with the Chinese,” he
said. “You can see it more as
synagogue style: You shake
hands, you meet.”
Gal-Or predicted he and
his family will see a different,
more advanced China in 10
years’ time.
found books alone were not
enough to change the lives of
rural students.
“Only when the whole vil-
lage is richer can children
enjoy a better education with
more books and schools,” he
said. “Through the reading
rooms, farmers can learn
skills and access information,
which are foundations for
acquiring wealth.”
The pensioner’s efforts are
greatly appreciated. Accord-
ing to Yang Lin, head of Chao-
shui village, Liu Tuchi’s
donations have enriched the
lives of villagers and
improved production.
“Grandpa Liu, I will study
hard and pay you back when I
grow up,” student Ye Qiao
said in a written message,
while another, Yang Jiao,
added that she wants to be
just like him and help others
in rural areas.
“My dad is rich. Rich in
mind and spirit,” Liu Naxin
said.
XINHUA
 Friday, April 13, 2018 7

COMMENT C H I N A DA I LY H O N G KO N G E D I T I O N

Maverick academic’s TO T H E P O I N T
S TA F F W R I T E R

freedoms come with Bay Area shoppers enjoy blanket protection

Details of the Guangdong-Hong Kong-Macao
Greater Bay Area project — which the Pearl Riv-
with local consumer laws and rights but also
because they cannot afford to stay in the place

real consequences er Delta cities and, actually, the whole country

and rest of the world have been eagerly looking
forward to — will soon be unveiled, according to
a spokesman for the National Committee of the
Chinese People’s Political Consultative Confer-
ence at the two sessions in Beijing last month.
and await the completion of litigation. Most of
the time, they just have to swallow the outrage
over unfair transactions or even swindles and go
home as complaints must be lodged at the place
where malpractice happens.
Under the new agreement, tourists could go
Chow Pak-chin notes that Benny Tai has a history of hiding It is understandable that the blueprint for such
a grand national-level project takes time to be
home first and file their complaints to the con-
sumer council there. The complaints would then

anti-govt activities under a cloak of academic discourse hammered out, given all the complex issues
involved.
But the absence of details of the grand plan
be referred back to the consumer council in the
city where the dispute has occurred and handled
according to the relevant laws there.

T
here is always a
price to pay for most
of our actions and
this is a golden rule
of thumb to live
by. However, one
individual seems to
mistakenly believe he is an exception
to this rule.
Benny Tai Yiu-ting, an associate
law professor at the University of
Hong Kong and key leader of the
illegal “Occupy Central” protests in
2014, is still running amok and prop-
agating his discourse, pushing for
Hong Kong’s independence without
bearing any legal consequences. Last
month he even took his illicit activ-
ity to a seminar in Taiwan and went
as far as to suggest people on the
Chinese mainland and Hong Kong
should ponder the idea of indepen-
dence or becoming part of a federal
system.
After being roundly criticized for
his political incitement, Tai showed
little remorse and instead went even
further, putting forward a timeline
for Hong Kong’s independence. He
claimed he had a hunch there would
be “a turning point” to pave the way
for the city’s independence before
2047, the supposed expiration date
for Hong Kong’s “one country, two
systems” blueprint. There is no doubt
any fair-minded person would see
this as a way to incite revolt against
the central government. Tai, however,
has been hiding behind the facade of
free speech and academic freedom to
instigate political revolt. Such free-
dom could only be granted within an
academic sphere and the recent Tai-
wan meeting was certainly outside
this scope.
I am rather concerned with Tai’s
reference to “the end of China’s dic-
tatorship”. Not only does it raise con-
cerns over Tai’s baseless hypothesis of
such an event coming into being but
it also begs the all-important ques-
tion: What role would Hong Kong
and he play in that regard?
Furthermore, when Tai talked
Chow Pak-chin
The author is president of Wisdom
Hong Kong, a local think tank.
He (Tai) employed a
similar ruse with the
“Occupy Central”
movement, which
was initially purport-
ed to be an academic
discussion...
about the “turning point” for Hong
Kong to move toward independence
before 2047, did he also imply the city
would be politically ready by then to
break away from the mainland?
Tai has unashamedly made these
seditious comments publicly, so I
am curious to know whether he still
considers himself to be Chinese. If he
does, what is his end game? Does he
want to see his motherland break up
into different independent states?
Despite coming under immense
criticism and facing diminishing
public support — his Legislative
Council rally last weekend only
attracted 1,200 people — Tai remains
unrepentant.
He employed a similar ruse with
the “Occupy Central” movement,
which was initially purported to be
an academic discussion in his 2013
newspaper article “Civil disobedience
is a weapon of mass destruction”. At
that time, no one would have thought
such an innocuous “academic discus-
sion” under the guise of freedom of
expression would have turned into a
messy 79-day sit-in.
Hong Kong is an inseparable part
of China and that’s an undeniable
fact of life. In 1997, Britain returned
the city to China, not to Hong Kong
people. Hong Kong residents can
still enjoy freedom of expression,
academic freedom and so on but it
goes without saying that there is a
line that must not be crossed. Hong
Kong residents may enjoy such free-
doms in various spheres but must
still toe a careful line between liberty
and inciting revolt against the central
government.
Would Tai go to Vatican City and
advocate atheism there? Would he
criticize the Jews on Israeli soil?
Assuming Tai possesses the general
sensibilities we employ in our day-
to-day lives, I am sure he too would
refrain from doing such things. With
that in mind, would this be consid-
ered self-censorship? And would he
accuse authorities there of suppress-
ing their citizens’ freedom of expres-
To and fro
sion? If this is the case, then why
does Tai continue to act in such an
antagonistic manner toward his own
country?
Tai would do well to be reminded
that freedom of expression does not
equate to freedom from consequenc-
es. He tries to use this defense time
and time again but should look no
further than Catalonia. The Spanish
region’s failed independence move-
ment and fate of its ex-leader Carles
Puigdemont, who will face sedition
and other charges over last year’s
independence vote, should serve as
an ominous reminder for Tai.
Another concern is Tai’s academic
credibility as a law professor. Is he
still fit to teach when he has such
an obviously warped view of the
legal system? Some might argue he
is innocent until proven guilty. But
what if he is found guilty for his role
in “Occupy Central”? Should that day
come, then the most logical course
of action would be to sack him from
HKU. His role as a law professor is
not just an internal HKU business; it
concerns students, staff and the com-
munity at large.
at this moment does not mean members of the The signed agreement covers residents from
city cluster should sit back and wait. There are Macao, Hong Kong and the nine cities in Guang-
many things these Bay Area cities could do now dong province — Guangzhou, Shenzhen, Zhuhai,
to start the momentum for regional cooperation, Foshan, Huizhou, Dongguan, Zhongshan, Jiang-
which is the spirit of the GBA project. men and Zhaoqing. Together these cities have a
On Tuesday, a memorandum of understanding population of about 70 million, and, according
was signed among consumer protection agencies to special administrative region government
in the 11 Bay Area cities, including Hong Kong, figures, mainland residents made as many as
to allow consumer complaints to be lodged in 45.5 million trips to Hong Kong over the past 12
the concerned tourist’s home city. The idea of the months. The number of people to benefit from
GBA project is to allow free flow of people in the this new arrangement would therefore be enor-
city cluster, including tourists, and the new MOU mous and tourist consumption volume would
is meant to increase the efficiency of consumer definitely be bolstered.
litigation processes and provide better protec- That is only one aspect of many in what could
tion for consumer rights of people traveling be achieved in cooperation and even integration
among those cities. among the cluster cities to realize the synergy
Tourists have always been easy prey for sales effect. One could only imagine the promising
malpractices. Unconscionable retailers target
tourists not only because they are not familiar
prospects for this region when the GBA project
blueprint is announced in the near future.
Editor’s note:
China Daily Hong
Kong Edition has
launched a photo-
sharing campaign at
Instagram. You can
share your photos
by tagging #hk24hr,
and we’ll choose the
best ones to publish
in the newspaper.
A handful of office
workers and
shoppers ride
escalators at IFC in
Central.
@JOHNLEHMANN /
INSTAGRAM

HK’s creative industry worthwhile to note that the act of embed- Such schemes can extend beyond film to
ding patriotic messages in films depicting the entire creative industry, which employs
major events in history is not new, and some 200,000 people. Hong Kong’s creative
pervades European and American cin- talents are well sought after and trusted on

set to launch new era Ken Chu

ema. There remain many other genres to
explore as the mainland market continues
to develop.
I feel that we should cast doubts aside
the mainland and the city’s designers and
planners have frequently collaborated with
mainland institutions. The government
has also actively promoted Hong Kong’s
The author is a member of the National

F
ollowing a two-decade continual
decline in production, Hong
Kong’s movie industry has once
again come under the spotlight as
the city’s filmmaking talents make waves
on the Chinese mainland and around the
world. Our film industry was once dubbed
a sunset business, since production of
local features hovered near 50 a year, a
fraction of the all-time highs seen in the
1980s and 1990s. But this could not be fur-
ther from the truth.
At the recent 12th Asian Film Awards,
Hong Kong’s filmmaking talents delivered
an impressive showing, sweeping the
awards for Best Actor, Best Original Music,
Best Action Film, Best Visual Effects as
well as the Excellence in Asian Cinema
prize. On the box office front, Operation
Red Sea, directed by the famed Dante Lam
Chiu-yin, has grossed more than $560 mil-
lion — the second highest-grossing film in
history.
It comes as no surprise that many local
filmmakers and actors have turned to
the mainland given its huge market and
financing — its box office takings reached
$8.6 billion last year, compared with Hong
Kong’s $237 million. Critics may say this
is the reason for the brain drain in Hong
Kong’s creative industry but I beg to differ.
With the mainland box office expected to
overtake North America’s in a few years’
time, this is an opportunity that should be
seized by the local film industry, to foster
greater collaboration.
The mainland market has embraced
Hong Kong film talent and this represents
a whole new area for growth. For example
Operation Red Sea inspires patriotic pride
in its audience and was a gift for the 90th
anniversary of the founding of the People’s
Liberation Army as well as the Communist
Party of China’s 19th National Congress.
For a Hong Kong director to be entrusted
with such a “main-melody movie” is a
milestone, even more so when this is
a repeat feat for Lam, with Operation
Mekong being the first such work.
There is no guaranteed success formula
for Hong Kong film talents on the main-
land but we are definitely going in the
right direction by increasing interaction
between the markets, evolving and learn-
ing from each other. Hong Kong films
are known for their entertainment value,
which has been largely missing from
mainland films. We have the advantage
of understanding different international
cultures, giving us the edge to add value
Committee of the Chinese People’s Political
Consultative Conference.
We should cast doubts
aside and focus on how
the development of the
Guangdong-Hong Kong-
Macao Greater Bay Area
presents a great oppor-
tunity to rebuild this
region as the Hollywood
of the East.
across the production chain for mainland
features, adapting them for international
audiences. This in turn will benefit the
cross-boundary film industry through a
multiplier effect, which would mean a
larger pie for everyone.
Mainland films can sometimes be
perceived as over-patriotic and to some
this can limit creativity. Nonetheless, it is
and focus on how the development of the
Guangdong-Hong Kong-Macao Greater
Bay Area presents a great opportunity to
rebuild this region as the Hollywood of the
East. Given the ample resources and tal-
ents, in addition to a huge domestic mar-
ket, we should foster greater collaboration
to make this a reality.
The Hong Kong government has worked
hard to promote film development. It has
successfully established CreateHK to lead,
advocate and promote the development
of Hong Kong’s creative economy and has
launched the Film Development Fund.
The fund aims to help the Hong Kong film
industry develop and nurture talents, as
well as foster greater partnership with the
mainland through the Closer Economic
Partnership Arrangement.
It is now time for the industry to step up
collaboration. Such efforts can range from
cross-boundary joint financing to encour-
age film production in the Pearl River
Delta region; increasing academic and
industrial exchanges between Hong Kong
and the mainland, such as through joint
forums and student exchanges between
film academies; as well as strengthening
export and promotion efforts to the inter-
national audience.
fashion design and brands to the mainland,
and implemented the Fashion Incubation
Program to provide technical training and
support for the industry.
Our people and society possess the dis-
tinct advantages of embodying Eastern
and Western cultures, on top of being a
free and open society with free flow of
information. Many leading international
media, creative and advertising companies
are based in Hong Kong for these very
reasons, letting us keep abreast of global
trends. As such, we continue to maintain a
lead over key cities on the mainland.
Our creative industry is well-established
and the government has laid the founda-
tion for further growth. It is now time
for industry players to capitalize on these
opportunities and realize its full potential.
We should view the mainland’s develop-
ments as boon more than bane and active-
ly seek cross-boundary opportunities lead-
ing to a win-win innovation ecosystem.
We can help shape the story of the “New
China” to the international audience with
Hong Kong’s unique mix of styles, expres-
sions and language.
All things considered, it can be said that
we are just about to herald the dawn of a
new era in Hong Kong’s creative industry.
8 Friday, April 13, 2018

COMMENT
*%("öLö%&$%$

China Daily Hong Kong Edition

EDITORIALS

Who trades with whom Cai Meng

not up to US to decide

S
ince its inception in 1994, the Summit of the
Americas has been a venue for the United States
and Latin American nations to sort out intra-
America concerns, most noticeably US-Latin
America trade.
And “fair and reciprocal trade” is expected to
command the limelight at the Friday-Saturday
gathering in Lima, Peru. Yet a parallel priority on the US delega-
tion’s agenda, according to the White House, is to “push back
against external economic aggression”.
It did not bother to elaborate. But no elaboration is needed.
As former US secretary of state Rex Tillerson made it crystal
clear on his first, also last, official visit to the region in February,
Washington is worried about the growing Chinese economic pres-
ence in what it still considers to be its backyard.
It remains to be seen whether or not US Vice-President Mike
Pence will be as blunt as Republican Senator Marco Rubio would
like, and declare Chinese involvement in the area as “unaccepta-
ble”. But chances are he will use both carrots and stick to tell Latin
American leaders his country, not China, should be their “partner
of choice”.
While Washington’s recent fixation with China’s growing pres-
ence in global trade is more or less understandable considering
the increasing China-related competition, its idea to dictate other
countries’ choosing of trading partners is outrageously inconsist-
ent with its call for trade with those nations to be “fair and recip-
rocal”. Trade can’t be fair if they can’t even decide with whom to
do business.
China, which will be attending the summit as an observer for
the first time, is the biggest or second-biggest trade partner for
a majority of Latin American countries. Trade ties are fair,
reciprocal and free of bullying. All parties in such relations
appear satisfied with what they see as mutually beneficial
trade.
Rather than any Chinese attempt to undermine US influence
in its own backyard, it is Washington’s own sense of insecurity
that may end up isolating the US in its immediate neighbor-
hood.
OPINION LINE

Hasty response will No tariffs on imported cancer drugs Graduate grab by

aggravate Syria crisis
T
he shadow of war that has fallen over Syria is darkening
with US President Donald Trump raising his pitch with
each passing day and threatening “missiles will be com-
ing” in response to an alleged chemical weapons attack
on Saturday.
At least 60 people were killed and more than 1,000 injured in
the suspected chemical weapons attack on Syria’s last rebel-con-
trolled area on Saturday, but before there is even an international
investigation into the attack to determine what happened and
who is to blame, a knee-jerk reaction like the one Trump is threat-
ening will only further complicate the situation and create a
greater humanitarian disaster in the war-torn country.
That the United Nations Security Council failed to approve
three draft resolutions on setting up an international investiga-
tion into the attack on Tuesday shows Washington and Moscow,
the two belligerent parties over the issue, need to narrow their dif-
ferences.
After all, paralyzing the world body does not help international
efforts to diagnose and address the grave situation in Syria.
The Syrian people have surely suffered enough after seven years
of conflict. Yet even after the Islamic State extremists were defeat-
ed in the country, the fighting between the forces of Syrian Presi-
dent Bashar al-Assad, supported by Russia, and the rebels,
supported by the US, has continued.
A hasty military strike against the Assad regime would increase
the possibility of what has been a shadow clash between Washing-
ton and Moscow turning into a head-on confrontation.
The two countries should try harder to avoid such a scenario
from coming true because it will further aggravate the situation in
Syria and only create fertile ground for extremist organizations.
And combating terrorists was the professed reason the two coun-
tries became involved in the Syrian civil war.
The US leader should, in particular, restrain his penchant for
warmongering rhetoric, especially since his country’s military
action in neighboring Iraq is responsible for having sparked the
current chaos in the Middle East. And in recent years, other coun-
tries in the region besides Syria have become mired in conflict and
social instability because of the US’ interventionist policy.
Experience shows diplomacy is still the best option for defusing a
crisis such as the one in Syria. The United States should think twice
before plunging the region deeper into bloodshed and conflict, and
take a step back to reappraise its policy toward the Middle East.
C O N TA C T U S
China Daily
No. 15, Huixin Dongjie, Chaoyang District, Beijing 100029
News: +86 (0) 10 6491-8366; editor@chinadaily.com.cn
Subscription:
+86 400-699-0203; subscribe@chinadaily.com.cn
Advertisement:
+86 (0) 10 6491-8631; ads@chinadaily.com.cn
Phone app: chinadaily.com.cn/iphone
China Daily USA China Daily UK
1500 Broadway, Suite 2800, New 90 Cannon St, London EC4N 6HA, UK
York, NY 10036 +1 212 537 8888 +44 (0) 207 398 8270
editor@chinadailyusa.com editor@chinadailyuk.com
China Daily Asia Pacific China Daily Africa
China Daily Hong Kong P.O. Box 27281-00100, Nairobi, Kenya
Unit 1818, Hing Wai Centre 7 Tin Wan +254 (0) 20 522 3498 (Nairobi)
Praya Road, Aberdeen, Hong Kong editor@chinadailyafrica.com
+852 2518 5111 enquiries@chinadailyafrica.com
editor@chinadailyhk.com subscription@chinadailyafrica.com
editor@chinadailyasia.com
good for patients and pharma firms
PREMIER LI KEQIANG stressed that China will lower tariffs on imported cancer drugs to zero dur-
ing a visit to a foreign pharmaceutical company in Shanghai on Tuesday. Beijing News comments:
Li’s pledge to eliminate import taxes on cancer
drugs and significantly lower those on other medici-
nes is good news for patients in China and may give
a boost to global pharmaceutical companies.
It is estimated that more than 2 million people
die of cancer each year in China, about a quarter of
the global total, and the sales of anti-cancer medi-
cines in China exceed 120 billion yuan ($19.12 bil-
lion) a year, half of which is generated by imported
medicines.
Many cancer patients resort to buying the medici-
nes from other countries where the drugs are less
expensive or cheaper generic drugs. They take the
drugs without professional instructions and moni-
toring, which could be dangerous.
Zero tariffs will help markedly lower the retail
Imperative to crack down on pyramid scams
THE STATE ADMINISTRATION FOR MARKET REGULATION recently announced that it had
drawn up a list of 11 key cities that should take action against pyramid selling, and it will monitor their per-
formance in this regard in 2018. Thepaper.cn comments:
Pyramid scams do great harm. In a pyramid
scheme the participants can only make money by
recruiting more members. It is an illegal activity
that can cause huge losses to those that are duped
into taking part.
Moreover, pyramid selling poses a threat to social
order and morality because the majority of partici-
pants cheat their friends and family members.
Worse, over the past years, increasingly more pyra-
mid selling organizations have been reportedly using
“persuasion”, and there were several deaths as well as
suicides related to pyramid selling in 2016 and 2017.
That’s why the move of the State Administration
for Market Regulation is welcome.
The central government should coordinate
nationwide resources in striking at the ringleaders
behind the scams. The administration said it will
HOT WORDS
National land supervision
On Tuesday, the Ministry of Natural
Resources released a report on national land
supervision. According to the ministry, in
the first half of 2017, all the provinces and
regions nationwide had 103.33 million hec-
hospitals reflects
shortage of talent
TALENT RECRUITMENT compe-
tition in the medical field is conducive to
prices of imported cancer drugs as well as ensuring not only the performance of hospitals,
there are more options for patients. The move is but also the entire society. Beijing Youth
also part of China’s efforts to further open up the Daily comments:
economy.
To further lower the retail price of imported can- According to media reports, more than
cer drugs and other medicines, the government 100 hospitals nationwide came to the
should simplify the administrative approval proce- 2018 Guangdong province college gradu-
dures for them and reduce the intermediate links ate job fair to recruit medical graduates.
between customs and patients. The competition for talents has become
By creating fairer competition, the reforms would so fierce that hospitals even at the county
also further stimulate domestic companies to step level are offering graduates annual sala-
up their efforts in the R&D of pharmaceutical drugs. ries of 150,000 yuan ($23,941), and some
Meanwhile, the public health departments should hospitals are offering settlement allow-
seek to determine why there is such high cancer ances as high as 1 million yuan to attract
morbidity in China and raise the people’s awareness medical PhD graduates.
of healthy lifestyle changes. The competition for talents has
become especially fierce among hospitals
in major cities competing for high-quali-
ty medical talent. For instance, some hos-
pitals in Shenzhen provide an annual
salary as high as 2 million yuan for doc-
tors.
The competition reflects the shortage
of medical talents at present in China,
especially in gynecology, obstetrics and
pediatrics after the family planning poli-
talk with the Party chiefs and mayors of any of the 11 cy was eased to allow all Chinese couples
listed cities that fails to improve the situation in to have two children.
2018. It also said the list will be updated annually. Encouraging more students to choose
Some local Party chiefs and mayors might feel medical majors at college would help
shame about this. If so, they should work hard to solve the doctor shortage problem in the
strike at pyramid selling so that their cities are not long run, and be conducive to improving
included on the updated list next year. the development of China’s healthcare
Beihai, Nanning, and Guilin, three cities in the system by promoting quality medical
Guangxi Zhuang autonomous region, have treatment and medical services at the
appeared on the State Administration for Market grass-roots level. As grass-roots hospitals
Regulation’s list, despite appearing on a list of “cities attract more high-quality doctors they
without pyramid selling” released by the local gov- will be able to provide better services,
ernment of the autonomous region in 2017. which will encourage more patients to
That the cities are included among the 11 cities to see doctors at grass-roots medical cen-
be monitored by the State Administration for Mar- ters. This will also be conducive to solv-
ket Regulation should be a reminder to local offi- ing the problem of unbalance of medical
cials to be stricter in carrying out their duties. resource in many regions.
tares of permanent basic farmland. tares of farmland. Local
Permanent basic farmland is high-quality authorities have been
farmland specially protected by the govern- urged to correct these
ment, as it is the foundation for China’s food violations.
security. The national land
In 2017, a national land responsibility and supervision system
supervision system was launched, which will help protect farm-
found 243 construction projects in provinces land and promote a Online
including Jiangsu, Hunan and Guizhou had green development Scan it for
illegally occupied or destroyed 7,260 hec- pattern. more hot words.
 CHINA DAILY HONG KONG EDITION Friday, April 13, 2018
Laurence Brahm
A new era of all together, nobody first
T
he Boao Forum for Asia,
held every spring in
South China’s Hainan
province, has become
known to many as “the Davos of
the East”. However, as an annual
economic conclave, the Boao
Forum represents a set of ideas
very different from those econom-
ic forums where Western business
and political interests dominate
and set the rules for globalization
that is synonymous with Ameri-
canization, or promote a set of
ideas associated with the “Wash-
ington Consensus”, which Europe
has felt obliged to buy into as a
matter of long-held North Atlantic
interests.
Established as a multilateral
convening of business interests
focused on the Asian community,
the Boao Forum for Asia has been
opening its doors to participants
who have business or trade inter-
ests with Asia.
When President Xi Jinping
addressed the 2018 Boao Forum
for Asia on Tuesday, he presented
a fresh image of China in the new
era. “In this complex and chang-
ing world, where are we headed
Chen Xiangyang
New ‘Cold War’ between US, Russia looming
O
n Wednesday, US Presi-
dent Donald Trump
tweeted that “nice, new
and ‘smart’” missiles
would soon be fired toward Syria,
arousing concerns that the United
States and Russia’s tussle in Syria
will further escalate.
And, suspecting Russia to be
behind the poisoning in the Unit-
ed Kingdom of a former Russian
double agent, about 28 Western
countries including the UK and
the US expelled Russian envoys,
with Moscow retaliating in kind.
In addition, the US has imposed
sanctions on seven Russian oli-
garchs, 17 senior government offi-
cials and 12 companies.
These incidents have added fuel
to the fire ignited by the Ukraine
crisis and a new “Cold War” can’t
be ruled out, which will have a
huge impact on international
relations.
The global financial crisis
prompted greater cooperation
among countries around the
world, raising hopes of an inclu-
sive global economy and world
order. But 10 years after the finan-
cial crisis broke out, conflicts and
unilateralism have increased,
because the West is desperately
seeking to hold on to its global
leadership role and trying to curb
the rise of emerging powers.
Instability is threatening peaceful
development and win-win coop-
eration, and the world will slide
back into a Cold War if geopoliti-
cal rivalries, such as that between
Moscow and the West, are not
checked.
Although Russian and US lead-
ers seemed eager to improve bilat-
eral relations a few years ago,
hopes of that happening have fad-
ed with the rising anti-Russia sen-
David Lidington
UK-China ties will go from strength to strength
A
t the beginning of this
year, Prime Minister
Theresa May visited
China to open a new
chapter in the “Golden Era” of
UK-China relations. I am pleased
to return to China this week at
what is a crucial moment in our
relationship.
We want an economic partner-
ship that delivers the maximum
possible benefits for both the
United Kingdom and the Europe-
an Union, while respecting the
integrity of each other’s institu-
tions and autonomy. This is in the
EU’s interests as well as ours —
after all, the EU is the UK’s biggest
market, and the UK is also a big
market for the EU.
In terms of our future security
partnership, we have been clear
that our commitment to the
defense of Europe is uncondition-
al and immovable. Negotiations
have covered many complex
issues, and the UK and the EU
recently reached an agreement on
the terms of a time-limited imple-
and where is the future of Asia?”
he asked.
Responding to the question
himself, Xi offered a clear path
forward. “In a world aspiring for
peace and development, the Cold
War- and zero-sum mentality
looks even more out of place. Put-
ting oneself on a pedestal or try-
ing to immune oneself from
adverse developments will get
nowhere.”
Without economic develop-
ment, peace and prosperity can-
not be assured. Sanctions, tariffs
and trade wars have, as proven
over the decades, achieved abso-
lutely nothing in terms of assur-
ing any kind of stability or
security for anyone. However, lift-
ing people out of poverty through
economic growth and the assur-
ance of identity through economic
empowerment do create lasting
and sustainable security. Contin-
ued economic integration
through transport and communi-
cations is key.
China has its own history of
alleviating poverty and forging its
own approach to sustainable
growth and development, and it
timent in the US over the alleged
interference of Moscow in the
2016 US presidential election. As
a result, confrontations over sanc-
tions, diplomacy and the media
between Washington and Mos-
cow have increased.
Moreover, the disputes in the
Middle East — especially in Syria
where the US supports the rebels
and Russia backs the government
forces — have intensified the hos-
tilities between Washington and
Moscow.
More important, the US has
identified Russia, and China, as
strategic competitors, instead of
competitive partners, in its Nation-
al Defense Strategy and other
reports, and it is seeking to
strengthen its alliances with other
countries, so that it can impose
tougher sanctions on Russia and
use trade protectionism measures
against China. This blatant US hos-
tility toward China and Russia will
only bring the latter two countries
together to counter the US’ moves.
The US-led West has been play-
ing nefarious geopolitical games
to inflict maximum damage on
Russia and China through sanc-
tions and trade conflicts. But the
West cannot win this battle, as
Russia’s countermeasures have
already caused problems for the
US-Europe alliance and China has
shown it is determined to respond
in kind to the US moves to safe-
guard its legitimate interests.
The escalating conflict between
Russia and the US-led West has
the potential to cause severe dam-
age to the world, especially to
Eastern Europe, the Middle East
and the Asia-Pacific. And it seems
Eastern Europe will continue to
be a volatile frontier of the Russia-
West conflict thanks to the inter-
mentation period from next year
for Britain’s ultimate exit from the
EU. This not only provides stabili-
ty in the short term, but repre-
sents the beginning of life outside
the EU — serving as a platform on
which we build our future rela-
tionship not just with the EU, but
with other economies too.
This positive vision for life out-
side the EU maximizes the oppor-
tunities available not just to the
UK, but also to our global part-
ners such as China.
That is why I believe we are
entering a new chapter in the
“golden era” of UK-China rela-
tions, in which cooperation
between us is stronger than ever
before, and in which we can tackle
mutual threats together, and take
advantage of the exciting new
opportunities.
As the British prime minister
said during her visit to China, we
want to help both British and Chi-
nese businesses to seize the huge
trade opportunities. Last year, total
bilateral trade in goods and servi-
At a time when
Trump emphasizes
only “America
first”, Xi has
repeatedly
expressed his vision
of a community of
shared future for
humankind.
can share this experience at
forums such as the Boao. Howev-
er, the “Chinese solution” is not a
cookie-cutter approach to be
adopted by other countries. Each
country and region has its own
solution that must be built on the
culture, geography and conditions
of the people and the place. This
approach of sharing and not
imposing was very much empha-
twined Ukraine issue.
As of now, Russia looks like
gaining the upper hand in the
Middle East game, including the
Syrian crisis and the Iran nuclear
issue, because of the irrational
statements and actions of US offi-
cials, such as their statements
threatening to scrap the Iran
nuclear deal and Trump’s order to
relocate the US embassy in Israel,
This positive vision
for life outside the
EU maximizes the
opportunities
available not just
to the UK, but also
to our global part-
ners such as China.
ces was worth £67 billion ($95.06
billion), up 13.8 percent over 2016.
UK exports to China have grown
68 percent since 2010, and China is
expected to be one of the UK’s larg-
est foreign investors by 2020.
We also welcome the possibili-
ties presented by the Belt and
Road Initiative as a means of glob-
al growth and connectivity. If
sized in Xi’s address on Tuesday.
In many ways China is stepping
into a role of global leadership
through action rather than words.
Unlike some Western powers that
espouse values that they cannot
themselves live up to, China is act-
ing rather than saying. The Belt
and Road Initiative is about eco-
nomic integration through net-
works of both transport and
communications.
China’s policy on ecological civi-
lization establishes a framework
for achieving low-carbon develop-
ment through enhancement of
green energy; it is an assurance of
environmental protection as well
— as not only a priority for the
government but also as a mega
trend for innovative technologies
and finance. These are among the
solutions that Xi offered to the
international community at the
Boao Forum for Asia.
Xi’s emphasis on global integra-
tion, increased trade and commit-
ments to open markets and
financial integration stand in
stark contrast to the Twitter out-
bursts of US President Donald
Trump. In the shadow of a unilat-
from Tel Aviv to Jerusalem.
The Trump administration
wants to have a finger in all the
pies, from Eastern Europe and the
Middle East to East Asia. And as
part of its “Indo-Pacific” strategy,
Washington seems keen on desta-
bilizing the Asia-Pacific region by
challenging Beijing’s jurisdiction
over the South China Sea waters
and trying to drive a wedge
implemented well, the initiative
has the potential to drive global
growth, and is therefore another
excellent opportunity for our two
countries to work closely together.
But we are determined to deep-
en our trading relationship even
further. I am pleased that our two
governments have launched a
Joint Trade and Investment
Review to identify opportunities
for promoting growth in goods,
services and investment, and to
pave the way for an ambitious
future trading relationship.
We are also working with China
to confront global and regional
challenges, such as co-signing the
2016 Paris Agreement to tackle cli-
mate change, and cooperating on
other environmental issues.
As we cement our partnership,
we must maintain and enhance
those vital cultural links which
underpin our relations. More than
150,000 Chinese students are
studying in UK universities, and
many among the thousands of
British students in China have cho-
eral trade war that Trump threat-
ens to launch, China stands as a
beacon promoting multilateral
trade, transport and communica-
tion integration, technology
advancement and environmental
protection. At a time when Trump
emphasizes only “America first”,
Xi has repeatedly expressed his
vision of a community of shared
future for humankind.
At such a time of global uncer-
tainty and volatility, business and
finance leaders worldwide are
looking for signals of stability.
Reactionary Twitter outbursts
ridden with anger do not offer
either stability or a sense of sus-
tainability for global investors
and business leaders. A well
thought through vision, backed
with clear and pragmatic plans
for assuring environmentally sus-
tainable growth together with
continued global economic inte-
gration does.
The author is the founding direct-
or of Himalayan Consensus and
International Research Fellow at
the Center for China and Globali-
zation.
LI MIN / CHINA DAILY
between the Chinese mainland
and Taiwan. What the US has fail-
ed to realize is that its actions will
further strengthen the China-Rus-
sia partnership and harden Chi-
na’s resolve to hit back.
The author is director of Crisis
Management Research Center,
China Institutes of Contemporary
International Relations.
sen to learn the Chinese language.
These are the reasons why Sino-
British ties will remain a priority
for the UK government. We are
committed to addressing rising
global challenges, building thriv-
ing economies, and deepening the
already strong links between our
people, our businesses and our
societies through our “Global
Comprehensive Strategic Partner-
ship for the Twenty-first Century”.
So as the UK prepares to leave
the EU and forge a new role in the
world, I am confident we can
deliver on our bold vision for a
Britain outside the EU that
remains open for business and is
globally minded.
And that is why I am confident
the new chapter of the “golden
era” will mean relations between
our two countries go from
strength to strength as we head
into the future together.
The author is minister for the
Cabinet Office and chancellor of
the Duchy of Lancaster.
VIEWS 9
Chen Weihua
The author is deputy editor of China
Daily USA.
chenweihua@chinadailyusa.com
US’ demonizing
of Chinese FDI
a shot in the foot
T
here will likely be a sharp
decline in Chinese foreign direct
investment in the United States
in 2017, partly as a result of Chi-
na’s tighter control of capital outflow, but
also because the US government and law-
makers increasingly view Chinese FDI
through the lens of geopolitics.
That was a message from two reports
on Chinese FDI in the US released by the
National Committee on US-China Rela-
tions and the Rhodium Group.
The fact that Eric Chewning, US deputy
assistant secretary of defense for manu-
facturing and industrial base policy, was
the keynote speaker at the Tuesday meet-
ing in Washington to launch the reports
is both surprising and telling.
Chinese FDI in the US plunged by more
than one-third in 2017, the first major cor-
rection in a decade. The value of newly
announced deals in 2017 declined more
than 90 percent.
... the US government
and lawmakers increas-
ingly view Chinese FDI
through the lens of geo-
politics.
An unprecedented number of Chinese
deals were delayed, or abandoned in 2017
as parties failed to obtain approval from
the Committee on Foreign Investment in
the United States, which screens FDI for
potential national security risks.
While the committee’s shortage of staff
was cited as a reason, one of the reports
titled New Neighbors said a more impor-
tant reason is that CFIUS has broadened
its approach to reviewing Chinese deals,
taking into consideration a wider array of
criteria when assessing security risks.
CFIUS prevented nearly $10 billion of
Chinese acquisitions in 2017.
Politicization of deals and political
gamesmanship may deter Chinese and
other international investors, the report
warned.
But such politicizing will likely get
much worse when the US Congress pass-
es the Foreign Investment Risk Review
Modernization Act, or FIRRMA, likely lat-
er this year. FIRRMA will greatly expand
the scope of CFIUS scrutiny and target
mainly Chinese investors coming to the
US. Put bluntly, it is a discriminative act
against Chinese investors.
Chinese investment in the US has
already created nearly 140,000 direct
jobs. That is why US local leaders — gov-
ernors and mayors — have shown huge
enthusiasm for attracting Chinese FDI,
for instance, by leading trade and invest-
ment missions to China.
However, Chinese FDI is quickly politi-
cized once in Washington. In a March 21
opinion piece, Republican Senator John
Cornyn from Texas and Democratic Sena-
tor Dianne Feinstein from California, the
two who introduced the Senate bill, wrote
that “as we speak, China is using any
means available to turn our technology
and know-how against us and erase our
national security advantage. This weap-
onization of investment is aimed at vac-
cuuming up US industrial capabilities in
cutting-edge technologies such as artifi-
cial intelligence and robotics which have
obvious and important military applica-
tion”.
They quoted Joseph Dunford, chair-
man of the US Joint Chiefs of Staff, as say-
ing that by 2025, China will pose the
greatest threat to US national security of
any nation.
Robert Pittenger, a Republican Con-
gressman from South Carolina, who
introduced FIRRMA in the House, simi-
larly scaremongered about Chinese FDI
on the CSPAN channel on Wednesday.
The vicious words reflect the Cold War
mentality in the latest US National Secu-
rity Strategy and National Defense Strate-
gy that define China as a strategic
competitor and a revisionist power that
threatens the US.
Already, Silicon Valley and the US elec-
tronics and semiconductor industries,
which depend a lot on foreign invest-
ment, have voiced deep concerns about
FIRRMA’s and CFIUS’s rejection of Chi-
nese FDI in the tech sector.
There is no doubt that while US gov-
ernment and lawmakers demonize Chi-
nese FDI, the US and American people
stand to lose out on the great opportuni-
ties presented by Chinese outbound
investment.
10 HK | CULTURE Friday, April 13, 2018 CHINA DAILY HONG KONG EDITION

Films

The divas come home

Louisa Wei’s new documentary, Havana Divas, is about
two octogenarian Cantonese opera performers from
Cuba who came all the way to China looking for their
roots. Neil Li caught up with the director.

Wong (in red) and Amaran

perform at the Guangdong
Academy of Cantonese
Opera in 2011.

Caridad Amaran (left) and Georgina Wong in Cantonese

opera costumes during their trip to China in 2014.
PHOTOS PROVIDED TO CHINA DAILY

It took director
Louisa Wei six years
and a trip to Cuba to
make Havana Divas.

Amaran playing female warrior Mu Guiying, 1947.

Wong (left) and Amaran give an impromptu performance at Foshan Ancestral Temple, 2014. A 15-year-old Amaran in Havana.

I
n the mid-1800s, more than
100,000 Chinese people
were living in Cuba. They
established Chinatown dis-
tricts such as Havana’s Barrio
Chino where their culture, food
and music took root. A number
of Chinese opera troupes also
performed, such as the Kwok-
kwong Opera Troupe, comprising
several Cuban or Chinese-Cuban
performers like Caridad Amaran
and Georgina Wong. Hong Kong
filmmaker Louisa Wei has traced
Amaran and Wong’s story and
their lifelong love of Cantonese
opera in her latest documentary,
Havana Divas.
Dual identities
Wei first learned about the Can-
tonese opera-singing Cuban wom-
en from her producer Law Kar on
the sets of her previous film about
the Chinese filmmaker Esther
Eng, Golden Gate Girls. That was
around 2011. And then they found
out that Amaran and Wong, both
already in their 80s, were in fact
in Hong Kong at the time, on their
way to visit their ancestral homes
on the Chinese mainland. Wei
made a quick decision to send a
cameraperson up with the singing
duo to get some footage.
Wei calls Golden Gate Girls and
Havana Divas “sister works”, one
of their shared themes being the
crossing of cultures and borders.
One of Havana Divas’ most mem-
orable sequences shows Amaran
adeptly applying makeup and put-
ting on her costume to transform
into a Cantonese opera performer.
In an instant, the Spanish-speak-
ing elderly Cuban woman switch-
es to singing fluently in Chinese.
It’s a captivating scene that exem-
plifies the women’s dual identity.
Cultural bonding
Chinese people have been living
in Cuba since the 1850s when they
were first brought there on eight-
year indentured laborer contracts
to work on the sugar cane fields.
Today about 1 percent of the Cu-
ban population has Chinese lin-
eage.
While Wong was born to a Cu-
ban mother and Chinese father,
neither of Amaran’s birth parents
were Chinese. After her father’s
early death, her mother remar-
ried Julian Fong and it was from
her Chinese stepfather that Ama-
ran inherited a love of Cantonese
opera.
“Law Kar and I were also at-
tracted to the story by the father-
and-daughter relationships, es-
pecially the one between Caridad
and her foster father. Although he
wasn’t her biological father, the
two of them connected so well over
Cantonese opera, spending a lot of
time together. Their relationship
was better than some between bio-
logical fathers and daughters. My
producer and I were very touched
by this,” Wei says.
Amaran and Wong joined the
Kwok-kwong Opera Troupe in
1939 and toured all over Cuba
throughout their teens. Amaran
had the opportunity to perform
with famous Cantonese opera art-
ists like Siu Yin-fei, Mo Dan-so and
So Chow-lai when they performed
in Havana. Eventually Wong gave
up performing to study in col-
lege and later became a diplomat.
Amaran’s Cantonese opera career
came to a halt after the Cuban
Revolution. She eventually mar-
ried and started a family. It wasn’t
until Wong moved back to Havana
after retirement that the two stage
sisters began performing again in
an effort to revive the art at home.
The way back home
After their initial meeting in
2011, Wei met up with Amaran
and Wong again in 2014 when they
returned to China for the second
time to continue their search for
their ancestral homes. With the
help of friends like Wei’s producer
Law, the women were able to find
and visit the hometowns of Ama-
ran’s stepfather in Kaiping and
Wong’s father in Enping.
Wei felt it was integral to in-
clude the women’s return to their
fathers’ homeland in her film. “I
think (their search) was more of a
nostalgia for their fathers instead
of their fathers’ ancestors. It was
like making a connection to their
fathers. As you grow older, you be-
gin to relate to your parents and
grandparents,” she explains.
Wei went to Havana for two
weeks in early 2015 to film inter-
views with Amaran, Wong and
their families. The women showed
Wei and her crew around the Chi-
natown district. Cuba now has
only about 400 Chinese-Cubans,
many of them elderly people living
in the Barrio Chino.
The film dutifully takes the au-
dience through the women’s jour-
ney from the beginning of their
singing career to the present time,
showing Cantonese opera’s impact
on their lives and communities.
During one of their trips to China,
the divas visited Foshan, the birth-
place of Cantonese opera, where
they took part in an impromptu
performance as well as a profes-
sional photoshoot in full costume
and makeup. The film captured
how thrilled Amaran and Wong
were with these experiences.
“When we were wrapping up
filming, I asked Caridad and Geor-
gina what their biggest wish was
and they both answered it was to
come back to China every year.
They had lots of fun as people
took them to shows and treated
them with food that they missed.
I think these things brought back
their memories of their fathers,”
Wei says.
Threaded narratives
Havana Divas can easily be di-
vided into three parts: the wom-
en’s journey, the Cantonese opera
scene during the 1930s and 1940s
and Cuba’s history. The film might
seem a bit disconnected at times
as the relation between the three
tracks are not immediately obvi-
ous. Wei reveals this gradually,
through a varied mix of music,
interviews and historical material.
Cantonese opera fans will be in-
terested to learn more about the
international reach of the genre
in the 1930s and 1940s, while any
documentary on Cuban life is sure
to touch on its complex history.
Wei spent a long time fact-check-
ing and took care to not bombard
the audience with too much infor-
mation, not an easy task to accom-
plish in a 90 minute-long film.
While Wei enjoyed talking to
Amaran and Wong, who she says
took her in as a friend almost im-
mediately, the language barrier
presented the biggest challenge
in the editing process. Although
Amaran was able to speak a bit of
Chinese, she and Wong primarily
spoke in Spanish which required
Wei, who only knew a little Span-
ish, to spend hours listening to
the interviews while referring to
a translated script alongside.
The effort seems to have paid
off. “From the initial screenings,
the audience seems to come away
with different messages and I’m
happy with that,” Wei says. “Some
people were impressed with the
women’s efforts to preserve Can-
tonese opera. Others were in-
spired by their search for their an-
cestors and wondered about their
own family members they have
lost contacts with. Some even said
it’s about chasing your childhood
dreams. I actually enjoy this part
a lot, listening to people and hear-
ing all these different ideas.”
IF YOU GO
Havana Divas
Directed by Louisa Wei
Date: April 15
Venue: Broadway Cinematheque
Public Square Garden, Yau Ma Tei
Date: April 21
Venue: MOViE MOViE Cinema,
Cityplaza ,Taikoo Shing

Psst, it’s coming to a cinema near you...
By ELIZABETH KERR
“Gimmicky” can mean one of
two things. It can be literal —
something so high-concept its
utter contrivance is clearly en-
gineered to attract attention. It
can also mean something creative
enough to defy logic in our cur-
rent commodified artistic land-
scape — creative enough to look
gimmicky. With that in mind,
John Krasinski follows fellow co-
median Jordan Peele (Get Out)
onto the horror landscape with A
Quiet Place, a nearly silent crea-
ture feature with a second big
bad: noise. Also bucking conven-
tional movie wisdom is Wes An-
derson being Wes Anderson with
his second stop-motion anima-
tion, Isle of Dogs.
In A Quiet Place, Evelyn (Emily
Blunt) and Lee (Krasinski) try to
keep their family together — and
alive — in a world overrun by
some kind of monster that hunts
by sound. Parents, son Marcus
(Noah Jupe, Wonder) and deaf
daughter Regan (Millicent Sim-
monds, Wonderstruck) have given
up shoes, fried food, electronic
toys… anything that makes a
racket. But then pregnant Evelyn
goes into labor, and their care-
fully constructed, low-volume life
starts to unravel.
In Isle of Dogs, dog flu has bro-
ken out in fictional Megasaki City
20 years in Japan’s future, and the
city’s corrupt, cat-loving mayor
has banished all dogs — strays,
pets, service dogs — to Trash Is-
land. His orphaned nephew At-
ari (Koyu Rankin) heads to the
forbidden zone in search of his
beloved Spots. While on the gar-
bage heap, mangy Chief (Bryan
Cranston) and his pack of alpha
dogs help Atari with his quest and
become unsuspecting revolution-
aries.
Isle of Dogs is endlessly artistic;
every one of its 144,000 images is
gorgeous beyond redemption, and
there’s a typically low-key mun-
dane humor at work. The detail
that’s gone into every frame, every
dog hair, every pile of garbage, is
remarkable, and like any Ander-
son film, the visuals are the best
part of the film — because there’s
not much else going on here. A
few nods to the need for an antag-
onistic press and a skeptical view
of government float above the
ether, but the story is about a boy
and his dog. Then the film is also
cursed with Anderson’s signature
brand of twee hipster ennui and
whimsy, and tone deafness. There
are only two females of any signif-
icance in the film — one is pretty
and the other pregnant. Okay.
There’s an American exchange
student who winds up being the
White Savior (and oddly flashes a
Black Power salute). What? And
one of the Trash Island rescuers is
literally washed white, eventually
finding a kinder temperament.
Really? Fortunately, the 1,000 in-
tricately constructed puppets and
voice work by Scarlet Johansson,
Frances McDormand, Bill Murray,
Edward Norton, Yoko Ono, Tilda
Swinton, Liev Schreiber, and Ken
Watanabe among others help
Dogs slide right over its more
problematic elements.
Whether he was trying to make
a statement about the anxieties of
modern parenting (weak) or has
simply crafted a masterful exer-
cise in tension (strong), writer-
director-star Krasinski’s A Quiet
Place is a singularly creepy, en-
tirely visceral movie experience.
Apply any logic to the house of
cards that is the film’s plot and it
Film Review
collapses, but it’s also a nice addi-
tion to the recent wave of thrillers
that have pivoted on the betrayal
of our most basic powers: our
senses. The tension in Lights Out,
Don’t Breathe and Hush is rooted
in an inability to see, hear, or
speak, and Krasinski does it bet-
ter than the rest. As a director he’s
found horror in life’s most rote
moments — toys, dinner, laundry,
“Clean-up in aisle 3” — and after
ramping up the stress levels from
the opening sequence he doesn’t
let it go. Krasinski masterfully
transforms the silence in A Quiet
Place into a sinister character in
its own right. Too bad he didn’t
put as much work into the rest of
the story.

A Quiet Place Isle of Dogs

Directed by John Krasinski. Written and directed by Wes An-

Written by Bryan Woods, Scott Beck, John Krasinski. derson. Starring Bryan Cranston
Starring Emily Blunt and John Krasinski. and Koyu Rankin. US, 101 minutes,
US, 90 minutes, IIB. Opens April 12. IIA. Opens April 19.
 Friday, April 13, 2018 11
Creative “I do not know when and where the seeds I sow will grow”
heads

On choosing the story of Mulan for Hong Kong Dance
Company’s educational program…
Mulan in the Xu Wei play is written in old Chinese. I read the
story when I was in school. The story became quite pivotal in
informing my sensibilities and value system. I was fascinated by
the story of this intrepid woman warrior who sets herself goals
that are hard to achieve.
On tweaking the original production of Mulan for pri-
mary school students…
The All About Mulan show is part of our dance education ini-
tiative. Our focus is on education, we believe in nurturing chil-
dren when they are young and open to new experiences.
It was tricky selecting a show for educational purpose as not
all dance shows we do are suitable for children. We introduced
an element of theater where actors, (playing a schoolgirl and her
father), introduce the story. We also added songs, as children may
not be able to appreciate dancing without the aid of music or
dialogues.
On inviting young audience members to have a go at
working the warrior’s weapon…
I borrowed the technique from the Chinese martial art style
gun shu, creating a dance performance based on the moves. To
me how well it works as a dance move is more important than
its provenance.
On whether young people today can relate to the notion
of filial piety…
Family bonding and respecting one’s elders is very deeply root-
ed in traditional Chinese culture but kids these days do not seem
to feel as passionate about upholding those values. So it’s great to
hear a small boy who came to watch our show say that he actu-
ally felt the emotion. This is the beauty of dance education.
On the mixed audiences drawn by Hong Kong Dance
Company’s educational programs…
My role is more like that of a sower of seeds. I do not know
when and where they will grow. Do it now and maybe the results
will start showing generations later. I don’t have any messages as
such that I would like the audiences to get. I do not expect 3- or
4-year-olds to understand the values informing the story. I would
just like them to remember a feeling, things like parents holding
their hands, bringing them to the theater. When they are older
and revisit the memory, something might spark in them.
I would like the students from dance schools and secondary
schools who came to the show to know that studying an ancient
classical text is not that boring. Mulan is taught in schools and
students who come to this show might start seeing the textbook
story in a new light.
As for the grown-ups, parents and teachers, they would per-
haps rediscover a text they had read as young people and relate
it to their daily lives.
On plans retaking advantage of the recent government
push to develop the arts…
We are very happy to see this push on the part of the govern-
ment to foster growth of cultural activities as well as build an
audience. That said I feel we are vested with great responsibili-
ties, being a government-funded organization, and we have to
constantly strive toward pushing ourselves forward.
If we had more funds we would consider involving more lo-
cal artistes, independent artistes and other professionals in our
projects. Even this production of Mulan could be so much better
in terms of theatrical skills involved, the quality of screen projec-
tions and design. That’s how we can push it to a different level
artistically.
Our tickets cost only HK$10 a piece, so it’s impossible to make
an improvement in quality without government support.
On the enduring appeal of Mulan…
Mulan is indeed the flagship show in our repertoire. Our origi-
nal show was created a decade ago and has traveled to many
places but I think there’s still room for improvement. Every time
I watch the show I see scope for improvement so I don’t want
to limit the possibilities as to how it could grow. It could be a lot
more than just a regular dance-based show and an educational
performance. This show should be evergreen and ever-growing
and someone else who takes over after me will, hopefully, con-
Yang Yuntao, tinue to develop this show and make it continue to evolve.
ARTISTIC DIRECTOR, HONG KONG DANCE COMPANY
Interviewed by Chitralekha Basu.

Our pick of city events from April 13 to 22 Warm up for jazz marathon
Jazz season will soon be upon us in Hong Kong. In
the lead-up to the mega jazz marathon on May 1,
International Jazz Day, get in the mood with an evening

Green is good of modern jazz performed by Hong Kong’s own Island

Find out about better ways
of living in harmony with
the planet. That’s the offer
being made by The Conscious
Festival, a three-day event that
promotes social environmental
responsibility without getting
too heavy about it.
The idea is to help people
make more informed decisions
about how to live, think and
consume as well as raise
awareness of the environmental
impact of those choices. To
IF YOU GO that end the festival provides a
balanced offering of information
The Conscious Festival
Organizers: Green Is the New Black and entertainment, including
Dates: April 20 to 22 interactive art, live music and
Venue: PMQ, Aberdeen Street, Central edu-tainment activities, along
https://greenisthenewblack.asia/festival/
with opportunities to buy eco-
friendly products and enjoy a
variety of healthy vegetarian
food and organic drinks. Find
out ways of going eco-friendly
at work from the industry
leaders and watch films with an
environmental theme.
The first day has a business
focus, followed by two days of
public events, to be enjoyed with
friends and family.
This is the festival’s first
appearance in Hong Kong after
a successful launch last year
in Singapore. Coinciding with
Earth Day on April 22, the event
is supported by Ocean Recovery
Alliance, a Hong Kong-based
charity with a focus on cleaning
the seas.
Express Jazz Orchestra. Formed in 2010, the band
comprises 17 international musicians of all ages and
backgrounds and mainly plays large ensemble arrange-
ments. Listen to them strutting their contemporary
stuff at the Fringe Dairy next weekend.
Island Express Jazz Orchestra
Date: April 21
Venue: Fringe Dairy, Fringe Club
Lower Albert Road, Central
www.hkfringeclub.com
Hong Kong talent at MANGA
Works by some of the finest from among Hong Kong’s
comic artists are on display at Comix Home Base in an
exhibition that celebrates the winners of the Japan Inter-
national MANGA Award. Check out this year’s gold medal
winner, Two Aldos by Colombian Diaz (pictured), Hong
Kong’s Dai Hing-yin’s Secret Weapon and Eric Cheng’s
Westward, two of this year’s award winners, besides other
winning titles from previous years.
Thematic Book Display: Japan International MANGA
Award-winning Hong Kong Comics
Dates: April 13 to May 13
Venue: Comix Home Base
7, Mallory Street, Wan Chai
www.comixhomebase.com.hk

Shutterbug's Corner What clicked for us this week Heard the latest?
Videos, texts and posts produced by China Daily
Hong Kong we thought you shouldn’t miss

Searching for equilibrium: Yoga practitioners seek balance in outdoor locations around Hong Kong. PHOTOS BY EDMOND TANG / CHINA DAILY

Like tinkering with your camera? Send us your most outstanding snaps with a common theme in a cluster of three or more.
We will carry the ones our photo editor really likes. Send your images to photo@chinadailyhk.com.
Eastern Pioneers
Over the years, a steady stream of curious or adventurous foreigners have made their way
to — or sometimes stumbled upon — China from different parts of the world. While many
have not stayed long or left without making much of a mark, others are noteworthy for
their impact on the people or places they touched. In the first of a new series of profiles of
these expats, Jon Lowe meets Hong Kong born Simon Willson, official DJ for the Hong Kong
Sevens. In the mid 1980s, Willson became the first expat DJ to have a residency in Shanghai,
from where he introduced a generation to Western music.
https://www.chinadailyhk.com/articles/100/29/101/1523068645998.html
12
WORLD
Friday, April 13, 2018
CHINA DAILY HONG KONG EDITION
Xi mourns victims
of crash in Algeria
By ZHANG YUNBI
zhangyunbi@chinadaily.com.cn
President Xi Jinping sent a
condolence message on
Thursday to Algerian Presi-
dent Abdelaziz Bouteflika over
the military transport plane
crash that killed 257 people in
the worst aviation disaster in
the North African nation’s his-
tory and plunged the country
into mourning.
In the message, Xi, on behalf
of the Chinese government
and people, mourned the vic-
tims and expressed great sym-
pathy and sincere condolences
to those injured and the fami-
lies of the victims.
Premier Li Keqiang also
sent a condolence message to
Algerian Prime Minister
Ahmed Ouyahia.
The plane went down in a
field just outside a military
base in Boufarik, 30 kilometers
south of Algiers, and was
devoured by flames, killing 247
passengers and 10 crew mem-
bers, the Defense Ministry said.
There was no official men-
tion of survivors.
Several witnesses told Alge-
rian TV network Ennahar that
they saw flames coming out of
one of the plane’s four engines
just before it took off.
Facebook CEO Mark Zuckerberg testifies before a House hearing
regarding the company’s use and protection of user data in
Washington on Wednesday. AARON P. BERNSTEIN / REUTERS
Facebook chief open
to idea of regulation
WASHINGTON — Face-
book CEO Mark Zuckerberg
acknowledged that regulation
of social media companies is
“inevitable” and disclosed that
his own personal information
has been compromised by
malicious outsiders.
But after two days of con-
gressional testimony, what
seemed clear was how little
Congress seems to know about
Facebook, much less what to
do about it.
On Wednesday, House law-
makers aggressively ques-
tioned Zuckerberg on user
data, privacy settings and
whether the company is
biased against conservatives.
As they did in the Senate a day
earlier, both Republicans and
Democrats suggested that reg-
ulation might be needed, but
there was no consensus and
few specifics about what that
might look like or even what
the biggest problems are.
Representative Frank Pallo-
ne, the top Democrat on the
panel and a 30-year veteran of
the House, said at the begin-
ning of the hearing that he
plans to work on legislation
but is pessimistic that Con-
gress will pass anything.
“I’ve just seen it over and
over again that we have the
hearings, and nothing hap-
pens,” he said.
For Zuckerberg, who often
found himself explaining what
his company does in rudimen-
tary terms to lawmakers twice
his age, the hearings could be
considered a win: Facebook
shares rose more than 1 per-
cent after climbing 4.5 percent
on Monday. And his company
“The plane started to rise
before falling,” an unidentified
man lying on what appeared
to be a hospital bed told Enna-
har TV. “The plane crashed on
its wing first and caught fire.”
The four-engine Il-76 made
its maiden flight in 1997,
according to Aviation Safety
Network. The plane has been
in production since the 1970s,
and is widely used for both
commercial freight and mili-
tary transport.
President Bouteflika
ordered three days of mourn-
ing starting immediately and
prayers for the dead on Friday
at mosques across the country.
Algeria is vast and plane
flights are often the best way to
traverse Africa’s largest nation.
It was the first crash of an
Algerian military plane since
February 2014, when a US-built
C-130 Hercules turboprop
slammed into a mountain in
Algeria, killing at least 76 people
and leaving just one survivor.
The previous deadliest crash
on Algerian soil occurred in
2003, when 102 people were
killed after a civilian airliner
crashed at the end of the run-
way in Tamanrasset. Only one
person survived.
AP contributed to this story.
regained more than $25 bil-
lion in market value that it had
lost since it was revealed in
March that Cambridge Analyt-
ica, a data-mining firm affiliat-
ed with Donald Trump’s
presidential campaign, gath-
ered personal information
from 87 million users to try to
influence elections.
Still, Facebook’s stock
remains 10 percent below
where it stood before the
scandal, a decline that has
wiped out about $50 billion in
shareholder wealth.
Zuckerberg agreed to the
hearings as pressure mounted
over the Cambridge Analytica
scandal and the company’s
own admission last year that it
had been compromised by for-
eigners trying to influence the
2016 election.
Zuckerberg told the Senate
on Tuesday that the company
has been working with Muel-
ler in his Russia probe and
apologized over and over
again for the company’s han-
dling of data privacy.
“I started Facebook, I run it,
and I’m responsible for what
happens here,” he said.
On regulation, Zuckerberg
said he was open to it.
“The internet is growing in
importance around the world
in people’s lives and I think
that it is inevitable that there
will need to be some regula-
tion,” he said.
That may be enough to sat-
isfy lawmakers for now. But
that could change if Demo-
crats take control of Congress
in midterm elections this year.
ASSOCIATED PRESS
Injuries in THAAD clashes
Demonstrators clash with riot police over the deployment of the US Terminal High Altitude Area Defense missile defense system, known
as THAAD, in Seongju, South Korea, on Thursday. Several people were injured. YONHAP NEWS AGENCY VIA VISUAL CHINA
US wrestles with Russia
over chemical weapons use
For Washington, undermining Moscow
role in Syria a main goal, experts say
By CHINA DAILY
The allegations of chemical
weapons use in Syria seem
like a front for settling scores
between major powers and
that was obvious in the recent
tweets by US President
Donald Trump against Russia.
In one of his posts on
Wednesday, Trump said the
relationship with Russia was
at a historic low.
“Our relationship with Rus-
sia is worse now than it has
ever been, and that includes
the Cold War,” he tweeted, a
day after his country and Rus-
sia clashed diplomatically in
the UN Security Council over
the draft resolutions to deal
with the allegations of chemi-
cal weapons use by Syrian for-
ces.
Both powers vetoed each
other’s draft resolutions, with
the Russians accusing the
United States of prejudging
the outcome of the investiga-
tion of the chemical weapons
use in Douma, east of Damas-
cus, while Washington said
Moscow was trying to carry
New ripples of uncertainty after Ryan retires
WASHINGTON — US
House Speaker Paul Ryan’s
abrupt announcement that
he will retire rather than seek
another term in Congress as
the steady if reluctant wing-
man for President Donald
Trump sent new ripples of
uncertainty through a Wash-
ington already on edge and a
Republican Party bracing for
a rough election year.
Ryan said he had decided to
end his 20-year career because
he doesn’t want his children
growing up with a “weekend
dad”, but it will create a vacu-
um at both ends of Pennsylva-
nia Avenue.
It will leave congressional
Republicans without a meas-
ured voice to talk Trump away
from what some see as damag-
ing impulses, and it will rob
Trump of an influential stew-
ard to shepherd his more
ambitious ideas into legisla-
tion.
Trump praised Ryan as “a
truly good man”.
out the investigation their
way.
But for many observers, the
chemical weapons pretext is
just a front behind which the
US aims to target Russia’s
interests in Syria, particularly
after the Syrian-Iranian-Rus-
sian alliance has almost won
the war in Syria, while the US
has been largely marginalized.
For the US, undermining
the Russian role in Syria is the
main goal, while for Israel,
eliminating the Iranian role is
the main goal, they said.
So the equation is Russia
versus the US and Israel ver-
sus Iran.
Before his tweets on
Wednesday, and while com-
menting on the chemical
weapons allegations, Trump
said: “If it’s Russia, if it’s Syria,
if it’s Iran, if it’s all of them
together, we’ll figure it out,” he
said, adding that Russian Pres-
ident Vladimir Putin, “every-
body’s going to pay a price —
he will, everybody will”.
But the White House said no
“final decision” has been made
and all options were still on
It’s unusual for a House
speaker, third in line to suc-
ceed the president, to turn
himself into a lame duck,
especially so for Ryan, a once-
rising GOP star who is only 48
and was the party’s vice-presi-
dential candidate in 2012. His
decision fueled fresh doubts
about the party’s ability to
fend off a Democratic wave,
fed by opposition to Trump, in
November. And it threw the
House into a leadership battle
that could end up pushing
Ryan aside sooner than he
intended and crush any hopes
for significant legislation
before the election.
Speculation over Ryan’s
future had been swirling for
months, but as he dialed up
colleagues and spoke by
phone with Trump, the news
stunned even top allies.
Ryan announced his plans
at a closed-door meeting of
House Republicans. Repre-
sentative Mark Walker of
North Carolina said an emo-
the table concerning Washing-
ton’s response to the suspected
chemical weapons attack.
After the US warmongering
rhetoric against Syria and its
allies, Russia warned the US
of striking Syria.
Russia’s envoy to the Euro-
pean Union Vladimir Chizhov
said his country has warned
the US against striking Syria.
“Russia has warned US repre-
sentatives, publicly as well as
through proper channels,
over the grave consequences
that could arise if these strikes
happen and whether deliber-
ately or otherwise Russian cit-
izens are hurt,” he said.
Israel’s Prime Minister Ben-
jamin Netanyahu official
Twitter account reported that
he spoke by telephone with
Putin and reiterated that Isra-
el will not allow Iran to estab-
lish a military presence in
Syria.
“I have a message to the rul-
ers of Iran,” Netanyahu said.
“Do not put to the test Israel’s
resolve.”
This came as Israel targeted
the Syrian T-4 air base in
Homs days ago, killing 14 sol-
diers including Iranian fight-
ers amid Iranian warnings.
On Wednesday, Iran vowed
to retaliate for the attack,
Paul Ryan, speaker of
the US House, announces his
retirement on Wednesday.
SAUL LOEB / AGENCE FRANCE-PRESSE
tional Ryan “choked up a few
times trying to get through”
his remarks and received
three standing ovations.
He later briefly thanked
Trump in public for giving
him the chance to move GOP
ideas ahead.
While Ryan was crucial in
getting the tax cuts passed, a
prime Trump goal, he and the
president have had a difficult
relationship. Trump showed
impatience with Congress’
pace in dealing with his pro-
posals, and Ryan had to deal
with a president who shared
while blaming Israel for the
strike.
Ali Akbar Velayati, a senior
adviser to Iran’s Ayatollah Ali
Khamenei, said on Wednes-
day that Israel’s “crimes will
not remain unanswered”.
Chinese Foreign Ministry
spokesman Geng Shuang said
on Thursday that China wor-
ries about the possible escala-
tion of the situation in Syria
and called for all parties to
keep calm and ease tension.
Geng said China insists on
peaceful settlement of dis-
putes, opposes use of violence
or threat of force in interna-
tional relations, and advo-
cates acting in line with the
United Nations Charter.
He said China has been
paying close attention to the
latest developments in Syria
and making contact with oth-
er members of the UN Securi-
ty Council and regional
countries, including the US
and Russia.
He also said that the State
Councilor and Foreign Minis-
ter Wang Yi had exchanged
views on this matter thor-
oughly with UN Secretary-
General Antonio Guterres.
Xinhua, Zhou Jin in Beijing
contributed to this story.
little of his interest in policy
detail.
Still, for many Republicans,
it’s unclear who will be left in
leadership to counterbalance
Trump. Ryan has been “a
steady force in contrast to the
president’s more mercurial
tone,” said Representative
Mark Sanford of South Caroli-
na. “That’s needed.”
The speaker had been
heading toward this decision
since late last year, said a per-
son familiar with his think-
ing, but as recently as
February he had considered
running for another term. His
own father died suddenly of a
heart attack when he was 16,
and though Ryan is in good
health, the distance from his
family weighed on him. A
final decision was made over
the two-week congressional
recess, which he partly spent
on a family vacation in the
Czech Republic.
AP—XINHUA
UK will be
‘less green’
after it
leaves EU
By EARLE GALE in London
earle@mail.chinadailyuk.com
Britain’s natural envi-
ronment is likely to deteri-
orate after the United
Kingdom leaves the Euro-
pean Union, according to a
report commissioned by
Friends of the Earth.
Its conclusions mean
Prime Minister Theresa
May’s government is
“unlikely” to deliver on its
promise of a green Brexit,
The Guardian newspaper
reported on Thursday.
Kierra Box, a Friends of
the Earth spokesperson, said
the group hopes the govern-
ment will now pay attention
to protecting the environ-
ment after it is no longer
bound by the EU’s stringent
environmental regulations.
“We were promised that
Brexit wouldn’t harm our
environment — but this
analysis shows that, under
all scenarios currently on
the table, this promise will
be broken,” Box said. “We
hope this report will spur
parliament to make much-
needed changes to the with-
drawal bill … to lock in
guarantees for our environ-
ment that the report authors
have found lacking so far.”
Under all scenar-
ios currently on
the table, this
promise will be
broken.”
Kierra Box, Friends of the
Earth spokesperson
The damning report says
wildlife, habitat, water qual-
ity, and air purity are all
likely to deteriorate, and the
control of chemicals and
food safety regulations look
set to be watered down.
Michael Gove, UK envi-
ronment secretary, had said
the country will be a global
“champion” of green poli-
cies after it leaves the bloc at
the end of next March.
Meanwhile, Michel Barni-
er, the EU’s chief negotiator,
seems unimpressed by the
assurances. Reuters has
reported he wants a “non-re-
gression” clause to be includ-
ed in any future trade deal
between the UK and the EU,
so the bloc’s standards are
preserved in the UK.
Barnier said May assured
the EU that London will not
water down its environmen-
tal protection, and he said
her words were reflected in
Britain’s proposed 25-year
plan for the environment.
“This is welcome, but my
responsibility as the EU
negotiator is to remain
extremely vigilant,” Reuters
citied him as saying.
The report was written
by academics at Sheffield
University, Queen’s Univer-
sity Belfast, and the Univer-
sity of East Anglia. They
looked at likely gaps in
environmental legislation,
possible miscommunica-
tion between London and
the devolved parliaments of
Scotland, Wales and North
Ireland, and other factors.
The researchers consid-
ered a range of Brexits, from
a Norwegian-style arrange-
ment that would keep the
UK close to the EU, to a
no-deal scenario and total
separation. They found a
“very high risk” to birds and
habitats under all scenarios.
 CHINA DAILY HONG KONG EDITION Friday, April 13, 2018
Experts hail Xi’s stance on foreign access
China showing
commitment to
role as leader,
forum told
By CECILY LIU in London
cecily.liu@mail.chinadailyuk.com
British experts have wel-
comed China’s commitment
to continue with the reform
and opening-up of its markets
to allow more foreign access,
which President Xi Jinping
highlighted in his keynote
address at the Boao Forum for
Asia 2018 annual conference
on Tuesday.
They said Xi’s speech shows
China’s policy consistency, its
willingness to contribute
toward global economic
growth, and its commitment
to be a responsible global pow-
er.
“Xi’s speech has been an
important marker in terms of
China’s opening-up of its mar-
kets,” said Rana Mitter, direct- Foreign reporters attend the opening ceremony of Boao Forum in Boao, Hainan, on Tuesday. XING GUANGLI / XINHUA
or of the University of Oxford
China Centre. “At a time when
the language of trade war is Shanghai this November as and reduce import tariffs for ready for more open policies. only China but also “meets the
being used, it is important for evidence.
leaders to say clearly that the
opening up of markets and in an ordinary sense, but a London School of Economics’ reform and opening-up policy,
mutual trade are important.”
Xi stressed that China does commitment taken of our own said Xi’s speech reflects a integrated China into global London, said this commit-
not seek a trade surplus and accord to open up the Chinese confidence from the govern- trade flows and consequently ment from Xi “indicates a wish
has a “genuine desire” to market,” Xi said.
increase imports, highlighting
the first China International this year significantly lower economy, including the auto- this journey of reform and importance of working with
Import Expo to be held in the import tariffs for vehicles motive industry, are now opening-up, which serves not other countries for the benefit
Trade war could ‘hurt millions’, Ma warns Book contributes China’s
By ZHAO HUANXIN
in Washington
huanxinzhao@
chinadailyusa.com
Protectionism will not
improve competitiveness of
the United States, and a trade
war will hurt millions of
small businesses and farmers
in the country, Alibaba
founder Jack Ma said in an
opinion piece published in
The Wall Street Journal on
Wednesday.
In the article, Ma suggested
that as China, the largest
potential consumer market
in the world, is open for busi-
ness, the US risks forfeiting
such an opportunity by wag-
ing a trade war.
His comments came at a
time when the world’s top
two economies are embroid-
ered in a bitter trade dispute.
Before the current spat, the
Chinese e-commerce giant
suffered a setback in the US in
February, when the Commit-
tee on Foreign Investment in
the United States blocked the
$1.2 billion purchase of Dal-
las-based US money transfer
company MoneyGram by Ant
Financial, an affiliate of Ali-
baba.
The Donald Trump
administration threatened
Integrated approach vital to Asia prosperity
By WEN ZONGDUO and
YANG HAN in Boao, Hainan
Leaders of multilateral
organizations in and around
Asia foresee a significant role
of regional cooperation in a
shared future of Asian pros-
perity. And more integrated
approaches can work better
against common challenges
such as poverty, terrorism
and pollution.
“Asia’s future lies in region-
al cooperation,” said Liu
Zhenmin, United Nations
under-secretary-general for
economic and social affairs,
at the Asian Regional Cooper-
ation Organization Roundta-
ble at the Boao Forum for
Asia Annual Conference 2018
on Wednesday.
“In this region, we have so
many big powers, and we
have attracted so many big
powers,” he said.
“Based on decades of experi-
ence, regional cooperation not
only promotes peace and sta-
bility, but also deepens eco-
nomic and social cooperation.”
some other products.
“It is not just another expo
major policy initiative and Institute of Global Affairs, a process that has significantly icy chairman for the City of
ment in recognizing that fueled its economic miracle.
He added that China will many parts of the Chinese
Jack Ma, founder and chairman of Alibaba Group, talk with IMF
Managing Director Christine Lagarde on the sidelines of the Boao
Forum on Monday. XING GUANGLI / XINHUA
to impose tariffs on $100 bil-
lion worth of Chinese prod-
ucts last week, in addition to
a $50 billion tariff package
proposed two days before,
which provoked China into
slapping 25 percent tariffs
on imports of US soybeans,
corn, airplanes and automo-
biles.
US soybeans sold to China
account for 62 percent of its
total soybean exports. A 25
percent tariff on the product
will have a devastating effect
on every soybean farmer in
the US, American Soybean
Association President John
Regional cooperation not
only promotes peace and
stability, but also deepens economic
and social cooperation.”
Liu Zhenmin, United Nations under-secretary-general for
economic and social affairs
Liu said he believes organi-
zations such as the Asian
Cooperation Dialogue will
continue to improve pan-
Asian communication. The
G20 is a very important multi-
lateral mechanism in today’s
world, and globalization has
basically brought benefits for
all nations involved.
“Globalization is like a train
that cannot go back once
started,” he said.
Secretary-General of Asso-
ciation of Southeast Asian
Nations Dato Lim Jock Hoi
expressed his appreciation
for Chinese President Xi Jin-
ping’s vision for openness and
innovation and for a commu-
nity of shared future. While
The year 2018 marks the global trend toward develop-
Erik Berglof, director of the 40th anniversary of China’s ment, cooperation and peace”.
Xi said China will continue one that understands the
Heisdorffer said earlier last
week.
“Instigating a trade war is
the wrong solution because it
will only provoke retaliation,”
Ma wrote. “The US has been a
consistent defender of free
and open markets, but this
time it is resorting to protec-
tionism that will not improve
American competitiveness.”
The billionaire made head-
lines at Trump Tower in New
York early last January, when
he and then president-elect
Trump discussed “plans to cre-
ate 1 million US jobs by allow-
ing small- and medium-sized
sharing ASEAN’s perspective
and experience on innovation
and development, he raised
three points.
First, ASEAN is committed
to continuously transforming
itself as a dynamic, competi-
tive and innovative region.
Second, while the opportu-
nities from technology and
innovation seem boundless,
the benefits for many are not
automatic. And ASEAN is
engaging in collaboration in
such a pursuit.
His third point stressed the
need to harness innovation to
steer ASEAN’s economic
transformation.
He said to facilitate cross-
border e-commerce and
Catherine McGuinness, pol-
for China to be a global player,
businesses to sell to China
through Alibaba’s platforms”.
But the plan seems to be hit-
ting a snag. At a discussion on
Monday at the Boao Forum for
Asia in Hainan province,
South China, Ma said, “if Chi-
na and the US have a good
relationship, we cannot only
make 1 million jobs, we can
make 10 million or 20 million
jobs for both countries,”
according to a livestream of
the discussion.
“If they have no good trade
relationship, we are going to
destroy 10 million jobs,” he
added.
In Wednesday’s article,
however, Ma said his company
is committed to supporting
small businesses. Through its
digital-commerce platforms,
where at least 500 million Chi-
nese consumers shop, Alibaba
will continue to help US small
businesses and farmers access
the China market, he said.
Still, he cautioned, “this
trade war will hurt millions of
American small businesses
and farmers”.
Ma, however, remained
upbeat about the future, say-
ing that while facing setbacks
in the current protectionist
environment, “I remain confi-
dent and look forward to the
next 20 years.”
exchange of innovation and
technology, international
coordination is essential and
ASEAN is stepping this up.
Gong Jianwei, executive
director of secretariat of the
Conference on Interaction
and Confidence Building
Measures in Asia, or CICA,
noted some countries have
been left behind in economic
development and such ine-
quality is causing conflicts in
some areas.
“There can be no sustaina-
ble security without sustaina-
ble development,” Gong said.
ASEAN-China Center Sec-
retary-General Yang Xiuping
said it is the common task for
ASEAN and China to further
realize the economic transfor-
mation and upgrading and
promote technological inno-
vation. ACC is an intergovern-
mental organization co-
founded by 10 ASEAN
member states and China.
“We should build on the
momentum and lift Asian
regional cooperation to a new
height,” she said.
solutions to global tests
By WANG MINGJIE
and CECILY LIU in London
It is all the more important
for China to push globaliza-
tion forward at a time when
the world is becoming more
unpredictable, a former prime
minister of Italy said at the
launch of the second volume
of Xi Jinping: The Governance
of China in nine languages.
Speaking at the ceremony in
London on Wednesday, Mario
Monti said President Xi Jin-
ping’s vision of building a com-
munity of shared future for
mankind is crucial now the
United States is resorting to uni-
lateralism and protectionism.
“To have a national leader
but also a global leader like
President Xi Jinping present-
ing his vision for the very long
term, exactly the opposite of
facing unpredictability, is very
important,” he said. “I think
it’s normal that each national
leader tries to pursue first the
interest of his or her own
country, but the problem is
that we should be mature
enough to understand that
even the largest of the coun-
tries these days can’t lead in a
sustainable way, unless this is
a part of the cohesive and har-
monious growth of the inter-
national system.”
Versions of Xi’s book in tra-
ditional Chinese characters,
English, French, Spanish, Ger-
man, Russian, Japanese, Ara-
bic and Portuguese were
unveiled in the presence of
300 political, business, aca-
demic, and publishing indus-
try leaders from 14 countries.
The new book follows the
successful publication of the
first volume, which was pro-
duced in 2014 and is available
in 24 languages.
As part of the launch, a sem-
inar themed “China in the
New Era” was held on the
same day, offering a platform
for scholars to discuss two key
concepts proposed by Xi — Xi
Jinping Thought on Socialism
with Chinese Characteristics
for a New Era and the building
of a community of shared
future for mankind.
Jiang Jianguo, minister of
the State Council Information
Office, said the concepts con-
tribute China’s solutions to the
issues facing the world.
“We should have an open
mind and seek common
ground while shelving our dif-
WORLD 13
of the entire global economy”.
She said this commitment is
order to keep growth stable.”
Meanwhile, Xi said China
consistent with steps China will “stay as determined as
has already taken in recent ever” to build world peace,
years to increase market contribute to global prosperi-
access. In particular, she high- ty, and uphold international
lighted China announcing in order.
November that it was allowing Mitter said this commit-
for the first time foreign finan- ment is consistent with Chi-
cial companies to hold control- na’s responsibility as a great
ling stakes in joint ventures as power, and its ability to be a
a key example of a benefit to powerful force on economic
the global community. and security matters.
“As President Xi says, open- “Both the United States and
ing brings progress, while clo- China have a strong responsi-
sure leads to backwardness. In bility to act as great powers —
order to reap the benefits of that is, understanding that
development, innovation and their actions have consequen-
a better life for everyone, a ces well beyond their national
country must truly open its boundaries. A world where the
doors to the world. United States and China coop-
“President Xi, and the peo- erate on regional security, cli-
ple of China, fully understand mate change, and
this, and everything we are international trade is essen-
hearing shows that the coun- tial,” said Mitter.
try is heading in this direc- Berglof said China’s best
tion,” said McGuinness. option to contribute toward
upholding international order
Existing plans is “through deep engagement
Jinny Yan, chief China econ- with the rest of the world com-
omist at ICBC Standard Bank, munity and ensuring that it
agreed, adding that Xi’s does so in a transparent and
speech was consistent with collaborative manner”, espe-
China’s existing plans to fur- cially when it comes to inter-
ther its reform and opening national projects such as the
up, instead of being distracted China-proposed Belt and
by short-term US trade ten- Road Initiative.
sions. “By genuinely engaging
“The cost of derailing with international institutions
domestic economic growth is and foreign partners, it could
far greater to China than the contribute to bringing eco-
immediate cost of a trade nomic and broader institu-
war,” Yan said. “This means tional development to
China’s main priorities countries which, until now,
remain pushing forward have not seen much of either,”
with planned reforms in said Berglof.
China is fundamental to a
world which is being trans-
formed by globalization.”
Nick Clegg, former deputy
In a remarkable prime minister of the UK, said
the role of China is of “axiomat-
fashion, China has ic and fundamental impor-
tance”, both to the future of
stepped forward China and the world, because a
with a new idea of number of Western democra-
cies are enduring a period of
the future.” disruption and introversion.
“So, if the Chinese leader-
Martin Jacques, author of ship is able to look outward
When China Rules the World and act with responsibility for
the wider world, that I think
will be of huge significance,”
ferences, and work together to Clegg said. “We are living in a
build a community of shared very dangerous time where
future for mankind,” he added. there is a great deal of econom-
Liu Xiaoming, China’s ic, social, and possibly military
ambassador to the United volatility, and we need cool
Kingdom, said the world heads and wise minds to make
needs to understand China in sure that we get through this
the new era in order to seize phase of global history as
the “Chinese opportunities”. peacefully as we can.”
Felipe Gonzalez, a former
West is ‘turning inward’ prime minister of Spain, said:
And global scholars and “China is continuing to open up
political leaders also praised the and is looking for shared inter-
book and China’s commitment ests. Globalization is a positive
to globalization at a time when for the whole of mankind and I
the West is turning inward. hope China can become a stabi-
Martin Jacques, author of lizing force. We should have
When China Rules the World, rules that are consented by all
said: “The West has kind of of us, so that building a com-
lost the plot and is blighted by
decay and decline. The world
needs a new vision and sense
munity of shared future for
mankind can become a reality.”
of direction. In a remarkable Liu Yixuan contributed
fashion, China has stepped to this story.
forward with a new idea of the
future. A shared destiny of a Contact the writers at wang-
common future offered by mingjie@chinadailyuk.com
Cdi^XZd[=djhZ:megdeg^Vi^dc
De$ ('/& WdZ De$ ('/( ^eki[i ed AWd]i^[d HeWZ" P^ekfk Jemd"
FkZed]D[m7h[W"I^Wd]^W_emd[ZXo@_dOWd^ed]"m[h[_dYbkZ[Z
_dj^[^eki[[nfhefh_Wj_edWh[WedCWhY^)&"(&',"Zk[jej^[fkXb_Y
YedijhkYj_edfhe`[Yje\Wfh_cWhoiY^eeb_dlebl_d]j^[Wh[We\BWdZ
8#)#("Kd_j,"P^ekfk9[djhWbJemd$
J^[ [nfhefh_Wj_ed ^Wi Yec[ je Wd [dZ$ J^[ ^eki[ emd[hi i^ekbZ
YedjWYj j^[ Z[fWhjc[dj _cfb[c[dj_d] j^[ [nfhefh_Wj_ed m_j^_d
j^[ \ebbem_d] ,& ZWoi" je h[WY^ W]h[[c[dj ed j^[ Z[jW_bi e\ j^[
[nfhefh_Wj_edWdZYecf[diWj_ed$
Edj^[[nf_hoe\j^_idej_Y["j^[_dlebl[ZZ[fWhjc[djim_bbh[b[Wi[W
i[h_[ie\ZeYkc[djiedj^[dej_Y[XeWhZWjj^[[nfhefh_Wj[Z^eki[i
WdZ bWdZ" Wi m[bb Wi ed j^[ ]el[hdc[dj m[Xi_j[$ J^[o _dYbkZ[
j^[ W]h[[Z Yecf[diWj_ed fbWd cWZ[ m_j^ j^[ ^eki[ emd[h" j^[
^eki_d][nfhefh_Wj_edWii[iic[djh[fehj"YedikbjWj_eddej_ÓYWj_ed"
WffhW_iWb WdZ WZl_Y[ b[jj[h" ^eki_d] [nfhefh_Wj_ed Yecf[diWj_ed
Z[Y_i_edh[fehj"^[Wh_d]dej_Y["^eki_d][nfhefh_Wj_edYecf[diWj_ed
Z[Y_i_edWdZh[c_dZ[hb[jj[h$IkXi[gk[djbo"j^[[nfhefh_Wj_edm_bb
X[[d\ehY[ZW\j[hWffb_YWj_edjej^[f[efb[iYekhj$
#ONTACTóADDRESSDe$((&'AWd]i^[dHeWZ"P^ekfkJemd"FkZed]
D[m7h[W"I^Wd]^W_
#ONTACTóPERSONChOWe"f^ed[0.,#('#(&/.,()(
#ONTACTó TIME CedZWo#<h_ZWo" .0)&#',0)& [nY[fj dWj_edWb
^eb_ZWoi
J^[ I[YedZ >eki_d] ;nfhefh_Wj_ed I[hl_Y[ 9ecfWdo B_c_j[Z"
FkZed]D[m7h[W"I^Wd]^W_
7fh_b')"(&'.
14 WORLD
Afghan star helps kids score World Cup goal
Russia tournament empowering
young victims to find new avenues
MEXICO CITY — Yelling
commands and lunging for
the ball on the balding astro
turf, Khalida Popal drilled the
team of nine Mexican teenage
girls through soccer training,
weeks before they jet off to
Russia for the World Cup —
the street children’s version.
For Popal, former captain of
the Afghan women’s team,
soccer can open new avenues
and boost self-esteem for the
Team Mexico girls, who
laughed and high-fived as
they tackled and scored in the
baking heat.
“When you enter the pitch,
you forget about everything.
The only thing you think
about is the ball and the game
— that’s the beauty of foot-
ball,” said Popal, who was
Savoring a sweet moment
New Canadian citizen David Alfonso, 8, reacts as maple taffy is prepared for new Canadians following a citizenship ceremony at the
Vanier Sugar Shack in Ottawa, Ontario, Canada, on Wednesday. CHRIS WATTIE / REUTERS
First plastic-collecting vessel augurs
changing tide in fight against pollution
GENEVA — With a total
deck surface roughly the size
of a football pitch, The Manta,
the first seagoing boat capa-
ble of collecting large quanti-
ties of macro plastic waste
floating on oceans, was defi-
nitely the star on the first day
of the 46th International
Exhibition of Inventions of
Geneva on Wednesday.
Though still under con-
struction, the giant boat,
designed to be 70 meters
long, 49 meters wide and 61
meters high, is based on the
latest innovative technologies
in the field of clean self-suffi-
cient energy, and has an opti-
mized maneuverability
allowing her to rapidly reach
highly polluted areas whether
at sea, along coast lines or in
estuaries.
According to project man-
Fans shocked and angry as BBC admits to faking scenes in documentary
LONDON — Fans of BBC
expressed their shock and
anger on social media after
the broadcasting corporation
admitted in a statement last
week that scenes from its doc-
forced to flee her homeland
after death threats.
“I know what it is being
without identity, being with-
out family, being without net-
works,” said the ambassador
for Street Child United, a Brit-
ish charity, wearing a number
10 top with her name embla-
zoned on the back.
“What always helped me to
come through that tough and
difficult situation was to play
football.”
Children from more than
20 countries, including India,
Brazil and Kenya, will con-
verge on Moscow in May for
the Street Child World Cup,
whose ambassadors include
Brazil’s Gilberto Silva and
England’s Alex Scott, ahead of
FIFA’s 2018 event.
10 tons
amount of plastic waste The
Manta will be capable of
collecting and processing per
day, or a total of 250 tons in a
complete 25-day mission
ager Marc Lebrun, The Manta
will be featuring an innova-
tive hybrid propulsion system
consisting of wind power,
solar energy and Dyna-Rigg
sails. Two Darrieus wind gen-
erators produce 500Kw/h to
propel its electric engines and
refuel the batteries on board
that benefit from an opti-
mized energy storage system.
The most amazing part,
however, is the factory on
umentary series Human
Planet were staged by the
camera crew.
An episode of the televi-
sion documentary Human
Planet depicted the life of the
Khalida Popal (left) coaches girls from Team Mexico for the Street
Child World Cup, in Mexico City, on April 3. REUTERS
With up to 150 million chil-
dren living on the streets
worldwide, according to the
United Nations, the organiz-
ers hope the event can help
erase the stigma surrounding
street children and improve
their treatment.
“This is a global issue of
board to collect, sort, com-
pact and store plastic waste. A
unique collection system,
including two collectors in
the boat’s hulls, is designed to
provide an innovative and
efficient solution to bring
waste rapidly on board.
To improve the prevention
of waste reaching oceans, The
Manta will also be equipped
with a scientific laboratory to
allow for locating, assessing
and gathering of waste. The
data will be shared with the
international community as
open data.
The Manta is part of the
association “The SeaClean-
ers”, created in 2016 by Swiss
skipper and adventurer Yvan
Bourgnon who was “shocked
by the amount of plastic
waste polluting the seas”.
The Manta will be capable
Korowai people of Papua
New Guinea and shot scenes
of tribesmen moving into a
treehouse. The BBC admitted
that “the portrayal of the
tribe moving into the tree-
children not being in a safe
home,” said Joe Hewitt, head
of Americas for Street Child
United, on the pitch side-
lines.
The event is also a child
rights conference, said Street
Child United, which works
with Casa Alianza, a nonprof-
of collecting and processing
nearly 10 tons of plastic wast-
es per day, or a total of 250
tons in a complete mission
lasting about 25 days, said
Lebrun. The boat will be
equipped with 40 crew mem-
bers, including eight to oper-
ate the boat and the rest 32
working in the factory on
board.
Comparing with the boat’s
manufacturing cost of about
30 million euros (about $37
million), Lebrun revealed an
even ambitious plan of pro-
ducing some 100 such giant
boats in the future, as the
project has so far attracted
sponsorship from numerous
private companies, NGOs and
foundations, but also the
attention of governments.
XINHUA
house as a real home is not
accurate.”
Actually, during the making
of BBC’s upcoming documen-
tary series, a member of the
tribe talked about how they
have built high tree houses for
the benefit of overseas pro-
gram makers.
“Seems so natural! What is
there left to trust in the
world.” A netizen called Ali M
tweeted.
“I want a refund on my TV
license ... TV programs are not
as described and not fit for
purpose,” said netizen Sparkle
Sunshine.
It’s not the first time that
BBC’s documentary series
it in Mexico that provides a
home to more than 100 chil-
dren, many victims of vio-
lence, sexual abuse and
trafficking.
For Mariana Nicol, who is
still adjusting to her new life
at Casa Alianza, soccer has
always been a passion but
she never imagined she
might get a chance to train
and play for Mexico.
“I can’t believe it, I feel like
it’s a dream,” said the pony-
tailed 14-year-old, who is try-
ing to finish primary school.
“It’s exciting to be training
with many kids that I know,
and to then grab the ball and
run with it or hand it back.”
For the Mexican team from
Casa Alianza — some of
whom have suffered addic-
tion, abuse and homelessness
— flying to Russia will not
only expand their horizons
but help them see beyond the
neglect that has so far dictat-
Oldest man loves
to soak in hot
springs, eat sweets
TOKYO — Masazo Nonaka
has enjoyed soaking in
northern Japan’s hot springs
for many years — probably
longer than most people.
The supercentenarian,
whose family has run a hot
springs inn for four genera-
tions, was certified on Tues-
day as the world’s oldest
living man, at age 112 years,
259 days.
Nonaka received the certif-
icate from Guinness World
Records in a ceremony at his
home in Ashoro, on Japan’s
northern main island of
Hokkaido, and celebrated
with a big cake decorated
with berries.
According to the town gov-
ernment, Nonaka was born
on July 25, 1905. He grew up
in a large family and suc-
ceeded his parents running
the inn. After working in
agriculture and forestry, he
managed a Japanese-style
hot spring inn called “Non-
aka Onsen”, which his par-
ents had started at the foot of
Mountain Meakan. He and
his wife had two sons and
three daughters. The 105-
year-old inn is now run by
his granddaughter Yuko. He
regularly soaks in the springs
and also enjoys eating
sweets, especially cakes.
Nonaka, wearing a knit
cap and a kimono-style jack-
et, flashed a smile and posed
for a group photo with his
Japanese Masazo Nonaka, who was born 112 years and 259
days ago, receives a Guinness World Records certificate in
Ashoro, Japan, on Tuesday. KYODO VIA REUTERS
are embroiled in a fakery
scandal.
In 2011, BBC filmed shots of
a tarantula spider in a studio
for an episode about wildlife
in the Venezuela jungle.
In the same year, Frozen
Planet featured newborn
polar bear cubs in a den with
their mother, with many peo-
ple assuming they were born
and filmed in the Arctic.
However, the cubs were
actually in a Dutch animal
park, as revealed in behind-
the-scenes footage on the
show’s website.
In 2015, the production
crew of a documentary about
life of Mongolian camel herd-
Friday, April 13, 2018 CHINA DAILY HONG KONG EDITION
ed their lives, said its head.
“Above all, I think the most
important is to know that they
can achieve whatever goals
they set,” said Sofia Almazan
Argumedo, Casa Alianza’s
Mexico director.
Popal recounted how
Afghanistan’s first women’s
national team worked to
encourage more women and
girls to play soccer, despite
attacks and pressure from
people opposed to them play-
ing a “man’s game”.
“Football is my experience,”
said Popal, who also helped
train the England Street Child
World Cup team.
“It’s all about team building,
staying together, having net-
works, having friendship, hap-
piness and feeling freedom. It
empowers every woman
around the world who plays
this game.”
REUTERS
family, making a victory sign
with his right hand.
He dug into the cake with
a spoon after it was cut, and
said, “Delicious,” according
to NHK public television.
He received the certificate
of the record at his home on
Tuesday. “Thank you,” he
said with a smile.
His family members say
Nonaka still moves about by
himself in a wheelchair.
Nonaka wakes up at 7 am
each day, reading a newspa-
per after breakfast every
morning, and loves to watch
sumo wrestling and samu-
rai dramas on TV. But his
favorite pastime is soaking
in the hot springs and relax-
ing.
Nonaka has outlived all
seven of his siblings, as well
as his wife and two of their
five children.
He is one of about 67,800
centenarians in Japan, the
fastest-aging country in the
world, with the highest
average life expectancy
80.98 for men and 87.14 for
women, according to the
Ministry of Health, Labor
and Welfare.
Guinness says Nonaka
replaced Francisco Olivera of
Spain, who died earlier this
year at age 113, as the world’s
oldest man.
AP—THE JAPAN NEWS/
ANN
ers used a semi-domesticated
wolf after being unable to find
a real wild wolf to film on
location.
Viewers expressed their
disappointment over these
scandals. “What a surprise,
the BBC lying again,” said
another netizen, Stevehixy,
on Twitter.
Human Planet was origi-
nally screened in 2011. It
describes the human species
and its relationship with the
natural world by showing the
remarkable ways humans
have adapted to life in every
environment on Earth.
XINHUA
Nobel
board
slams
turmoil
STOCKHOLM — The Nobel
Foundation Board has sharply
criticized the Swedish Acade-
my, which chooses the Nobel
Literature Prize winner each
year, saying the group has dam-
aged its own reputation and is
threatening to tarnish the rep-
utation of the Nobel Prize itself.
The comments came hours
after the Swedish king said the
resignation of three members
from the Swedish Academy
was “deeply unfortunate and
risked seriously damaging” the
body’s “important activities”.
After a Nobel board meeting
on Wednesday, the foundation
issued a statement noting that
“trust in the Swedish Academy
has been seriously damaged”
and demanding that the group
take specific actions to restore
that trust.
The Nobel board said that
included making sure the
Swedish Academy can carry
out the 2018 Nobel selection
“in a credible manner”, resolv-
ing the group’s conflicts of
interest and confidentiality
issues according to Nobel reg-
ulations and referring any
“suspected criminal acts” to
law enforcement officials.
It is crucial that
all involved now
realize their
responsibility for
the institution.”
Carl XVI Gustav, Swedish king
The prestigious academy has
been in turmoil after the resig-
nations on Friday of members
Klas Ostergren, Kjell Espmark
and Peter Englund, who quit
after the secretive 18-member
academy voted against remov-
ing a female colleague whose
husband is embroiled in sexual
misconduct allegations.
Academy members are
appointed for life and resigna-
tions are extremely rare. In
gender-neutral Sweden, it was
also a surprise that three male
cultural figures would demand
that a woman be ousted from a
Nobel-awarding committee for
her husband’s alleged actions.
The men were calling for the
removal of academy member
Katarina Frostenson, whose
husband, Jean-Claude Arnault,
has been accused of sexual mis-
conduct and leaking Nobel
winners’ names.
Arnault was banned in
December by the Swedish
Academy from attending a
Nobel banquet after the Swed-
ish daily Dagens Nyheter pub-
lished allegations from 18
women claiming to have been
assaulted or raped by Arnault.
Arnault, the head of a Stock-
holm culture center, denies
the alleged assaults, which
reportedly occurred between
1996 and 2017.
In March, prosecutors said
an investigation into reported
rape and sexual abuse by
Arnault during 2013 to 2015
had been dropped, but a probe
into other criminal acts would
continue. It did not elaborate.
Separately on Tuesday, one
of Sweden’s biggest dailies,
Dagens Nyheter, cited an
internal Academy probe alleg-
ing that Arnault leaked the
names of winners the Nobel
Literature Prize seven times,
starting in 1996. The Dagens
Nyheter said the names
include US singer-songwriter
Bob Dylan and Belarus jour-
nalist Svetlana Alexievich.
In his second statement this
week, Swedish King Carl XVI
Gustav said “it is crucial that
all involved now realize their
responsibility for the institu-
tion and contribute to resolv-
ing conflicts”.
ASSOCIATED PRESS
C H I N A DA I LY H O N G KO N G E D I T I O N Friday, April 13, 2018 15
16
SPORTS
Friday, April 13, 2018
CHINA DAILY HONG KONG EDITION
Soccer
Buffon blows fuse in Real ref rage
Juve veteran sent off in fury over
penalty that could end CL career
MADRID — Gianluigi Buf-
fon’s Champions League
career looks likely to end in a
red mist of rage after Cristiano
Ronaldo’s late penalty on
Wednesday rescued Real
Madrid from a pulsating
Juventus comeback.
Buffon’s anger earned him a
red card from English referee
Michael Oliver, moments
before Ronaldo slammed a
97th-minute penalty into the
top corner to send Madrid into
the semifinals.
Oliver’s decision was not as
poor as Buffon claimed. Mehdi
Benatia’s challenge on Lucas
Vazquez, from behind, was a
clumsy attempt to stop the
Spaniard finishing from five
yards.
But Juve had made the
impossible possible, having
wiped out a 3-0 deficit from
the first leg, to lead by the
same scoreline at Santiago
Bernabeu.
Buffon, who has racked up
125 Champions League
appearances but never won
the competition, could not
contain his frustration as
Ronaldo’s goal made the
aggregate score 4-3.
“This referee has no heart,
he has a garbage bag instead of
a heart,” Buffon told Italian
channel Mediaset Premium
after the match.
“If you do not have person-
ality and courage, you should
go to the stands to watch the
match with your wife and a
Sprite.”
Buffon’s red card could
bring a bad-tempered end to a
magnificent Champions
League career, with the
40-year-old Italian expected to
retire in the summer.
“The referee blew for a foul
that only he saw,” Buffon told
beIN Sports. “Above all, for
great matches at European lev-
el, we need big players, coach-
Juve president
calls for VAR
Juventus president Andrea
Agnelli called for the video
assistant referee (VAR) to be
used in the Champions
League after his side was
knocked out by Real Madrid in
a thrilling quarterfinal second
leg that was decided by a
debatable injury-time penalty.
“A goal-line official behind
the line isn’t the same thing
as an official in front of a vid-
eo replay,” Agnelli said.
“If UEFA is not ready, then
they need to train people
quickly, just as Serie A did,
plus in Germany, Portugal
and elsewhere.
“This isn’t about one or
two incidents, but about
going forward in a massive
tournament that brings so
much money and prestige.
We can’t allow these inci-
dents to occur.”
Video technology has
been trialed this season in
Serie A, the Bundesliga and
some English cup games,
and is set to be used at the
World Cup finals.
The lack of technology in
the Champions League also
came under the spotlight in
Manchester City’s 2-1 loss to
Liverpool when City’s Leroy
Sane had a goal wrongly dis-
allowed for offside.
“Players make mistakes,
so do referees, but this offi-
cial completely lost control of
the situation,” added Agnelli.
REUTERS
es, supporters and referees.
“There must be some sensi-
tivity to understanding the
importance of some moments
and if you do not have this sen-
sitivity to what’s going on in
the game, you’re not worthy of
being on the pitch.
“In this case, he should be in
the stands with his parents,
with his friends, with fries and
Coca-Cola, and watch the
game. You cannot do some-
thing like that.”
Benatia controversially lik-
ened the penalty decision to
being “raped”.
“Honestly I’ve seen and
played in matches — you can
never whistle for a penalty like
that in the 93rd minute,” Ben-
atia said.
“If there is contact it is with
my thigh and that is part of
football. There is never the
intention to foul him or to
push him.”
Benatia added: “Last year
they screwed Bayern Munich
on two or three goals that were
offside if I’m not mistaken.
“It’s always the same story
that repeats itself. It’s a very
big team Real, it’s not for noth-
ing that they have won so
much, I don’t think they need
any extra help.
“Everyone knows that this
match had to go into extra
time and the best team would
have won.”
Amid the swarm of Juventus
players surrounding Oliver,
Ronaldo kept his cool. This was
a record-stretching 11th con-
secutive Champions League
game in which he has scored.
“I do not understand why
they protest against the penal-
ty,” Ronaldo told beIN Sports.
“If he did not commit the
foul, Lucas would have scored.
During the game, Benatia and
the rest of them had already
been kicking us from behind.
But we are happy and we are
Heynckes pleased to squeeze into semis
MUNICH, Germany —
Jupp Heynckes expressed his
delight at Bayern Munich’s
ability to keep its composure
despite a frustrating 0-0 draw
against 10-man Sevilla as it
qualified for the Champions
League semifinals.
Bayern progressed to the
last four on Wednesday for
the seventh time in nine sea-
sons, prevailing 2-1 on aggre-
gate following its first-leg
victory in Spain last week.
Franck Ribery had Bay-
ern’s best chance in the
Munich home leg, but he
fired at Sevilla goalkeeper
David Soria in the first half at
Allianz Arena.
Sevilla’s Joaquin Correa hit
the Bayern crossbar with a
header on the hour mark
before being sent off just
before the final whistle for a
foul on Javi Martinez.
Spain international Marti-
nez finished with a bruised
knee, while James Rodriguez
picked up a thigh injury in the
hard-fought encounter.
Heynckes was pleased his
side ground out the result
despite its inability to breach
a determined Sevilla defense.
“You can’t always play bril-
liantly and put the opponent
to the wall, sometimes you
have to just keep them score-
less,” Heynckes said.
“They hit the bar, which
didn’t let us rest, but we didn’t
get nervous.”
Heynckes praised the disci-
pline exhibited by his players.
Cristiano Ronaldo fires a 97th-minute penalty past Juventus substitute goalkeeper Wojciech Szczesny on Wednesday to secure Real
Madrid’s place in the Champions League semifinals. Juve won 3-1 on the night but Real advanced 4-3 on aggregate. PAUL HANNA / REUTERS
in the semifinals.”
Real coach Zinedine Zidane
was more sympathetic
towards Buffon.
“He did not deserve that,”
Zidane said. “But we cannot
change it. It will not take away
everything he has done, even if
it’s a shame to end his Champi-
ons League career this way.”
Croatian international Mar-
io Mandzukic set Juve on its
way with a goal after just 76
seconds — the fastest Real has
ever conceded in this competi-
tion — and then scored again
before halftime with another
header at the back post.
When Keylor Navas fum-
bled Douglas Costa’s cross on
the hour, allowing Blaise Mat-
uidi to stab home, Juve was on
the cusp of ensuring there
would be no Spanish repre-
sentative in the last four, fol-
lowing Barcelona’s
elimination on Tuesday.
But Oliver blew for the pen-
alty, Buffon exploded and
You can’t always
play brilliantly and
put the opponent
to the wall, some-
times you have to
just keep them
scoreless.”
Jupp Heynckes, Bayern coach
Top scorer Robert Lewan-
dowski, in addition to Ribery,
Jerome Boateng and Joshua
Kimmich, were each a yellow
card away from suspension,
but the quartet emerged
unblemished.
“We kept our discipline and
we didn’t pick up any yellow
cards, even though four play-
ers were in danger of being
suspended, which was impor-
tant,” said Heynckes.
Thomas Mueller admitted
it was a frustrating night for
Bayern and its fans as it strug-
gled to cope with Sevilla play-
maker Ever Banega.
“In the first 20, 25 minutes,
we managed to constrict Sev-
illa, but too often we didn’t get
pressure on Banega,” Mueller
said.
“Annoyingly, we did not
score, although we had chan-
ces. We played well, even if it
Ronaldo hit the net.
“It leaves a bitter taste,”
Juventus coach Massimiliano
Allegri said.
“Because we have not had
the chance to take the game to
extra time. In view of the two
legs both teams would have
deserved to move on to the
next phase.”
Real, meanwhile, edges one
step closer to claiming an
unprecedented third consecu-
tive Champions League tri-
umph, a fourth in five years.
It joins Bayern Munich, Liv-
erpool and Roma in Friday’s
semifinal draw.
“What I did not expect is in
minute one to score a goal,”
Zidane said. “By conceding the
goal after a minute, you drop
your head and give them life.
Then they played a good game
— they were good and we were
bad.”
Gareth Bale perhaps paid
the heaviest price. Bale had
been handed his first Champi-
Bayern Munich’s Franck Ribery fires straight at Sevilla goalkeep-
er David Soria in Wednesday’s 0-0 draw. MICHAELA REHLE / REUTERS
wasn’t a good game for the
general public.”
Treble dream
After Barcelona and Man-
chester City — the runaway
league leaders in Spain and
England respectively —
crashed out on Tuesday, Bay-
ern is the only team in Europe
that can still win the treble.
It wrapped up a sixth
Gianluigi Buffon and his Juventus teammates argue with referee
Michael Oliver over the penalty decision. PAUL HANNA / REUTERS
ons League start since Sep-
tember by Zidane, but the
Welshman was hauled off at
halftime with his team trailing
2-0. Casemiro also made way
as Marco Asensio and Vazquez
came on.
“Something had to change,”
Zidane said. “I was not happy
straight Bundesliga title last
Saturday and is into the Ger-
man Cup semifinals, where it
faces a trip to Bayer Leverkus-
en next Tuesday.
Liverpool, defending cham-
pion Real Madrid and Roma,
which knocked out Barcelona,
are also in Friday’s draw, but
Heynckes has no preference.
“You saw yesterday in Man-
chester and Rome that we
with the approach, it was not to
punish Gareth or Casemiro.
“We have changed a little
more the dynamics, with
Lucas and Marco giving us a
little more energy. We had to
do it.”
AGENCE FRANCE-PRESSE
can’t underestimate any team
— all the three other teams are
at the top level,” he said.
“Of course, we are ambi-
tious and we want to reach
the final, but we have two
hard games ahead of us, who-
ever we get.
“You saw that Barcelona
clearly thought the job was
done before they played Roma,
so I have no preference.”
Sevilla’s bid for a first semi-
final appearance fell short in
spite of shutting out Bayern’s
attack and restricting the host
to 51 percent possession.
Sevilla boss Vincenzo Mon-
tella said it needs the same
passion in its fight to get back
among the European places
in the Spanish league, where
it is currently seventh.
“I am proud of my team,
they showed personality with
heart and they never gave up
against a team which can win
the Champions League,” said
Montella.
“We put in a good perform-
ance, we had our chances,
they certainly weren’t clear
chances, but Correa hit the
woodwork.
“Sevilla can leave Munich
with heads held high.
“We have to have the same
attitude, passion and deter-
mination now in the league
and cup,” he added, with Sev-
illa due to face Barcelona in
the Copa del Rey final on
April 21.
AGENCE FRANCE-PRESSE
What they say
“I don’t understand
why Juventus pro-
tested the penalty. If
the defender hadn’t
committed the foul,
Lucas would have
scored. He was push-
ed from behind.”
Cristiano Ronaldo,
Real Madrid star,
on the controversial penalty
“This was a game
where we have suf-
fered tremendously,
it has to be a lesson
to learn that in foot-
ball, nothing is ever
guaranteed and you
have to fight to the
end.”
Ronaldo, after his
97th-minute spot-kick
“There must be some
sensitivity to under-
standing the impor-
tance of some
moments and if you
do not have this sen-
sitivity to what’s
going on in the game,
you’re not worthy of
being on the pitch. In
this case, he should
be in the stands with
his parents, with his
friends, with fries
and Coca-Cola, and
watch the game. You
can not do some-
thing like that.”
Gianluigi Buffon,
Juventus goalkeeper,
on referee Michael Oliver
“This referee doesn’t
have a heart. He has
a rubbish bin
instead of a heart.”
Buffon
“It was crazy —we
forgot to score.”
Toni Kroos, Real Madrid’s
German midfielder
“#TOGETHER, we
have celebrated, suf-
fered, but most of all
felt great pride in
this team. Put your
hands together for
our Bianconeri.”
Juventus, on Twitter
“I said that a Bayern
victory in the final
would be sensation-
al, and I remain con-
vinced by that. But
we saw in Rome last
night that anything
is possible and we
cannot underesti-
mate any team in
the quarterfinals.”
Jupp Heynckes,
Bayern Munich coach
“Sevilla are a good
team — for a long
time we couldn’t get
a grip on the mid-
field, but we stopped
them from scoring.”
Arjen Robben, Bayern winger
 MOVING AHEAD
BUSINESS
MAIN PRIORITY
CHINA DAILY HONG KONG EDITION Friday, April 13, 2018
WB raises
forecast for
growth rate
Nation’s economy may gradually
bottom out this year, says analyst
By XIN ZHIMING
xinzhiming@chinadaily.com.cn
The World Bank raised Chi-
na’s GDP growth forecast for
this year to 6.5 percent on
Thursday, up from 6.4 percent
in its last forecast in January.
Analysts said the Chinese
economy may gradually bot-
tom out this year, with quality
of growth continuing to
improve.
The World Bank also said in
its updated growth forecast
report for the East Asia and
Pacific region that China has
achieved headway in its eco-
nomic restructuring.
“After growing faster than
anticipated in 2017, China is
expected to slow moderately
to 6.5 percent in 2018 as its
economy continues to rebal-
ance away from investment
and toward domestic con-
sumption with policies that
focus more on slowing credit
expansion and improving the
quality of growth,” the report
said.
Hu Yuexiao, chief economist
of Shanghai Securities, said
that the world’s second-largest
economy may start to bottom
out this year and the basic
trend will be “stable and
improving growth”.
“Although its GDP growth
rate has not picked up signifi-
cantly, the quality of growth
has improved,” he said. “As
investment stabilizes and cor-
porate profit levels rise, the
market will become more con-
fident in the country’s econo-
my.”
China’s GDP growth was
6.9 percent year-on-year last
year and it is scheduled to
release its first-quality
growth-related statistics
next Tuesday. Analysts have
widely anticipated growth
to be 6.8 percent in the first
three months.
The solid growth of the Chi-
nese economy will forcefully
A harbor employee oversees cargo unloading in Lianyungang Port,
Jiangsu province. GENG YUHE / FOR CHINA DAILY
Digital strides powering China’s economic progress
By OUYANG SHIJIA
ouyangshijia@
chinadaily.com.cn
The country’s digital econo-
my accounted for 32.28 per-
cent of its gross domestic
product in 2017 and remained
an important pivot for the
country’s economic growth, a
new report said on Thursday.
Released by Tencent
Research Institute, the annual
China Internet Plus Index
Regulator to push mixed-ownership reforms p18
Nutrition to be top focus for Wahaha p21
help push global economic
recovery and provide unprece-
dented development opportu-
nities for people of other
countries, the National
Bureau of Statistics said on
Thursday.
China’s mid and high-rate
growth in recent years has
made it an indispensable
engine and stabilizer of global
economic recovery and sus-
tainable development, the
bureau said in an article pub-
lished on its website.
From 2013 to 2016, the pro-
portion of China’s GDP in the
global total increased from
12.5 percent to 14.8 percent
and its average annual GDP
growth during that period was
7.2 percent, much faster than
that of the United States, euro-
zone economies and Japan,
the bureau said.
The NBS’ estimate shows
that from 2013 to 2016, the
average annual growth of the
world economy would have
slowed by 0.6 percentage
point if China’s contribution is
not taken into account. This
year, China’s contribution to
global economic growth may
reach 34 percent and it will
account for 15.3 percent of
total global GDP if the world
economy expands at about 3
percent as predicted by the
World Bank, the bureau said.
China’s large population
and stable economic growth
have provided great room for
development of enterprises
from all over the world, the
NBS said. “More and more
enterprises from the devel-
oped economies have entered
the China market and made
huge profits and strengthened
cooperation with the Chinese
side.”
In 2015, for example, US
exports of goods and services
to China created 910,000 jobs
in the US, the NBS said, citing
statistics of the US Depart-
ment of Commerce.
shows that the internet-based
digital economy amounted to
26.7 trillion yuan ($4.25 tril-
lion) in 2017, up 17.24 percent
year on year.
Driven by the coming-of-age
mobile payment technologies,
healthcare, education and
entertainment sectors have
benefited the most in 2017 from
the booming digital wave.
Meanwhile, business services
and life services saw a period of
sluggish growth due to their rel-
Participants attending the Belt & Road Trade and Investment Forum, held in Beijing on Thursday, prepare for a group photo.
More opening-up brings stronger B&R ties
By JING SHUIYU in Beijing
and REN XIAOJIN
in Guangzhou
The Ministry of Commerce
will accelerate the implemen-
tation of opening-up meas-
ures that President Xi Jinping
pledged at the Boao Forum
for Asia Annual Conference
2018 and seek enhanced coop-
eration with Belt and Road
economies and international
organizations, a top official
said on Thursday.
Vice-Minister of Commerce
Qian Keming made the
remarks at the Belt & Road
Trade and Investment Forum
in Beijing, echoing President
Xi’s promise on Tuesday
about advancing the building
of a community with a shared
future for humankind.
China will ramp up efforts
Guidelines to ensure safe self-driving vehicle tests
By FAN FEIFEI
fanfeifei@chinadaily.com.cn
China released a national
guideline on road tests for
self-driving vehicles on
Thursday, as part of a broader
drive to accelerate the devel-
opment of the technology and
gain the advantage in com-
mercializing such vehicles.
The guideline, which was
jointly issued by the Ministry
of Industry and Information
Technology, the Ministry of
Public Security and the Minis-
try of Transport, allows local
authorities to evaluate local
conditions and arrange road
tests for autonomous vehicles.
It states that the test vehi-
cles should be passenger or
commercial automobiles, not
low-speed vehicles or motor-
cycles.
According to the regula-
tion, which will take effect on
May 1, test vehicles should be
able to switch between self-
driving and conventional
driving in order to ensure the
test driver can quickly take
over in case of a malfunction.
Moreover, test applicants
must be independent legal
entities registered in China,
and have to first complete
atively high digital levels.
“The digital economy is play-
ing an increasingly important
part in driving China’s economic
growth and transformation.
Moreover, the application of dig-
ital technologies is no longer
limited to the economic sector,
but spread across a wide range
of fields, including public ser-
vice, cultural life and social gov-
ernance,” Si Xiao, president of
Tencent Research Institute, said
on Thursday at the 2018 China
to develop e-commerce in
countries and regions partici-
pating in the Belt and Road
Initiative, and help related
economies integrate into glo-
balization, Qian said.
China will also boost
regional economic coopera-
tion and promote free trade
areas, Qian said.
“We will set up high-stan-
dard FTAs with countries and
regions that have the willing-
ness to do so,” Qian added.
Between 2013 and 2017,
trade between China and Belt
and Road economies totaled
more than $5 trillion, and out-
bound direct investment
exceeded $70 billion, accord-
ing to the ministry.
To further promote the ini-
tiative, China and the Interna-
tional Monetary Fund
launched the China-IMF
Tencent, Changan Auto forming smart car joint venture
A unit of Chinese internet
giant Tencent Holdings Ltd has
teamed up with State-owned
Chongqing Changan Automo-
bile Co to develop business
related to smart and connected
vehicles.
The two firms on Thursday
signed a cooperation agreement
on a joint venture at the 2018
China Internet Plus & Digital
Economy Summit held in
tests in designated closed
zones before conducting road
tests.
Xin Guobin, vice-minister
of industry and information
technology, said: “Road
testing for self-driving vehi-
cles is a complicated project
and safety should be the top
priority.”
He added that car manufac-
turers should intensify their
efforts in the research and
development of self-driving
technology, to offer more
vehicles with safe and reliable
performance.
The government is study-
26.7
trillion yuan
value of the internet-based
digital economy in China in
2017
Internet Plus & Digital Economy
Summit in Chongqing.
Guangdong province, Jiangsu
province and Zhejiang province
We will set up
high-standard
FTAs with coun-
tries and regions
that have the will-
ingness to do so.”
Qian Keming, vice-minister of
commerce
Capacity Development Center
in Beijing on Thursday.
The center will offer train-
ing courses for Belt and Road
economies including China,
according to a statement from
Chongqing. Under the deal,
Changan will take 49 percent of
the joint venture with an invest-
ment of 98 million yuan ($15.6
million). Tencent Dadi Tongtu
Technology Co Ltd, a unit of Ten-
cent, will spend 102 million yuan
to own the remaining 51 percent.
The joint venture will build an
open platform to develop the
internet of vehicles, big data
and cloud technologies, aiming
ing how to improve road
infrastructure in order to bet-
ter adapt to the self-driving
vehicles, according to the
Ministry of Transport.
Beijing issued the nation’s
first guideline for road tests of
autonomous vehicles in
December and unveiled a
closed testing ground for
autonomous cars in February.
In addition, on March 1, the
authorities in Shanghai
issued the country’s first road
test licenses to two smart-car
makers, SAIC Motor Corp Ltd
and electric vehicle startup
Nio Auto.
top the list of regions that used
internet-based technologies to
facilitate almost everything
from paying taxes to making
appointments with doctors.
Henan was ranked eighth in the
list, up three spots from last year.
For instance, Guangdong
province offers 108 e-govern-
ment services, and 19 local bus
stations allow people to pur-
chase tickets via Tencent’s
messaging app WeChat.
For the first time the report
TRADE
IMBROGLIO
US pork
producers hope
for resolution
p20
FENG YONGBIN / CHINA DAILY
the People’s Bank of China.
“The Belt and Road Initia-
tive can serve as a powerful
platform for economic
growth and regional cooper-
ation, involving more than 4
billion people living in Asia,
Europe and Africa,” said
United Nations Resident
Coordinator Nicholas Rosel-
lini.
“Inclusiveness and win-win
outcomes, at the core of the
initiative, have to be proact-
ively integrated in the BRI
outcomes,” he said at the 2018
High-Level Policy Forum on
Global Governance in
Guangzhou.
“The initiative will aim not
only to contribute to the
achievement of the goals of
participating economies in
the areas of basic infrastruc-
ture, regional development,
to offer comprehensive solu-
tions for smart and connected
cars and operating services.
Last year, Baidu Inc
announced its Apollo project,
which opened up its autono-
mous driving platform to its
partners. The company claimed
it had gained more than 90
partners for the platform so far.
OUYANG SHIJIA
“The national guideline on
self-driving vehicles will regu-
late the whole industry, provid-
ing a reference and guidance
for local authorities that have
yet to issue such guidelines,”
said Tao Ji, technical director of
Baidu Inc’s automatic driving
department.
Tao added that safety is the
priority in the R&D, design,
manufacturing and road tests
of self-driving vehicles. Baidu
has already obtained road test
licenses for its self-driving
vehicles in Beijing and Ping-
tan, Fujian province.
Li Keqiang, a professor of
introduced the concept of digi-
tal Gini coefficient to present
the digital distribution of the
nation. The report noted the
digital Gini coefficient shrunk
to 0.59 in 2017 from 0.6 in
2016, saying the nation will be
ushered into a more balanced
digital economic future.
Another report released by
China Internet Network Infor-
mation Center earlier this year
backed the new findings, say-
ing the Chinese internet users
are becoming increasingly
digitally savvy. Of the nation’s
531 million online shoppers,
527 million are using mobile
connectivity and industriali-
zation, but also extend and
upgrade the initiative to
explicitly aim for a sustaina-
ble transformation of the
economies along the initiative
with poverty reduction, envi-
ronmental sustainability and
inclusive social development
at its core, key elements for
the success of the initiative in
the long-term.”
He also noted that there are
common barriers to achieving
the aims of the BRI, such as a
lack of understanding of the
investing countries’ priorities,
policies and regulations, com-
munication barriers due to
the cultural differences, and
barriers due to environmental
and social concerns.
Contact the writers at jing-
shuiyu@chinadaily.com.cn
We still need more
time before we can
see highly or total-
ly autonomous
vehicles.”
Li Keqiang, a professor
at Tsinghua University
the department of automo-
tive engineering at Tsinghua
University, said: “Safety
comes first for self-driving
cars.” Pointing to the recent
fatal accident involving a
pedestrian and an Uber Tech-
nologies Inc self-driving car
in the United States, he called
for car manufacturers to
establish safety management
systems.
“We still need more time
before we can see highly or
totally autonomous vehicles.
This depends on advances in
technology, social recognition
and the construction of road
and telecommunication
infrastructure,” Li said.
payments, up by 12.3 percent
compared to the end of 2016.
In recent years, the govern-
ment has accelerated its speed
to boost the growth of the digital
economy, introducing the Inter-
net Plus policy to deepen the
integration of the internet with
economic and social sectors.
Tencent is among one of the
leading technology companies
that have driven the digital
economy forward. During the
Lunar New Year in February,
Tencent saw its WeChat active
monthly users hit the mile-
stone of one billion, the com-
pany said.
18 BUSINESS
Regulator to push forward mixed-ownership reforms
By ZHENG XIN and
ZHANG YUE
The National Develop-
ment and Reform Commis-
sion, the country’s top
economic regulator, will
push forward mixed-owner-
ship reforms by encouraging
foreign and private capital to
pour into State-owned enter-
prises to advance the reform
and restructuring of the
SOEs.
Foreign and private capital
will be encouraged to join the
What’s news
GOVT AND POLICIES
ADB predicts HK
growth to hit 3.2%
Hong Kong’s economy will
grow 3.2 percent this year, the
Asian Development Bank
forecast on Wednesday.
Though the forecast is slightly
lower than the actual growth
of 3.8 percent in 2017, it is still
higher than the actual growth
of 2.1 percent in 2016, ADB
Chief Economist Yasuyuki
Sawada said. The economic
growth rate of Hong Kong
will be 3 percent in 2019,
according to the report. Hong
Kong’s growth accelerated in
2017, propelled by a strong
external environment and
solid domestic demand, and a
tight labor market and recov-
ering inbound tourism should
sustain robust growth this
year and next, though some
moderation is expected, the
chief economist said.
COMPANIES AND MARKETS
Mexican airline
seeks alliances
Interjet, Mexico’s third-larg-
est airline, announced on
Wednesday it is seeking an
alliance with China’s Hainan
Airlines in the second half of
2018 to attract more tourists
from Asia. Interjet Executive
Director Julio Gamero said
the two airlines are negotiat-
ing details of the alliance,
saying the cooperation fol-
lows the general trend of
globalization in the indus-
try. “Mexico’s economic
development will not slow
Hollywood exploring movie market with nation’s chart-topping metrics
LOS ANGELES — On the
heels of China’s box office coup
in the first quarter of 2018,
beating out US grosses and
catapulting it to the top of the
global box office for the first
time, Hollywood is exploring
how to adapt to the changing
landscape of a “world’s largest
market” that is not its own.
A recent report by the
Motion Picture Association of
America revealed that even in
the face of mounting trade
tensions between the United
States and China, whose
impact on the entertainment
industry is still unclear, the
importance of Chinese movie-
goers to Hollywood’s future is
significant.
“The Chinese film market is
going to be the largest film
market in short order,” said
MPAA Chairman, Charles Riv-
kin, a former US assistant sec-
retary of state.
With some blockbuster Hol-
lywood movies grossing more
in China than in the United
States and China grosses play-
ing a bigger role in the success
of American releases, “How to
get a piece of the burgeoning
Chinese market” is the ques-
tion of the day in Tinseltown.
State firms through buying
stakes and convertible bonds
from or conducting share
rights swaps with SOEs, it
said in a statement on Thurs-
day.
The commission will also
continuously improve the
withdrawal mechanism for all
types of capital to encourage
the inflow of capital to foster
more world-class, globally
competitive companies, it
said.
The NDRC said it would fur-
ther improve the corporate
High-speed noodles
A bowl of noodles is being transported to a customer by a “mini” truck, which moves on a maglev track, in a noodle restaurant in
Nanjing, Jiangsu province, on Wednesday. The design is intended to prevent customers from being scalded when picking the hot
noodles bowl by themselves. WU BIN / FOR CHINA DAILY
down, and we are going to
further connect with the
outside world through busi-
ness and tourism,” Interjet
Director General Jose Luis
Garza said.
Building firms to
develop art center
Leading Chinese and US con-
struction companies on Tues-
day jointly launched a
project to develop the Arts
District Center in downtown
Los Angeles. In partnership
with China Building Tech-
niques Group Co Ltd and US
architectural firm AC Martin,
with its history of over 110
years, Arts District Develop-
ment LLC is planning a per-
manent new home. Located
in the heart of the rapidly
evolving arts district in
downtown Los Angeles, the
Xian Li, a Hollywood studio
executive, believes US-China
coproduction is a way for inde-
pendent productions to gain
access to China’s huge market,
but like other American
exporters, Hollywood should
adapt to the changing market.
“Hollywood studios are not
really deep in the coproduc-
tion game. They can’t adapt
fast enough to a rapidly chang-
ing market,” Li told Xinhua on
Friday. “So it’s a tremendous
opportunity for smaller pro-
duction companies to take
advantage of the vacuum,
develop those key relation-
ships in China and grow with
the industry there.”
“China audiences are
changing. They are more
sophisticated now, and more
open to a diversity of movies,
not just Hollywood blockbust-
ers, but Indian, European,
Thai and Japanese. That
increases the pressure on
American filmmakers,” she
said.
“They aren’t just looking for
blockbusters anymore, there’s
room for dramas, films that
make you cry, films that satisfy
the audience emotionally,” she
added.
governance of enterprises by
ensuring that the injection of
private and foreign capital
would efficiently improve the
management of State assets
and promote new manage-
ment and business models for
SOEs.
Eastern Air Logistics, one of
the first batch of SOEs mixed-
ownership pilot projects, is a
positive test case of Beijing’s
ambitious plans to reform
State-owned enterprises by
bringing in foreign and pri-
vate investors.
unique 12-story mixed-use
development project will
contain 129 artist condomin-
iums, a 13-room art hotel and
4,646 square meters of com-
mercial space for retail and
restaurants.
Yutong provides
e-buses in France
The German intercity bus
service company Flixbus
said on Tuesday it had intro-
duced its first long-distance
electric bus line in France,
provided by the Chinese
manufacturer Yutong. Link-
ing Paris and Amiens, which
are situated around 150 km
apart, the electric coaches
are able to go around 200
km without having to stop
for charging. After about
two hours of driving, the
electric coaches will need
China audiences are changing.
They are more sophisticated now,
and more open to a diversity of movies,
not just Hollywood blockbusters ...”
Xian Li, a Hollywood studio executive
As one of those smaller com-
panies jockeying for position
in China’s booming market,
Leomark Studios, an Los
Angeles-based production and
distribution studio, is excited
by the opportunities it sees
before it.
“We were just at the Hong
Kong Film Festival and it was
electric,” Erik Lundmark, CEO
of Leomark, told Xinhua on
Saturday. “We’ll definitely
attend Beijing and Shanghai
film festivals next.”
Both Lunkmark and his
writer/producer wife are
immigrants to the United
States who have worked for
years to build their boutique
studio from scratch — but
found it rough going.
“It’s difficult for newer com-
panies to really break into Hol-
lywood, but the China market
With the aim of building a
world-class logistics compa-
ny, Eastern Air Logistics saw
its total revenue reach 7.751
billion yuan ($1.23 billion)
last year, a 31.7 percent
increase compared with the
same period of 2016, after
the reform. The return on
net assets was 53.25 per-
cent, far exceeding the aver-
age 15 percent of world-
class aviation logistics
enterprises.
Peng Huagang, deputy sec-
retary-general of the commis-
four hours to fully recharge
their batteries.
Boeing invests in
hypersonic tech
US aerospace giant Boeing
said on Wednesday that it
has joined a $37.3-million
fundraising for a British aer-
ospace startup focusing on
hypersonic flight technolo-
gy. Boeing said in a state-
ment that its venture capital
arm HorizonX is going in
with British propulsion sys-
tem manufacturer Rolls-
Royce and defense company
BAE Systems on an invest-
ment round for Reaction
Engines, a leader in hybrid
rocket-jet propulsion tech-
nology that could send air-
craft zipping into space and
back at multiple times the
speed of sound.
is buzzing, and we feel there’s a
real future for us there,” Lund-
mark said.
But Li cautioned that it’s not
going to be easy, “finding that
magical coproduction that
works in both markets can be
something of a unicorn.”
A less difficult winning
strategy many are adopting is
to cast more Chinese stars in
Western movies, like Donnie
Yen and Jiang Wen in Disney’s
Rogue One: A Star Wars Story
or Chris Wu in Europa’s Valeri-
an and the City of One Thou-
sand Planets.
Legendary Entertainment,
now owned by China’s Dalian
Wanda Group, has adopted
this hybrid approach for their
popular Pacific Rim franchise,
introducing more Chinese
actors to the cast, including
star Jing Tian. This prompted
sion, said during a seminar at
the Counsellors’ Office of the
State Council that the pilot
reform on employee owner-
ship reform, conducted on the
10 mixed-ownership enter-
prises, has been successful
with tangible results.
He said that by the end of
2017, the 10 enterprises have
successfully attracted both
private and overseas capital
adding up to 1.83 billion
yuan. At the same time,
employee ownership reform
is now being carried out in
AROUND THE WORLD
BOK forecasts
GDP uptick in 2018
South Korea’s central bank
forecast on Thursday that the
country’s gross domestic prod-
uct would grow 3 percent in
2018 amid the mixed signs fac-
ing the export-driven economy.
Bank of Korea Governor Lee
Ju-yeol told a news conference
after the rate-setting meeting
that the BOK’s growth outlook
for this year was unchanged
from the one estimated three
months earlier. In 2017, the
one ebullient, online fan to
rave, “The fighting is great.
Jing saved the world in the
end. All hail China!”
But, there may be an easier
way to break into the China
market.
“Scripts,” Li summed up.
“Hollywood invented the film
business and China has come
an impressively long way in
improving their production
skills in a short time, but their
scripts aren’t quite there yet.
China needs Hollywood writ-
ers.”
Gavin Scott, writer of the
Emmy-Award winning Mists
of Avalon and veteran Holly-
wood screenwriter who has
penned scripts for the likes of
Steven Spielberg and George
Lucas, is keen on stepping into
the breach.
He has traveled recently to
China where he negotiated
with two Chinese production
companies to write Chinese
feature films for the Chinese
and international market. No
stranger to mentoring other
writers, Scott finds the
prospect of collaborating with
the Chinese an exciting one.
“I think it’s a great opportu-
nity for writers from two great
Friday, April 13, 2018 CHINA DAILY HONG KONG EDITION
126 enterprises in 21 regions
across the country, Peng
said.
China so far has had three
rounds of pilot SOEs mixed-
ownership reform, including
one focusing on China Uni-
com — mainly through share
issuance, to bring in private
investment.
Aiming to invigorate the
companies and ending the
situation of overcapacity,
poor corpo+rate governance
and low labor productivity,
which have dragged down
country’s GDP rose 3.1 percent.
It was identical to the growth
forecasts offered by the Inter-
national Monetary Fund and
the Organization for Economic
Cooperation and Develop-
ment.
Banque de France
lowers estimate
France was set to report 0.3
percent growth over the first
quarter of the year, the coun-
try’s central bank, Banque de
France, said on Wednesday,
revising down a previous esti-
mate by one percentage point.
In its monthly economic sur-
vey based on business leaders
sentiment, BdF noted indus-
trial production decelerated at
the end of March as the slower
trend of aerospace, computer
hardware and other equip-
ment offset the dynamism of
electrical equipment and
pharmaceuticals. The capacity
utilization was slightly down
to 80.4 percent over the peri-
od against 80.5 percent in
February, BdF data showed.
Caribbean, LatAm
stability expected
The Economic Commission for
Latin America and the Carib-
bean said on Wednesday that it
was maintaining its GDP
growth expectations for the
region at 2.2 percent in 2018,
the same figure as last Decem-
ber. According to the UN agen-
cy, 2018 will see Latin America
and the Caribbean enjoy a
greater economic stimulus
than in 2017, when growth
reached just 1.2 percent. For
ECLAC, internal demand will
play an important role in this
acceleration. The body said
that while this internal
demand will remain low over-
all, greater investment than in
past years will boost private
consumption, making it a rele-
vant engine of growth.
Gulf of Mexico oil
output increases
US crude oil production in
the Gulf of Mexico reached its
highest annual level in 2017
cultures to come together and
collaborate to create the enter-
tainment of the future,” he told
Xinhua in an interview.
When asked about the chal-
lenges of creating “writer-for-
hire” commercial cross-
cultural fare, he was
undaunted: “Both China and
Hollywood have great cultural
riches to draw on and if writ-
ers can find a way to combine
them, the whole world will
benefit.”
For Chinese filmmakers
intent on learning Holly-
wood’s winning script formu-
las who prefer a more high-
tech approach, they could
also get a jump on the compe-
tition with a little help from
cutting-edge artificial intelli-
gence.
“We’ve cracked the code on
human interaction and story-
telling,” said Stephen Green-
field, one of a team of AI
software programmers and
psychologists who have man-
aged to create an astonishing-
ly robust and nuanced AI
program that can provide
detailed suggestions for realis-
tic storylines and plot points.
“As fellow artists, our goal is
to help writers improve and
profits at SOEs in recent
years, the reform covers sev-
en major sectors including
power, petroleum, natural
gas, railway, aviation, tele-
communication and military
industry.
The results of the reform
have been broadly positive,
said Xiao Yaqing, head of the
State-owned Assets Supervi-
sion and Administration Com-
mission.
Contact the writers at zheng-
xin@chinadaily.com.cn
and is expected to continue
increasing in 2018 and 2019,
according to the projection of
the US Energy Information
Administration published on
Tuesday. US crude oil produc-
tion in the gulf reached 1.65
million barrels per day, the
highest annual level on
record. Although briefly hin-
dered by platform outages
and pipeline issues in Decem-
ber 2017, oil production in the
gulf is expected to continue
increasing in 2018 and 2019,
based on forecasts in the
EIA’s latest Short-Term Ener-
gy Outlook.
Philippines imports
more from China
China was the Philippines’
largest source of imports in
February, comprising 19.9 per-
cent share of the total imports
for the month, the Philippine
Statistics Authority said on
Wednesday. In a report, the
PSA said import bills from the
top 10 countries for imports for
February amounted to $6.08
billion or 78.7 percent share of
the total. “China was the coun-
try’s biggest source of imports
with 19.9 percent share in Feb-
ruary 2018. Import payments
to this country stood at $1.54
billion, posting an increment
of 57.7 percent from $977.17
million in February 2017,” the
PSA said.
Sri Lanka calls for
oil exploration bids
Sri Lanka will call for fresh
bids in May for an oil explo-
ration block off the island’s
northwestern coast, where
traces of natural gas were
discovered in 2011, Cabinet
spokesman Rajitha Senarat-
ne said on Wednesday. Senar-
atne said that following a
proposal by Minister of
Petroleum Resources Arjuna
Ranatunga, the cabinet also
agreed to enter into agree-
ments with global oil compa-
nies for land and offshore
exploration work along the
Eastern coastal belt.
CHINA DAILY — AGENCIES
evolve their stories.”
Their breakthrough pro-
gram, The Storytelling Cipher,
apparently works so well that
the US law enforcement agen-
cies have been using it to mod-
el and predict behavior of
terrorist groups around the
world.
But Hollywood’s future in
the China market is likely to
hold challenges as well.
The LA Times reported that
Jeff Towson, professor of
investment at Peking Univer-
sity’s Guanghua School of
Management, said Holly-
wood’s success in China is
going to increasingly come
under assault by rising Chi-
nese competitors.
“Foreign companies (like
Hollywood studios) do well at
the top of the market, typical-
ly because they start out hav-
ing superior quality,
technology or brand recogni-
tion,” he said.
“But over time, the Chinese
competitors grow and steadily
improve their quality. They
reinvest, make acquisitions
and begin to attack the top of
the market,” he predicted.
XINHUA
 CH INA DAILY HONG KONG EDIT ION Friday, April 13, 2018
Q&A WITH CEO
Editor’s Note: This year marks the 40th anniversary of China’s reform and opening-up. China Daily interviewed top executives of well-known multinational companies for their views on the country’s socioeconomic development.
Catering to consumers’ evolving preferences
Yum China says
its future lies in
better, faster
restaurant and
delivery services
By HE WEI in Shanghai
hewei@chinadaily.com.cn
Please use three words to
describe China’s changes in
the past 40 years.
Visionary:
The success of China’s eco-
nomic reforms and opening-
up policy would not have been
possible without a drive and
ambition to succeed. Yum Chi-
na’s evolution from a single
KFC store in Qianmen, Bei-
jing, 30 years ago, to over 7,900
stores across the country
today epitomizes China’s story
of sustained and successful
economic growth since the
implementation of the flag-
ship reform and opening-up
policy over 40 years ago.
Opportunity:
The opening-up has fueled
foreign investment and
encouraged international
companies to enter the mar-
ket, bringing new opportuni-
ties and experiences to people
across the country. We are
proud we have been able to
contribute to and play a part in
leading industry standards
and practices.
Innovative:
China has always actively
invested in technological
advancement and innovation
to bolster macroeconomic
growth and improve people’s
lives. Since opening up 40
years ago, China has trans-
formed into a country that is
at the forefront of various
technological advances, such
as cashless mobile payments.
What are the biggest achieve-
ments in China since the
introduction of the reform
and opening-up policy 40
years ago?
No other country in the
world apart from China has
lifted so many people out of
poverty in just 40 years, which
is a truly remarkable feat con-
sidering the size of China’s
population. Chinese people
are ambitious and have an
incredible drive to persevere
and succeed. This strong atti-
tude has played a big part in
the success of China and will
continue to do so. For Yum
China, we have experienced
great growth and success over
the last 30 years led by strong
leaders but even stronger
employees who serve our cus-
tomers every day.
What’s the biggest challenge
China faces today and how
can the country overcome it?
While China has seen
income levels rise and the rap-
id urbanization of regions
across the country, the envi-
ronment and poverty in rural
Daimler chairman: Competition benefits companies, customers
By GONG ZHENGZHENG
gongzhengzheng@
chinadaily.com.cn
Dieter Zetsche is chair-
man of the Board of Manage-
ment of Daimler AG and head
of Mercedes-Benz Cars.
Apart from economic devel-
opment, what progress in
other fields have you wit-
nessed in China in the past
40 years?
China’s successful economic
development has paved the
way for the country’s remarka-
ble progress in many fields
over the past years. The coun-
try’s ever-increasing innova-
tive power can especially be
seen in the field of artificial
intelligence. And what
impresses me personally is the
The first Kentucky Fried Chicken restaurant on the Chinese mainland was opened in the Qianmen area in Beijing on Nov 12, 1987. Yum China has evolved from a single KFC
store in Beijing 30 years ago to over 7,900 stores across the country today. PROVIDED TO CHINA DAILY
areas have become challenges.
Rebalancing and putting in
place new measures have
already been prioritized by the
government, illustrated by
President Xi Jinping’s focus on
improving the environment
and plans to completely eradi-
people driving this transforma-
tion. From what I experienced,
the Chinese are eager to adapt
to change and embrace it —
and that is something I can def-
initely relate to. When it comes
to our work here, we do not
focus on technologies only.
More importantly, we invest
in people. With the upgrading
of the Chinese manufacturing
industry and the Chinese gov-
ernment’s important work in
promoting vocational educa-
tion, we continually invest in
higher “Made in China” quali-
ty, together with our local pro-
duction plants and dealer
partners. Through coopera-
tion with 26 vocational
schools across the country,
over 4,800 young people have
enrolled in our vocational
training programs since 2006.
cate rural poverty by 2020.
As a company, we also
believe we have a role to play in
overcoming these challenges
and improving the lives of the
communities in which we oper-
ate. For example, Yum China
has implemented a series of sig-
Looking ahead, we will contin-
ue to extend our educational
programs in China, to jointly
shape the future of mobility
with local talent.
How has your company bene-
fited from China’s reform
and opening-up policy?
The whole auto industry
benefited big time. Fueled by
China’s reform to encourage
private vehicle consumption
in the beginning of this centu-
ry, the Chinese automotive
market ignited its remarkable
growth and developed into the
world’s largest auto market in
2009, holding this position
ever since. We have witnessed
and participated in this
impressive growth, thanks to
our Chinese customers who
made China our single largest
CV
Name: Joey Wat
Age: 46
Career:
March 2018 - now: CEO
of Yum China
Feb 2017 - Feb 2018:
President & Chief Operating
Officer of Yum China
Aug 2015 - Feb 2017: CEO
of KFC China
Sept 2014 - Aug 2015:
President of KFC China
Before joining Yum China
in 2014: Managing director
of Watson UK
Education:
Bachelor’s degree from
Hong Kong University
MBA from Northwestern
University’s Kellogg School
of Management
CHINA DAILY
nature corporate social respon-
sibility programs designed to
complement the government’s
poverty alleviation goals and
priorities, including the One
Yuan Donation Program,
which encourages consumers
to donate one yuan to help chil-
Dieter Zetsche
PROVIDED TO CHINA DAILY
market for Mercedes-Benz
passenger cars in 2015.
Over the past years, we have
seen an intensification of Sino-
German cooperation. Our
joint efforts with our strong
partners in China have grown
from local production and
We keep our core
products and intro-
duce innovative new
offerings with local
flavors at different
times of the year.”
Joey Wat, CEO of Yum China
dren living in impoverished
areas across China gain access
to nutritional meals.
Has competition intensified
between your company and
Chinese companies?
I believe the key to success is
to ensure that we keep up with
the ever-changing demands of
our consumers, as well as giv-
ing the autonomy to our local
staff and fully respect regional
differences inside China. One
of the reasons for our success
in China has been our ability
to rapidly adapt to changing
preferences and introduce
localized offerings that
increase choice and deliver
local tastes and flavors. We
keep our core products and
sales of passenger and com-
mercial vehicles to mobility
services and automotive
finance solutions. We are firm-
ly rooted in China and we con-
tinue to expand our local
capabilities, for instance, in
our Beijing R&D center with
over 850 employees. As China
is becoming a global innova-
tion hub, our R&D activities
broaden more and more, now
including the important future
topics — connectivity, autono-
mous driving and NEVs.
Another good indicator in
that matter is the ever-growing
number of locally produced
cars: Today, over 70 percent of
our cars sold in China are also
made here. Driven by the out-
standing market demand for
our premium cars, our joint
venture production hub with
introduce innovative new
offerings with local flavors at
different times of the year.
How do you view China’s role
in the world today?
China has a leading role in a
number of areas in the world
today. As an economy that is
becoming more globalized,
China is slated to play an even
more crucial role in tackling
many of the challenges con-
fronting the global communi-
ty today such as climate
change and the eradication of
extreme poverty.
Another area that stands
out for me is technology and
innovation. It is incredible to
see the rate of adoption and
development when it comes to
technology in China today. It
has transformed the land-
scape and forced companies to
adopt quickly to engage with
customers. But you must be
able to understand how best to
use all this technology. Yum
China has been quick to adopt
and, as always, listen to cus-
tomers. One example is how
we led the way in food delivery
in China with the introduction
of Pizza Hut Home Delivery in
2001. Delivery now accounts
for over 14 percent of our busi-
ness. There is the power of our
membership platform and the
fact that almost 60 percent of
BAIC became our largest Mer-
cedes-Benz passenger car plant
worldwide in 2017. Looking
ahead, we will further deepen
our local partnerships. Togeth-
er with BAIC, we will invest over
11.9 billion yuan ($1.9 billion) to
establish a second production
location in Beijing to expand
capacities for more “Made in
China, for China” products,
including battery-electric vehi-
cles. We are fully committed to
localize Mercedes-Benz elec-
tric vehicles in China, the
world’s largest NEV market.
Has competition intensified
between your company and
Chinese companies?
First of all, I truly believe
competition is a good thing as it
triggers even better perform-
ance, ultimately benefiting the
19
sales were cashless by the end
of 2017 from 100 percent cash
in mid-2015. That just shows
how quickly things can and do
change in China and I believe
this momentum will continue.
Could China’s experience
and practices be used to
solve global problems?
China has always been clear
in what it is focused on and
encouraged companies to
help. I strongly believe compa-
nies have an important role to
play in partnering and helping
to improve people’s lives. Yum
China has created and imple-
mented a series of signature
corporate social responsibility
programs to help with the gov-
ernment’s poverty alleviation
goals and priorities. Programs
that are scalable and accessi-
ble to as many people as possi-
ble can make a real impact.
What measures do you
expect if China wants to
deepen reforms?
I believe that the Party and
the government will continue to
play an essential role to further
deepen government reforms.
The government has also
always been a strong advocate
of innovation and technology,
and I believe that this support
will be further strengthened in
the coming years.
What will be the country’s
“calling card” in the future?
For the past 40 years, China
has focused predominantly on
driving “hard” infrastructural
initiatives such as construct-
ing railways, mega airports
and bridges. In many ways,
this ambition to develop
sophisticated “hard” infra-
structure became China’s
“calling card”.
I believe that in the coming
years, China’s calling card will
shift to “softer” endeavors,
such as investing in business
leaders, scientists and innova-
tion. Technology will also con-
tinue to play a key role as
people increasingly rely on
their mobile phones in their
everyday lives, ranging from
paying electricity bills to
applying for loans.
At Yum China, we will also
continue to actively invest in
our technological and digital
capabilities to cater to con-
sumers’ evolving preferences
and deliver better, more
streamlined restaurant and
delivery services, which we
already offer through the KFC
China Super App, enabling
customers to locate a nearby
KFC store and pre-order food
before picking up the complet-
ed order. I believe we will see
much more of this kind of cus-
tomer-led, service-oriented
innovation coming out of Chi-
na in the next phase of the
country’s growth.
Online
See more by
scanning the
code.
customer. Additionally, it ani-
mates a new spirit of coopera-
tion with promising new
players. We enjoy a successful
cooperation with our local part-
ners in the automotive indus-
try, which remains the strong
base of our efforts here. With
BAIC, we are deepening our
NEV cooperation, as Daimler
recently became a shareholder
of Beijing Electric Vehicle Co.
Furthermore, our cooperation
is also extending outside of car
manufacturing to IT giants
including Baidu, Alibaba and
Tencent, in fields such as auton-
omous driving and connectivi-
ty services. At Daimler, we
maintain our startup spirit, and
China offers great potential for
companies that are able, and
willing, to innovate and shape
tomorrow’s mobility.
20 BUSINESS
US pork producers hope for resolution
American farmers, Chinese consumers
could both lose from trade disputes
By MAY ZHOU in Houston,
Texas and CALVIN ZHOU in
Beaver Creek, Minnesota
For the past two years, John
Zhong has been bringing pre-
mium American Berkshire
pork to tables in China.
Now, he hopes the leaders of
the United States and China
can come to the table and
negotiate a deal to end the
threat of tariffs.
Zhong left China to study at
Iowa State University in 2007
and fell in love with the people
and lifestyle of the American
heartland.
In 2015, he and his partner
Rex Kuo founded Heartland
Brothers — so named because
they felt like brothers united
in their common love of the
American Midwest values of
honesty, hard work, trustwor-
thiness and pride.
They wanted to bring a
piece of the American Mid-
west to China by exporting
Berkshire pork.
A hybrid of Chinese and Sia-
mese pigs produced by the
British in the 1700s, Berkshire
pork is prized for its juiciness,
flavor and tenderness.
Heartland Brothers has
been doing well and growing.
“Last year our sales increased
threefold to about 300 metric
tons. Basically, our company
supports three family hog
farms in the US heartland,”
said CEO Zhong.
Zhong’s fledgling company
could get its wings clipped by
the ongoing trade conflict
between China and the US. In
response to President Donald
Trump’s tariff on Chinese steel
and aluminum, China slapped
a 25 percent tariff on pork at
the beginning of April.
American pork exported to
China already has a 12 percent
tariff to begin with. An addi-
tional 25 percent duty will take
away all of Heartland Broth-
ers’ profit and more.
“The more we sell, the more
money we will lose. We are
becoming the collateral dam-
age in all of this. That’s not
fair,” Zhong said.
Zhong and Kuo are not con-
sidering quitting just yet. “We
do it because we love it, and we
are proud of the heartland
lifestyle,” Zhong said.
One of the three suppliers
for Heartland Brothers is the
Tofteland family farm in Bea-
ver Creek, Minnesota, located
a few miles from the Iowa bor-
der and run by Marvin Tofte-
land and his son David.
They grow soybeans, corn
and Berkshire hogs on 242.8
hectares. Some of their soy-
beans are exported to China.
“We raise about 6,000 to
7,000 Berkshire hogs a year
and have done this for about
20 years now,” Marvin Tofte-
land said. He began selling
hogs to Heartland Brothers
two years ago.
“The numbers have been
increasing with time. The pop-
ularity of Berkshire pork must
be growing in China, people
are acquiring more of a taste
for the old-scout pork,” Tofte-
land said. Last year, about half
of his hogs ended up on tables
in China.
While high demand keeps
the price of Berkshire hogs
steady, with the extra tariff,
“we won’t be able to get the
growth we want in China. We
also would like to see John suc-
ceed,” Tofteland said.
For non-specialty hog pro-
ducers, the economic impact
is more apparent.
“Since the tariff on Chinese
steel and aluminum was
announced, the price of hogs
David Tofteland checks Berkshire hogs at his family farm in Beaver Creek, Minnesota.
has dropped by about $20 a
head. The situation definitely
created an atmosphere to
push the price low,” said Brian
Duncan, a hog farmer in Polo,
Illinois.
Duncan’s family farm mar-
kets about 70,000 head a year.
The price drop, if it does not
recover, will translate to a loss
of $1.4 million for him.
Like Tofteland, Duncan
hopes that both nations sit
down to discuss how to divide
the economic pie more evenly
instead of imposing tariffs on
each other.
“It’s frustrating that there is
a process in place through the
WTO to address trade con-
cerns, but a disruptive path
was chosen. Producers in the
US and consumers in China
get the short end. We hope
both sides get this negotiated
out and move on,” Duncan
CALVIN ZHOU / CHINA DAILY
told China Daily.
David Anderson, a professor
and livestock economist at Tex-
as A&M, said that with China
being a major export market
for US pork, the tariff will
affect the overall meat market
in the US.
“The meat industry is inter-
connected. This year, the US is
producing a record amount of
meat at roughly 140 billion
pounds. If we sell less to Chi-
Online teaching group bets
big on technology for growth
By CHENG YU
chengyu@chinadaily.com.cn
Xueersi Online School, a
subsidiary of leading Chinese
education company TAL Edu-
cation Group, has unveiled its
latest online English learning
products in response to strict
policies regarding after-class
institutions.
The step came after Chinese
education authorities called
for more intensified efforts to
renovate after-school training
institutions to cut excessive
academic burdens for the
country’s primary and second-
ary school students.
The newly launched prod-
ucts emphasize technology
that enables students to take
online classes combining
livestreaming courses, quiz-
zes, voice tests and mentoring,
all aimed at helping students
to “improve efficiency” rather
than simply increasing their
educational burdens.
“We scramble to advance
education through technolo-
gy,” said Zhou Nan, head of
Xueersi Online School, who
is responsible for English
language study products.
“Our latest products will
help students to learn
English in a more immersive
and efficient way, which fur-
thermore lightens students’
burden.”
The artificial intelligence-
enabled product acts like an
“AI teacher” integrated with
hard technologies.
Its voice-recognition system
helps to record and grade
learners’ pronunciation and
intonation, while face recogni-
tion helps to discern students’
status through observing their
facial expression.
Also, students can role play
with the AI-enabled system
and can take part in an
immersive learning environ-
ment with the company’s tai-
lor-made, cartoon-based
scenarios.
The move also exemplifies
Friday, April 13, 2018 CHINA DAILY HONG KONG EDITION
na, that means lower prices for
beef too,” Anderson said.
In addition, China has put
beef on the list for the next
round of potential tariffs.
“Everybody had a lot of hope
that China’s beef market
would grow. I don’t expect the
tariff to result in noticeable
changes now, but the market
certainly will not grow for us
in the future,” Anderson said.
As an economist, Anderson
A girl tries the latest livestreaming courses of Xueersi Online
School in Beijing. PROVIDED TO CHINA DAILY
TAL’s broader efforts to
advance education through
technology, thereby expand-
ing its online course business-
es to seek new growth
engines.
“Regulations from top edu-
cation authorities may lead to
some adjustments of K12 (kin-
dergarten through 12th grade)
businesses, but in the long
term, they will benefit leading
education companies like TAL
and New Oriental to some
extent,” said Wu Yue, an ana-
lyst from China International
Capital Corp Ltd.
Wu explained that the mar-
ket will tend to be healthier
under regulations as some
small and mid-sized institu-
tions are expected to drop out
of the competition as they
gradually lag behind market
leaders.
“Online businesses are
expected to become the next
big growth point for TAL and
the company will continue to
benefit from its investments in
technology,” Wu added.
“Advanced technologies in
the education segment will be
of great help to improving
teaching progress as well as
expanding businesses,” Wu
said, adding that TAL’s inten-
sified application of technolo-
gies including AI have helped
favors free trade. “In a bigger
picture, free trade is how the
economy grows. The econom-
ic gain from free trade comes
from people doing what they
are good at.”
The opposite of free trade,
tariffs will result in a lot of los-
ers. “It’s hard to see any win-
ners in this,” Anderson said.
Contact the writers at mayz-
hou@chinadailyusa.com
its online classes be more
interactive, which has
improved user experience to
some degree.
Overall, TAL shares have
seen steady growth since its
debut in the New York Stock
Exchange in 2010. Its shares
rose from $30.27 per share on
Jan 2 to $37.19 per share on
Apr 11 recently.
“We will continue to enlarge
our investment in technolo-
gies as well as research and
development this year,” said
Zhang Guohui, head of Xueer-
si Online School responsible
for technologies.
According to Zhang, Xueer-
si Online School has attracted
more than 7 million students
registered for courses, with a
maximum of 100,000 students
taking livestreaming classes at
the same time.
He said that more than 400
talents focused on technolo-
gies are enrolled in Xueersi
Online School and this figure
is expected to rise to 1,000 by
the end of this year.
“We have accumulated over
10,000 voice samples in the
past year. With the increasing
number of data, our technolo-
gies tend to be more accurate.
It will help teachers to teach
better and help students to
learn better,” Zhang added.
 CHINA DAILY HONG KONG EDITION Friday, April 13, 2018 BUSINESS 21

New ministry to help nation keep word on emissions Nutrition to

By ZHENG YIRAN The nation’s new PV instal-
lation last year reached 53

zhengyiran@chinadaily.com.cn
China’s newly established
Ministry of Ecology and Envi-
ronment will play a significant
role in meeting the commit-
ment to the reduction of green-
house gas emissions
worldwide, said an official from
the Energy Foundation — an
international non-governmen-
tal organization aimed at pro-
moting the use of clean, reliable,
and secure sources of energy.
In addition, it will also help
China cut local pollutant emis-
sions, such as PM 2.5 — particu-
late matter with a diameter of
or less than 2.5 micrometers,
sulfur dioxide and nitrogen
oxides, said Zou Ji, president of
the Energy Foundation China.
“China’s current energy
structure is able to reduce both
greenhouse gas and local pollu-
tant emissions simultaneously.
With the new ministry estab-
lished, the government will
have more control over techni-
cal, political, strategic and
financial solutions, realizing a
synergistic effect,” Zou said.
Laurence Tubiana, chief
executive officer of the Europe-
an Climate Foundation, said:
“President Xi Jinping’s com-
mitment to green energy is
important. I don’t think we can
carry on this enormous eco-
nomic transformation without
An employee puts finishing touches to photovoltaic products at a facility of Shenzhou New Energy
Co in Lianyungang, Jiangsu province. SI WEI / FOR CHINA DAILY
high-level commitment.”
She hoped Europe and Chi-
na could work hand in hand
to focus on green investment,
China is a major green technology, economic
transformation and trade. “It
power with enor- is important not to lose that
momentum,” she added.
mous influence in US Special Envoy for Cli-
the region and in mate Change Jonathan Per-
shing agreed. “China is a
the world ...” major power with enormous
influence in the region and in
Jonathan Pershing, United the world ... Over the past sev-
States special envoy for climate eral years, we have seen an
change increase in China’s interest
and engagement in green
energy, and I hope the new
structure continues to move
that forward,” he said.
China has been taking the
lead in new energy contribu-
tion in recent years.
According to a recent report
by Bloomberg New Energy
Finance, China is in pole posi-
tion in investing in the photo-
voltaic industry. In 2017, total
PV investment around the
globe reached $160.8 billion,
up 18 percent year-on-year,
among which the investment
from China totaled more than
50 percent at $86.5 billion.
gigawatts, a great increase
from 2016.
Justin Wu, general manag-
er of BNEF Asia-Pacific, said
that “China’s PV installation
in 2017 was 20 GW higher
than we estimated.”
“This is partly due to the
pressure of industry devel-
opment, in that Chinese reg-
ulators have not strictly
limited the scale of new
ground power stations,
although the burden of sub-
sidies had become increas-
ingly severe and power
curtailment problems con-
tinued to spread,” he said.
“In addition, there are an
increasing number of rooftop
PV projects in the nation’s
industrial parks, whose
capacity is not limited by the
government.”
Wu added: “China’s large-
scale power consumers have
begun installing PV panels to
meet their own electricity
needs. As the cost continues
to decline, the economic
advantages on the consumer
side have also become
increasingly prominent.”
According to BNEF, China’s
total investment in clean
energy in 2017 reached a
record-breaking $132.6 bil-
lion, growing 24 percent on a
year-on-year basis.
be top focus
for Wahaha
Rising demand from consumers drives
move toward health products industry
By SHI JING in Shanghai
shijing@chinadaily.com.cn
Hangzhou Wahaha Group,
one of China’s largest beverage
companies, is seeking an
industrial upgrade by shifting
its focus to its nutrition and
health products and investing
in high-tech industries,
founder and chairman Zong
Qinghou said on Wednesday.
“Wahaha will ramp up
efforts on health products for
the increasing number of Chi-
nese customers with metabol-
ic disorder such as diabetes,”
Zong said. “And as more Chi-
nese, especially the younger
generation, are facing health
problems such as insomnia,
we are planning more prod-
ucts to help improve the situa-
tion.”
In addition, the group has
Nutrition and Health Food
Association, the market size of
the country’s health products
reached 400 billion yuan
($63.7 billion) in 2017, with
more than 16,000 products
registered and approved for
production.
Industry leaders in the sec-
tor also reported positive per-
formance last year. Beijing-
based Be Sun Yen Holdings
had an annual turnover of 543
million yuan in 2017, up 5.5
percent year-on-year. Zhuhai-
based By-Health reported even
stronger annual growth of 34.7
percent with sales revenue of
3.1 billion yuan last year.
Zhu Danpeng, a researcher
at the China Brand Research
Institute, said that a growing
number of companies are
entering the health products
industry, providing more

Airbnb considers China crucial for global expansion plans
By HE WEI in Shanghai
hewei@chinadaily.com.cn
United States’ home-shar-
ing platform Airbnb is dou-
bling down on China through
a suite of new services to
reach an untapped segment
of travelers in the country
that the firm predicts will
become its most significant
market by 2020.
Efforts to enhance service
consistency include an
expanded accommodation
portfolio and host training
sessions, as it takes on hotels
with standardized services,
according to Nathan Ble-
charczyk, Airbnb’s co-founder
and China chairman.
“Our goal is to welcome
more than one billion guests
by 2028, and we cannot reach
this goal without our Airbnb
China community,” said Ble-
charczyk, who forecast China
to be the platform’s largest
source of guests in the next
three years.
As people explore authentic
and local experiences, one
appeal of booking through
Airbnb is that each home is
different. But that creates a
dilemma as such inconsisten-
cy could scare off those willing
to spend more to guarantee a
safe and convenient stay.
To prevent guests from
being “unpleasantly sur-
prised”, the company has
launched an Airbnb Plus pro-
gram that features more stan-
dardized facility offerings and
stringent screening measures.
Hosts must submit applica-
tions and go through an
on-the-spot inspection of the
home against a 100 plus-point
checklist. Shanghai is one of
the first 13 cities worldwide to
launch Airbnb Plus in March,
with more Chinese cities in
the pipeline later this year.
“By verifying these homes,
we make sure the houses
come fully stocked with
shampoo, toilet paper, pots
and pans, and have a general
level of cleanliness to meet
higher expectations from
travelers,” he said.
Airbnb is doing exception-
ally well among Chinese mil-
lennials, with 18-to-35-year-
olds making up almost 80
percent of its Chinese custom-
ers, Blecharczyk noted. The
country is also home to a
notably younger population
of hosts compared with other
markets such as the US.
To continue that momen-
tum, the company has just
launched a namesake acade-
my offering offline work-
shops, online live chats and
videos to better train and
engage with hosts.
Meanwhile, the concept of
sharing accommodation is
slow to gain traction among
China’s high-end travelers,
according to research by Hur-
un last June. Only a quarter of
those surveyed said they
would consider private home-
stay options like Airbnb, trail-
ing behind boutique hotels
and cruises.
Hence, the recent addition
of four new property classifi-
cations types, including bou-
tique hotels and distinctive
properties like treehouses
and yurts — tents commonly
used by Mongolian residents
— could be a hit to capture
independent Chinese tourists
who are typically choosing a
home rental for the experi-
ence and not for the cheap
price tag, he noted.
Online
See more by
scanning the
code.
also invested in a probiotics
production line.
Wahaha will also produce a
meal replacement in the near
future. The product, which is
made up of dietary fiber and
necessary nutrition, will main-
ly target the growing number
of Chinese dieters, especially
women, as the group tends to
have stricter weight control,
Zong said.
“China is undergoing an
economic transformation and
upgrading at present. There-
fore, the development of high-
end manufacturing and smart
equipment has become a buzz-
word. But as a matter of fact,
traditional industries, which
are closely related to people’s
daily lives, should also under-
go upgrading and there will be
room for their development,”
he said.
According to the China
products and catering to the
rising demand from consum-
ers.
As some traditional indus-
tries are going through a diffi-
cult time, health products
present a new opportunity for
transformation, attracting
more companies to divert
their focus in the near future.
Meanwhile, Wahaha plans
to invest in some high-tech
and advanced manufacturing
companies in the future,
according to Zong. Instead of
looking for targets on its own,
Wahaha will team up with
experienced industry leaders
to ensure the success of the
investments.
The firm now has set up
more than 80 production bas-
es and 180 subsidiaries all over
China, and registered an
annual turnover of 40 billion
yuan in 2017.

Daily Stock Market Performance Gainers

Gainers
and and
Losers
Losers International Stock Markets
Daily YTD Daily Daily Daily YTD % Chg
Index Close % Chg % Chg GAINERS Close % Chg LOSERS Close % Chg Close % Chg –20% 0% +20%
Shanghai Stock Exchange Composite Index 3180.16 –0.9 –3.8 Hang Seng Index 30,831.28 –0.2
Shanghai Stock Exchange
3600 Hang Seng China Ent Index 12,288.86 –0.3
Datang Telecom Tech 8.32 10.05 Wuxi Acryl Technology 42.81 –10.01
3490 Sunny Loan Top Co Ltd 7.67 10.04 Raisecom Technology Co 20.15 –10.00 TAIEX Taiwan Stock Index 10,955.29 –0.2
3380 Xinjiang Youhao Group 6.14 10.04 Great-Sun Foods Co Ltd 32.86 –10.00 Nikkei 225 21,660.28 –0.1
ShanghaiLaChapelleFshn 18.43 10.03 Zhejiang Ausun Pharma 20.75 –8.87 Sensex 34,141.61 0.6
3270
Hunan Salt Industry Co 15.25 10.03 ZhengzhoClIndstry&ElPw 5.43 –8.43 KOSPI 2,442.71 –0.1
3160 S&P/ASX 200 5,815.53 –0.2
Cashway Technology Co 32.29 10.02 Tianjin712Comm& Brdcst 44.00 –8.31
3050 AnhuiGenuine New Matrl 39.44 10.01 XinjingSlmMdrnAgrcltre 4.76 –6.85 New Zealand 50 Gross Index 8,404.22 –0.6
Deppon Logistics Co 29.01 10.01 ShanghaiGldnBrdgInfTch 18.94 –6.38 Straits Times Index STI 3,469.12 –0.3
Qijing Machinery Co 24.29 10.01 Henan Dayou Energy Co 4.65 –6.06 Bangkok SET Index 1,766.13 0.2
Tederic Machinery Co 20.45 10.01 Hubei Zhenhua Chemical 16.06 –5.92 Bursa Malaysia KLCI Index 1,868.12 –0.1
Shenzhen Stock Exchange Component Index 10,726.96 –0.8 –2.8
VN-Index 1,173.02 0.5
11,700 Shenzhen Stock Exchange Dow Jones 24,189.45 –0.9
11,200 Shaanxi International 4.32 9.92 Shenzhen Tat Fook Tech 12.97 –4.84
ShandongHumon Smelting 13.00 9.80 Nanjing Hanrui Cobalt 171.35 –4.64
10,700 ChongqingZhifeBlgclPrd 36.71 8.61 Suzhou Anjie Tech 19.38 –4.39 Commodities
10,200 Yintai Resources Co 16.70 6.71 Sichuan Jiuzhou Electr 6.50 –4.27 Daily YTD % Chg
Hunan Gold Corp Ltd 10.22 6.24 Ninestar Corp 26.60 –4.04 Close % Chg –25% 0% +25%
9700 Hangzhou Century Co 11.34 4.71 WuxiLeadIntllgntEqpmnt 67.62 –4.02 Brent Crude Oil (USD/bbl.) 71.80 –0.4
Berry Genomics Co Ltd 56.93 4.27 All Winner Technology 24.97 –3.96 Gold (USD/t oz.) 1360.00 1.0
Transfar Zhilian Co 17.64 4.19 NAURA Technology Group 42.20 –3.87 Silver (USD/t oz.) 16.77 1.0
Zhejiang Cen Huatong 35.17 4.05 Huaxun Fangzhou Co Ltd 10.07 –3.82 Copper (USD/lb.) 3.12 –0.6
Shanghai Shenzhen CSI 300 Index 3898.64 –1.0 –3.3
Hubei Biocause Pharma 8.02 3.89 Shenzhen Deren Electr 18.82 –3.78 Aluminum (USD/MT) 2257.00 2.2
4400 Corn (USD/bu.) 3.96 –0.5
Hang Seng Wheat (USD/bu.) 5.04 –0.8
4000 CNOOC Ltd 12.46 3.66 Galaxy Entertainment 70.85 –2.95 Soybeans (USD/bu.) 10.59 –0.1
PetroChina Co Ltd 5.69 2.89 Wharf RealEstate Invst 54.30 –1.72 Coffee (USD/lb.) 1.20 –0.2
3600 WH Group Ltd 8.68 2.24 Tencent Holdings Ltd 413.20 –1.53 Sugar #11 (USD/lb.) 0.12 –0.2
China Unicom Hong Kong 10.30 1.98 AIA Group Ltd 70.60 –1.40 Palm Oil (MYR/MT) 2405.00 –1.1
3200 Sunny Optical Tech 155.40 1.64 Geely Automobile 23.45 –1.26

Cross Currency Rates ETFS

Shanghai B-Share Stock Price Index 325.91 –0.2 –4.7 Daily %
USD EUR CNY HKD GBP KRW BRL RUB JPY INR CAD EQUITY ETFs Ticker Close Change
365
USD 1.234 0.159 0.127 1.415 0.001 0.296 0.016 0.009 0.015 0.793 China 50 510050 2.74 –1.19
355 China AMC CSI 300 Index 510330 4.22 –0.78
EUR 0.810 0.129 0.103 1.147 0.001 0.240 0.013 0.008 0.012 0.643
345 China CSI 500 510500 6.36 –0.53
335 CNY 6.285 7.759 0.801 8.897 0.006 1.862 0.101 0.059 0.096 4.984 China SME 159902 3.53 –0.65
HKD 7.850 9.686 1.249 11.111 0.007 2.326 0.126 0.073 0.120 6.224 China Universal CSI Consumer Staples Index 159928 2.21 –0.63
325
GBP 0.707 0.872 0.112 0.090 0.001 0.209 0.011 0.007 0.011 0.560 E Fund ChiNext Price Index 159915 1.72 –0.52
315 E Fund CSI 300 510310 1.65 –0.96
KRW 1069.550 1321.660 170.324 136.250 1517.870 317.635 17.230 10.021 16.357 850.110
E Fund CSI 300 Financials ex Banks Index 512070 1.91 –1.04
BRL 3.375 4.173 0.537 0.430 4.775 0.003 0.054 0.032 0.052 2.676 E Fund Hang Seng China Enterprises Index 510900 1.24 –0.64
Shenzhen B-Share Stock Price Index 1138.07 –0.6 –2.2
RUB 62.225 76.768 9.902 7.928 88.052 0.058 18.441 0.583 0.957 49.338 E FUND SZSE100 INDEX FUND 159901 4.80 –0.95
1250 Fortune SGAM Xianjin Tianyi Money Market 511990 100.02 0.00
JPY 106.830 131.820 16.999 13.609 151.193 0.100 31.657 1.717 1.634 84.707
Guangfa CSI 500 510510 1.68 –0.53
1190 INR 65.395 80.705 10.405 8.330 92.550 0.061 19.378 1.051 0.612 51.848 Guotai Shanghai Stock Exchange 180 Financial Index 510230 6.07 –1.44
CAD 1.261 1.556 0.201 0.161 1.785 0.001 0.374 0.020 0.012 0.019 Harvest CSI 300 Index 159919 4.24 –1.07
1130 Huatai-Pinebridge CSI 300 510300 3.89 –1.04
Shanghai SSE180 510180 3.33 –1.01
Data provided by
1070 SSE Pledge Urban Investment Bond 511220 93.99 0.22
A M J J A S O N D J F M A Yinhua Traded Money Market Fund 511880 101.30 0.00
22 LIFE | Dining Friday, April 13, 2018 CHINA DAILY HONG KONG EDITION

Reading between the leaves

Eat beat

Star chef returns

Three-star Michelin chef
Curtis Duffy is back in town
after he wowed Beijing
foodies last April with his
culinary magic. Duffy is
bringing a six-course dinner A new book accompanying a documentary series about the history of Chinese tea
at Flames Grill from April 11
to 14, with caviar, crab, scal- and its global cultural significance has just been published. Li Yingxue reports.
lops, duck leg, wagyu and a
strawberry dessert.

8 Wangfujing East Street,
Dongcheng district, Beijing.
010-5812-8888.
No limits for Tola
Social media celebrity chef
Marco Tola is coming to host
a delectable four-day culinary
feast with his artistic crea-
tions on a plate from April 11
to 14 at the Ritz-Carlton, Tian-
jin. The four-day event will
feature different Italian deli-
cacies and themes each day.
Tola will also be on hand to
explain his culinary aesthet-
ics to his customers in person.
167 Dagubei Road, Heping
district, Tianjin.
022-5809-5123.
Tea with Delvaux
Rosewood Beijing celebrates
leather luxury goods compa-
ny Delvaux with the mai-
son’s 2018 spring/summer
collection and an exquisite
afternoon tea at Bistrot B
Lounge Bar this month. Pas-
try chef Florian Couteau and
his team have created sweet
and savory delights for an
afternoon tea that echoes
Delvaux’s collection.
Jingguang Center, Chao-
yang district, Beijing.
010- 6536-0066.
CHINA DAILY
I
n the middle of 19th cen-
tury, Scottish botanist
and plant hunter Robert
Fortune famously stole
tea plants and seeds from Chi-
na and took them to India,
from where they traveled to
the rest of the world.
The tea Fortune purloined
from the Wuyi Mountains in
Fujian province used to be
known by the trade name
Bohea in English, which is a
derivation from the Fukien-
ese pronunciation of “Wuyi”.
The history of Bohea tea
was told in the first season of
the documentary, Chinese
Tea, which began airing on
Jiangsu TV in August and
contains more than 100 inter-
views with tea planters, tea
makers, tea sellers and tea-
culture buffs.
“Every story from tea to
taste bud is a story of people
and emotions,” says Liu Jia,
chief director of the 10-epi-
sode documentary.
A book of the same name
was published at the end of
March, adding a wealth of
background information to
the documentary series.
Liu, who is also the chief
editor of the book, says that
preparation for the book
started during the shooting of
the documentary.
“The planning and shoot-
ing of the documentary took
two years, and we had collect-
ed a large amount of material
about Chinese tea,” says Liu.
“But the information includ-
ed in the documentary is lim-
ited by its format, so I wanted
to present this information in
the form of a book.”
Liu started researching and
planning the series in 2016,
and had visited more than 10
provinces in China. The crew
also shot sequences in Britain,
Japan and Kenya.
“Chinese tea is actually an
international cultural symbol,
so we chose some countries
that have been greatly influ-
enced by Chinese tea,” says
Liu.
Graduating from Peking
University in 1991, Liu later
worked for China Central
Television and Xinhua News
Agency. He realized that
there were not many Chinese
documentaries about tea.
Most instead focus on Chi-
na’s culture and customs.
“I think because there are
too many aspects of knowl-
edge about tea, it’s complicat-
ed to explain everything,” Liu
says. He then decided to tell
his audience about high-
quality tea in season one —
What is high-quality tea?
Where is it made, and how
did it make its way around
the world?
Pictures in the book, Chinese Tea, feature a tea garden (top) on
Hainan Island and a woman picking tea leaves in Ya’an, Sichuan
province. PHOTOS PROVIDED TO CHINA DAILY
Unlike food documenta-
ries that show a variety of
ingredients, locations and
cooking skills, making an
engaging series about tea
proved more difficult — espe-
cially since the tea plants and
tea making processes in dif-
ferent areas often appeared
the same.
“Aerial footage of different
tea gardens tended to look
pretty similar, which some-
times even confused our edi-
tors. So we only chose footage
that added a visual impact to
Chinese Tea, published by the China Light Industry
Press, adds a wealth of background information to the
documentary series of the same title.
the stories we were telling in usual impression of pretty
the documentary instead of young women picking tea
relying on them to show the leaves in the mountains. So
full picture,” Liu says. we wanted to show our audi-
“The limitations of the doc- ence it is really not easy to
umentary format were made produce high-quality varie-
up for in the book. Since the ties of tea.”
book follows the same logical The documentary has been
lines as the series, we were airing on Friday nights, a
able to include much more prime slot usually reserved
background information in for reality shows, and is now
the publication.” being aired on international
Liu chose the China Light routes by Air China.
Industry Press to produce the For the second season of
book as they had already pub- Chinese Tea, which is due to
lished a series of titles about air in the second half of the
tea, and their team was year, Liu is planning to focus
knowledgeable on the sub- on the flavors of tea.
ject. “The editing process Liu Wei, former deputy
takes longer because you chief editor of the Guangming
need to verify all the informa- Daily, says the book reminds
tion and stories about tea. We him not only about the differ-
found that some of the stories ent flavors of tea, but also the
were actually made up by tea stories he enjoyed when
merchants,” says Liu. “In ret- drinking tea with people.
rospect, some of these should “The documentary is like a
have been left out of the docu- journey with tea ambassa-
mentary.” dors, like a modern Silk Road
As a tea lover, Liu learned a trip,” says Liu. “The book will
great deal about tea during spread the journey farther
the documentary’s produc- and wider.”
tion and the editing stages of
the book. “Planting and pro- Contact the writer at
ducing tea is actually a heavy liyingxue@
work, and not at all like the chinadaily.com.cn

Hong Kong Exchanges and Clearing Limited and The Stock Exchange of Hong Kong Limited take
no responsibility for the contents of this announcement, make no representation as to its accuracy or
completeness and expressly disclaim any liability whatsoever for any loss howsoever arising from or in
reliance upon the whole or any part of the contents of this announcement.

AUTOMATED SYSTEMS HOLDINGS LIMITED

(Incorporated in Bermuda with limited liability)
(Stock Code : 771)

THE COMPANIES (WINDING CLOSURE OF REGISTER OF MEMBERS

UP AND MISCELLANEOUS
PROVISIONS) ORDINANCE
(CHAPTER 32)
IN THE MATTER OF
CELLMARK CHINA LIMITED
(“the Company”)
NOTICE OF MEETING OF
CREDITORS OF THE COMPANY
NOTICE IS HEREBY GIVEN, pursuant
to section 241 of the Companies (Winding
Up and Miscellaneous Provisions)
Ordinance (“Ordinance”), that a meeting
of the creditors of the Company will be
held at 10 a.m. on 26 April 2018 at Suite
B1, 23/F, United Centre, 95 Queensway,
Admiralty, Hong Kong to appoint Joint
and Several Liquidators to the Company
and to consider further matters relevant
to the creditors’ voluntary winding-up
of the Company pursuant to sections
241, 242, 243, 244, 251, 255A and 283
of Ordinance. Creditors may vote either
in person or by proxy. Proxies must be
ORGJHGDWWKHRI¿FHRI=ROIR&RRSHU+RQJ
Kong) Limited, Suite B1, 23/F, United
Centre, 95 Queensway, Admiralty, Hong
Kong not later than 24 hours before the
holding of the meeting.
Dated this 13th day of April 2018
Ng Hui Peng Kelly
Director
NOTICE IS HEREBY GIVEN that the register of members of Automated Systems Holdings Limited (the
“Company”) will be closed on the followings days:
NOTICE OF HEARING OF
APPLICATION TO COURT FOR For 2018 Annual General Meeting
ANNULMENT OF BANKRUPTCY ORDER
AND DISMISSAL OF For determining the entitlement to attend and vote on the forthcoming annual general meeting to be held
BANKRUPTCY PETITION on Wednesday, 16th May 2018, the register of members will be closed from Friday, 11th May 2018 to
Wednesday, 16th May 2018, both days inclusive, during which period no transfer of shares of the Company
IN THE HIGH COURT OF THE
will be registered. In order to determine the entitlement to attend and vote at the forthcoming annual general
HONG KONG
SPECIAL ADMINISTRATIVE REGION meeting, all completed transfer forms accompanied by the relevant share certificates must be lodged with
the Company’s branch share registrar in Hong Kong, Tricor Tengis Limited, at Level 22, Hopewell Centre,
COURT OF FIRST INSTANCE
183 Queen’s Road East, Hong Kong, for registration not later than 4:30 p.m. on Thursday, 10th May 2018.
IN BANKRUPTCY PROCEEDINGS
NO.9999 OF 2008 For Final Dividend and Bonus Issue
Re: CHAN WAI TAK (“the Bankrupt”)
Applicant: CHAN WAI TAK 7KH¿QDOGLYLGHQGDQGERQXVLVVXHDUHVXEMHFWWRWKHDSSURYDORIWKHVKDUHKROGHUVDWWKHIRUWKFRPLQJDQQXDO
TAKE NOTICE that the High Court has JHQHUDOPHHWLQJ7KHUHFRUGGDWHIRUHQWLWOHPHQWWRWKHSURSRVHG¿QDOGLYLGHQGDQGWKHSURSRVHGERQXVLVVXH
appointed Thursday, the 24th day of May 2018 LV7XHVGD\WK0D\)RUGHWHUPLQLQJWKHHQWLWOHPHQWWRWKH¿QDOGLYLGHQGDQGWKHERQXVVKDUHVWKH
at 11:00 a.m. to hear the application of the register of members of the Company will be closed from Thursday, 24th May 2018 to Tuesday, 29th May
Bankrupt pursuant to Section 33(1)(b) of the 2018, both days inclusive, during which period no transfer of shares of the Company will be registered. In
RUGHUWRTXDOLI\IRUWKH¿QDOGLYLGHQGDQGWKHERQXVVKDUHVDOOFRPSOHWHGWUDQVIHUIRUPVDFFRPSDQLHGE\WKH
Bankruptcy Ordinance to annul the bankruptcy
order made against the Bankrupt on the 6th day UHOHYDQWVKDUHFHUWL¿FDWHVPXVWEHORGJHGZLWKWKH&RPSDQ\¶VEUDQFKVKDUHUHJLVWUDULQ+RQJ.RQJ7ULFRU
of January 2009 and to dismiss the bankruptcy Tengis Limited, at Level 22, Hopewell Centre, 183 Queen’s Road East, Hong Kong, for registration not later
petition presented against the Bankrupt on the WKDQSPRQ:HGQHVGD\UG0D\7KH¿QDOGLYLGHQGZDUUDQWVDQGVKDUHFHUWL¿FDWHVRIWKHERQXV
24th day of November 2008. shares are expected to be despatched to the qualifying shareholders of the Company on or before Friday, 8th
Any creditor who wishes to support or oppose June 2018.
the said application shall give notice in writing By Order of the Board
to the Solicitors for the Bankrupt on or before
10th May 2018, and may appear at the High
Automated Systems Holdings Limited
Ngan Wai Hing
Court on the appointed day for the purpose by Company Secretary
himself or his solicitor. Hong Kong, 13th April 2018
Dated this 13th day of April 2018.
Messrs. Edward C.T. Wong & Co. As at the date of this announcement, the Board comprises Mr.Wang Weihang and Mr. Wang Yueou being
Solicitors for the Bankrupt, Executive Directors; Mr. Li Wei and Mr. Cui Yong being Non-Executive Directors; and Mr. Pan Xinrong,
4th Floor, Club Lusitano, Mr. Deng Jianxin and Ms. Or Siu Ching, Rerina being Independent Non-Executive Directors.
16 Ice House Street,
Central, Hong Kong. This announcement is also available for viewing on the website of Hong Kong Exchanges and Clearing
Limited at www.hkex.com.hk and on the website of the Company at www.asl.com.hk.
Tel: 2545 5688 Fax: 2854 0198
Ref: GC/40793/17
 CHINA DAILY HONG KONG EDITION Friday, April 13, 2018 Fun | LIFE 23
Language tips
Horoscope
BETTER CHINESE
Crossword Capricorn (DEC. 22-JAN. 19)
Share your feelings and discuss plans to make your home a
place of comfort. Love and romance should be high on your list,
along with entertaining and self-improvement projects.
选择


Aquarius (JAN. 20-FEB. 19) To choose; a choice
Helping others can be fun, until someone takes advantage of
you. Only offer what’s warranted, and make suggestions to peo- 例：我可以选择吗？
ple who could put them to good use.
 



Can I make a choice?
Pisces (FEB. 20-MARCH 20)
If you use your charm, good things will come to you. Reconnect-
ing with an old crush will give you a different perspective on the
past, present and future.
手术
 
Operation
Aries (MARCH 21-APRIL 19)
Work behind the scenes and take care of your responsibilities 例: 手术很简单。
without complaining. Structure and discipline will help you cre-
ate a stable environment that will encourage you to excel.  
It’s a simple operation.
Taurus (APRIL 20-MAY 20)
Socialize with peers, reconnect with old friends or relatives, or
take up an unusual hobby that will stimulate your imagination.
签字
An opportunity to make new friends should not be ignored. 
Sign
Gemini (MAY 21-JUNE 20)
例：请在这里签字。
A proposal should be looked at carefully. Make sure you fully
understand what’s expected of you before you sign up for some- 


thing that may restrict or jeopardize your progress. Please sign here.

Cancer (JUNE 21-JULY 22)

If you put everything you’ve got into whatever task or project you
打包
take on, your effort will not go unnoticed. Expand your friend- 
ships and interests. A promising partnership is in the stars. To pack; doggy bag

Leo (JULY 23-AUG. 22) 例：吃不完我们可以打包带走。

Learn from an expert. How you go about your business and !"# $
   
relate and react to others will be the deciding factor when it Let’s doggy bag the food that we cannot finish eating.
comes to getting ahead or being given a unique opportunity.

Virgo (AUG. 23-SEPT. 22) 听说

An open discussion with a friend or relative will help resolve an %"&
Across 33 Org. whose 64 Not seriously 27 Rapper with issue you’ve been struggling with for some time. If someone is Being told; hear about
1 Pipe with a website has a 65 Bacchus and the 2013 #1 being excessive, an intervention will help.
tube “Know Your Ariadne paint- album Born 例：我听说他被解雇了。
7 Like out-of- Rights” tab er, circa 1523 Sinner Libra (SEPT. 23-OCT. 23)  %"&%$
range stations 34 Narrow grooves 66 Used a black 28 Page in a Holly- I was told that he had been fired.
Look over your personal papers, pending settlements or any
15 Three times 35 Opposite of marker on … or wood script? health issues that interfere with physical activities you enjoy
16 Part of many a weather, on a a hint to three 30 Mucilaginous doing. Taking care of personal business will make you feel opti-
wreath ship chunks of black 31 Counting word mistic about the future.
36 Eco-friendly squares in this 32 Verges on 买单
17 “Aren’t you 
glad I’m back?” seafood desig- puzzle 34 Like river Scorpio (OCT. 24-NOV. 22)
nation 67 Unspecified deltas To pay the bill
18 Place with pic- A chance to spend more time with a loved one is encouraged.
nic tables, often 38 --- group 37 Catch, in a way Take a short trip, engage in unusual activities and expand and
19 Student’s note- 40 It might come 39 It’s “rarely pure explore your creative ideas and talents.
例：我来买单吧。
taking aid from a tap Down and never sim-  #
21 --- 41 Draw out 1 Counterpart of ple,” per Oscar Please let me pay the bill. / It’s my treat.
Sagittarius (NOV. 23-DEC. 21)
22 Christopher 45 Prince, for one JavaScript Wilde
46 Hit 42 The Richard in Open your doors and host a get-together. Sharing your ideas is
Hitchens and 2 Home to Bowl- fine, but the information you gather will put you in a better posi-
Marcel Proust, 48 Hawks have ing Green a Shakespeare tion when it comes time to make a decision.
From Let’s Speak — Phrasebook of Mandarin Chinese, by China Intercontinental Press

for two sharp ones 3 Roundabouts title

26 Played at a par- 49 Yelling 4 Acted syco- 43 Struggle (with)
ty, say 52 Large wire phantically 44 “Picnic” play-
29 He portrayed 55 --- 5 Peaks wright
Steve Wozniak 59 Sprint, e.g. 6 Prom wear, for 47 Nova ___ Bridge
in “Steve Jobs” 63 Gets away from some 50 Poem title BETTER ENGLISH
7 Pesticide appli- starter Josh Billings was the pen
er 51 Like many name of 19th-century Amer-
Yesterday’s solution 8 7-up, for exam- monuments at ican humorist Henry Wheel-
ple night er Shaw. He said, “My son, 十大手机厂商推“快应用”
对抗小程序
9 True or false: 52 Place to wor-
ship from observe the postage stamp!
Abbr. Its usefulness depends upon
10 Asian holiday 53 Lone
54 Completely its ability to stick to one 3月20日，由多家国内手机巨头共同推动的“快应用”
11 “Don’t doubt 标准正式对外公布。
me!” convinced thing until it gets there.”
12 Drawstring, e.g. 56 Woman’s name He could not imagine self-
13 Attack in an that sounds like adhesive stamps. When bid-
underhanded its first two let- ding, sometimes you cannot The top 10 Chinese smartphone makers, including Huawei
way ters find out what you need to Technologies Co Ltd and Xiaomi Corp, joined hands on
14 Name tag info 57 Put over high know. Then, my view is to Tuesday to promote technical standards for "fast apps,"
at an alumni heat assume partner has at least which are designed to compete against Tencent Holdings
event 58 IDs that are one valuable asset — a Penny Ltd's mini programs.
20 Big ___ Confer- often not dis- Black! — if he bid at the one-
ence played in full:
Abbr. level, and two useful cards if South quietly gnashed his
23 “Lord, is ___?” 3月20日，华为、 小米等国内十大智能手机厂商联合推
60 G.O.P. org. he competed at the two-lev- teeth, wishing his opponents
24 Arrow part 出“快应用”技术标准， 以对抗腾讯旗下的小程序。
25 Skier’s obstacle 61 Back at sea el. had been much less obstruc- 快应用(fast app)是基于手机硬件平台的新型应用
26 Fathers, to 62 It has a tip for Look at the South hand in tive. When the board was 生态， 用户无需下载安装APP便可以即点即用。从产
babies game-playing today's diagram. He opens originally played, South reb- 品特性来看， 快应用与微信小程序高度相似。与小程
one spade (do you agree?), id five clubs. Surprisingly, 序内置于微信不同的是， 快应用直接与手机操作系统
West overcalls two dia- North did not pass that, but 关联(directly linked to the mobile operating systems of
Comics monds, North makes a nega- bid five spades. Then South phones)。
DILBERT tive double, and East pre- passed.
empts with four diamonds. South was pessimistic.
What should South rebid? Four no-trump would have 快应用技术标准确定后， 开发者在一处上传的某个快
South might have opened been reasonable if it had 应用可在10家厂商的手机上线， 形成统一的快应用门
two clubs — his hand was been regular Blackwood, but 户(fast app portal)。
certainly strong enough. But North would have assumed
if East-West crowded the it was Roman Key Card
auction, it could have been Blackwood in hearts, the suit 除了标准化的发布流程、 完善的开发者文档、 工具及论
very difficult for South to he showed. With that South 坛支持外， 未来，快应用开放平台还会开放开发者服务
describe his hand. One hand, I would have rebid six 支持， 如消息推送(push notifications)、帐号接入
spade at least started South’s clubs. I believe I am not (acount access)、支付接入(payment access)、
story. influenced by knowing the 数据服务(data services)等。
Over four diamonds, whole deal.
F-MINUS
相关词汇
Kakuro
小程序 mini program
快应用 fast app

存储卡 memory card

锂电池 lithium battery

快捷图标 short-cut icon

PEANUTS 全球定位系统 GPS (Global Positioning System)

客户身份识别卡（SIM卡）Subscriber Identity Module

无线局域网 Wireless Local Area Networks (WLANs)

To learn more hot words,

please log on to http://language.chinadaily.com.cn/
A Kakuro consists of a playing area Follow us on weibo at http://weibo.com/languagetips
of filled and empty cells similar to a
crossword puzzle. Some black cells
DRABBLE contain a diagonal slash from top
left to bottom right with numbers in
them, called “clues”. A number in
the top right corner relates to an
“across” clue and one in the bottom
left a “down” clue. The object of a
Kakuro is to insert digits from one
to nine into the white cells to total ChinaDaily 中国日报
the clue associated with it. However Yesterday’s solution 手机报免费体验 双语新闻微信
no digit can be duplicated in an entry.
24
LIFE
Friday, April 13, 2018
CHINA DAILY HONG KONG EDITION
FOOD FOR THOUGHT
Discussions on
restaurants,
eating habits
and cooking
highlight Open
Day events in
Beijing,
Yang Yang
reports.
I know now an
increasing
number of young
Chinese people
try to pursue the
meaning of life
according to
their own will.”
Chuang Tzu-i, author of
Anthropologist in the Kitchen
Hollywood, Bollywood top China holiday box office
By XU FAN
xufan@chinadaily.com.cn
A new box-office record was
created during the recent
Tomb Sweeping Day holiday
in China, with more than 20
new movies contending for
audiences’ attention.
The traditional Chinese holi-
day to remember ancestors,
which lasted from April 5 to 7
this year, raked in 684 million
yuan ($109 million) — a surge
of 17 percent from 586 million
yuan in 2017 — at the box office.
The figure marks a new high
for the annual holiday, accord-
ing to Entgroup, an entertain-
ment-industry tracker.
As a result, Hollywood sci-fi
movie Ready Player One has
made nearly 1 billion yuan
since it was released in China
on March 30, making it Steven
Spielberg’s highest-grossing
film in the country.
Bollywood’s Hindi Medium
soared as a sleeper hit to seize
the second slot at the holiday
box office. The movie is about
a rich couple’s crazy plan to get
their 3-year-old daughter into
a top school, because they
C
huang Tzu-i from
Taiwan was study-
ing anthropology in
the United States
about 12 years ago. One day
the doctoral candidate came
across Cambridge Cookery
School in the neighborhood
of her lodging. Watching
through the window, she
could see a busy class shroud-
ed in steam.
It was the sixth year of her
PhD program when she was
preparing for her final disser-
tation.
In a surprise move, she quit
university and registered as a
student at the cookery school,
a decision unimaginable for
many Chinese, especially a
decade or so ago.
Chuang eventually became
a popular blogger, and her
writings about the experience
at the cookery school and her
observations of kitchen opera-
tions at ritzy restaurants fasci-
nated her online followers. In
2008, she published her first
book, Anthropologist in the
Kitchen.
She shared her stories with
more than 200 audience
members recently at Open
Day, a series of events orga-
nized by Vistopia, a sister
brand of the publishing brand
Imaginist.
“I never regret my seeming-
ly imprudent decision. … In
the last 10 years, what I did has
gradually been understood
and accepted by more people.
I know now an increasing
number of young Chinese peo-
ple try to pursue the meaning
of life according to their own
will,” Chuang says.
Writer Leung Man-tao, who
plans the Open Day events,
says they try to turn abstract
ideas to real experiences.
At this year’s events that ran
through March, participants
enjoyed a selection of food,
music, film, coffee, tea and
chats with people from the
creative industry.
“One (goal) is how to
improve people’s humanistic
education, including how to
think more reasonably about
life, society and the world,”
Leung says of the events.
“The second is about how
to attain a more comprehen-
sive and compassionate sensi-
bility to feel the other’s
existence, and details in ordi-
nary life that are worth dig-
ging into so as to enrich one’s
life.”
Liu Ruilin, the founder of
Imaginist, further explains
believe it is a passport to an
easier life when she grows up.
The themes of education and
parenting seem to have reso-
nated with Chinese parents in
particular.
The Chinese films Wrath of
Silence, a crime noir directed
by rising filmmaker Xin
Yukun, and Light Chaser Ani-
mation’s third feature, Cats
and Peachtopia, recounting a
kitten’s dream, followed
behind the foreign movies at
the box office but were expect-
ed to do better in the remain-
ing days of the month.
The former is an experi-
mental thriller, and the latter
shows the technical progress
made by domestic anima-
tors.
Although faced by two pow-
erful imported rivals, the fol-
lowing weeks could see a
change for other Chinese mov-
ies, too.
Eighteen, or nearly 80 per-
cent of the 23 new movies to
hit mainland theaters by the
end of April, have been pro-
duced by domestic studios.
With the 37th Hong Kong
Film Awards set to unveil its
From left: Writer Leung Man-tao, Chuang Tzu-i and food critic Shu Qiao share their views about the spirit of making delicious food during
the recent Open Day events in Beijing. PHOTOS BY YANG MING / FOR CHINA DAILY
that without a solid physical
life as the foundation, spiritual
products will appear pale and
weak.
Chuang was invited to talk
about the spirit of making
delicious food and enjoying it
with Leung and food critic Shu
Qiao, since food and restau-
rants are an important part of
an ideal life.
“Cooking is a very personal
and relaxing experience, so I
don’t like cooking contests that
try to judge a dish by a single
standard,” Shu says.
Shu has an opinion on res-
taurants, too. She says some
restaurants “make cooking a
show”.
“It makes the food expensive
because the charge includes
the presentation,” she says.
Us and Them (left), starring actor Jing Boran, and Tomorrow Is Another Day (right), featuring Teresa Mo and Ray Lui, are among the new
movies produced by domestic studios to be released later this month in mainland theaters. PHOTOS PROVIDED TO CHINA DAILY
winners on April 15, people
are already talking about
Tomorrow Is Another Day,
because of its four nomina-
tions at the awards. Aside
from Teresa Mo’s nomination
for the best actress, the movie
has been nominated for best
actor, best new performer and
best new director.
The directorial debut of
scriptwriter-turned-filmmak-
er Chan Tai-lee is based on a
true story — a woman’s strug-
Anthropologist
in the Kitchen
by Chuang Tzu-i
Leung says restaurants also
should bear in mind the emo-
tional health of chefs. “Other-
wise, eating would become a
suffering” for the customers,
especially if they realize that
the staff isn’t happy. In such a
case, cooking could become a
way of social alienation even
for professionals, the three
speakers agree.
In the kitchens of some star-
rated Western and Asian res-
taurants, chefs work like
they’re in an army, highly
cooperative and efficient, but
each person performs a single
task, say, cutting fish, boiling
rice or chopping onions,
Chuang says.
In some restaurants, the
employees are not allowed to
talk to each other or listen to
gles while taking care of her
son who has autism and finds
her husband cheating on her
with a young mistress. Tomor-
row Is Another Day will be
released on the mainland on
April 20.
Taiwan singer-actress Liu
Jo-ying, also known as Rene
Liu, will appear on the big
screen for the first time as a
director. Us and Them will be
released on April 28. The mov-
ie starring pop idols Jing
Tea sets are among the objects on show during the Open Day events.
music, making the work envi-
ronment unhappy, she adds.
That’s not to mention, many
cooks have to go to the gym to
Boran and Zhou Dongyu tells
a bittersweet love story about
two people over the course of a
decade.
On Friday, the highly antic-
ipated movies to be released
are Dwayne Johnson’s sci-fi
adventure Rampage and
Natalie Portman’s Annihila-
tion. Japanese animation
Mary and The Witch’s Flower
by director Hiromasa Yone-
bayashi, once a major creator
at the prestigious Studio
keep in shape, Shu says.
But professionalism in
Western cooking has gradual-
ly influenced Chinese restau-
Ghibli, will hit Chinese thea-
ters on April 28.
The rest of April will be a
battleground for domestic
films, which currently out-
number foreign movies.
“April is a bit special as it is
in the middle of two lucrative
box-office seasons — the Tomb
Sweeping Day holiday and the
May Day holiday,” says Jiang
Yong, a Beijing-based trade
analyst, adding that more
market potential for domestic
rants and cookery schools.
Some cooks who graduate
from professional schools still
seem to add too many proc-
essed condiments in dishes,
making them “strong in flavor,
oily and often unhealthy”,
according to Chuang.
“It seems that in the last 30
years, Chinese people in gen-
eral have started to like food
with strong flavors — salty,
oily and spicy, like Sichuan
and Hunan cuisines, both of
which are famous for being
spicy,” Leung says, adding
that even Sichuan cuisine
itself has grown stronger in
flavor.
“People in different cities all
like eating malatang (skew-
ered meat, vegetables and tofu
products boiled in spicy broth
and cooked in a fiery sauce) as
a nighttime snack,” he says.
Shu agrees: “No matter
which tourist spot around the
country you go to, there are
always foods like barbecued
squid or Taiwan sausage. It’s
like all the ancient towns in
China now have a similar
look.”
This is because strong-fla-
vored dishes can be easily rep-
licated everywhere, Chuang
says.
Some major sauce makers
also sponsor cookery schools
and encourage trainers to use
their condiments.
“Which means, as all the fla-
vors are simplified, our
tongues generally lose the sen-
sitivity to different tastes. We
are seeing the same kind of
things and eating the same
kind of food, which can make
our thoughts simple in the
long run,” Leung says.
These days, many people
like to go to popular restau-
rants and post photos on
social media.
“Enjoying the food is not as
important to them as taking
photos and posting them
online,” Leung says.
Shu continues, “People say
that it is a time when people
are given diverse choices, but I
don’t see that.”
People tend to go to the
same places for food or
sightseeing when they visit a
city. Otherwise, they may
feel they’ve missed out, she
adds.
“That’s why we emphasize
sensitivity and diversity with
our events,” Leung says.
Contact the writer at
yangyangs@
chinadaily.com.cn
Many good
low-budget movies
still find it hard to
earn enough
screenings at
theaters.”
Gao Yitian, film producer
films will be created in coming
days.
But Gao Yitian, a veteran
film producer, still has con-
cerns about the Chinese box
office.
“Many good low-budget
movies still find it hard to
earn enough screenings at
theaters, which means audi-
ences can’t easily buy tickets
for such films, even if they
want to watch them,” Gao
says.
 C H I N A DA I LY H O N G KO N G E D I T I O N Friday, April 13, 2018 ANNOUNCEMENT A1

TOWN PLANNING ORDINANCE (Chapter 131)

AMENDMENTS TO THE APPROVED MA TAU KOK OUTLINE ZONING PLAN NO. S/K10/22
In the exercise of the power conferred by section 12(1)(b)(ii) of the Town Planning Ordinance (the Ordinance), the Chief Executive in Council (CE in C) on 7 February 2017 referred the approved Ma Tau Kok Outline Zoning Plan (OZP) No. S/K10/22
(the Plan) to the Town Planning Board (the Board) for amendment.
The Board has made amendments to the Plan. The amendments are set out in the Schedule of Amendments. The descriptions of the areas affected by the amendments in the Schedule of Amendments are for general reference only. The exact locations
RIWKHDUHDVDIIHFWHGE\WKHDPHQGPHQWVDUHPRUHVSHFL¿FDOO\VKRZQRQWKHGUDIW0D7DX.RN2=31R6.
7KHGUDIW0D7DX.RN2=31R6.VKRZLQJWKHDPHQGPHQWVLVH[KLELWHGXQGHUVHFWLRQRIWKH2UGLQDQFHIRUSXEOLFLQVSHFWLRQIRUDSHULRGRIWZRPRQWKVIURP0DUFKWR0D\GXULQJQRUPDORI¿FHKRXUVDWWKHIROORZLQJ
locations:–
(i) WKH6HFUHWDULDWRIWKH7RZQ3ODQQLQJ%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJ
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJ
(iii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ1HZ7HUULWRULHV
(iv) WKH.RZORRQ'LVWULFW3ODQQLQJ2I¿FHWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDQG
(v) WKH.RZORRQ&LW\'LVWULFW2I¿FH/RZHU*URXQG)ORRU.RZORRQ&LW\*RYHUQPHQW2I¿FHV%DLOH\6WUHHW+XQJ+RP.RZORRQ
,QDFFRUGDQFHZLWKVHFWLRQRIWKH2UGLQDQFHDQ\SHUVRQPD\PDNHUHSUHVHQWDWLRQWRWKH%RDUGLQUHVSHFWRIDQ\RIWKHDPHQGPHQWV7KHUHSUHVHQWDWLRQVKRXOGEHPDGHLQZULWLQJWRWKH6HFUHWDU\7RZQ3ODQQLQJ%RDUGWK)ORRU1RUWK3RLQW
*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJQRWODWHUWKDQ0D\
In accordance with section 6(2) of the Ordinance, a representation shall indicate:–
(a) WKHSDUWLFXODUPDWWHULQDQ\RIWKHDPHQGPHQWVWRZKLFKWKHUHSUHVHQWDWLRQUHODWHV
(b) WKHQDWXUHRIDQGUHDVRQVIRUWKHUHSUHVHQWDWLRQDQG
(c) the amendments (if any) proposed to the draft plan.
$Q\UHSUHVHQWDWLRQPDGHWRWKH%RDUGZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQXQGHUVHFWLRQRIWKH2UGLQDQFHXQWLOWKH&(LQ&KDVPDGHDGHFLVLRQLQUHVSHFWRIWKHGUDIWSODQLQTXHVWLRQXQGHUVHFWLRQ$Q\SHUVRQZKRLQWHQGVWRPDNH
UHSUHVHQWDWLRQLVDGYLVHGWRUHDGWKHµ7RZQ3ODQQLQJ%RDUG*XLGHOLQHVRQ6XEPLVVLRQDQG3XEOLFDWLRQRI5HSUHVHQWDWLRQV&RPPHQWVRQ5HSUHVHQWDWLRQVDQG)XUWKHU5HSUHVHQWDWLRQVXQGHUWKH7RZQ3ODQQLQJ2UGLQDQFH¶WKH*XLGHOLQHVIRUGHWDLOV7KH
*XLGHOLQHVDQGWKHVDPSOHVXEPLVVLRQIRUPDUHDYDLODEOHDWORFDWLRQVLWRLLLDERYHDQGWKH%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSE
&RSLHVRIWKHGUDIW0D7DX.RN2=31R6.LQFRUSRUDWLQJWKHDPHQGPHQWVDUHDYDLODEOHRQSD\PHQWRIDIHHDWWKH6XUYH\DQG0DSSLQJ2I¿FH0DS3XEOLFDWLRQV&HQWUH+RQJ.RQJUG)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD
5RDG1RUWK3RLQW+RQJ.RQJDQGWKH6XUYH\DQG0DSSLQJ2I¿FH0DS3XEOLFDWLRQV&HQWUH.RZORRQ*URXQG)ORRU1DWKDQ5RDG.RZORRQ7KHHOHFWURQLFYHUVLRQRIWKHSODQFDQEHYLHZHGDWWKH%RDUG¶VZHEVLWH
Statement on Personal Data
The SHUVRQDOGDWDVXEPLWWHGWRWKH%RDUGLQDQ\UHSUHVHQWDWLRQZLOOEHXVHGE\WKH6HFUHWDU\RIWKH%RDUGDQG*RYHUQPHQWGHSDUWPHQWVIRUWKHIROORZLQJSXUSRVHV
D WKHSURFHVVLQJRIWKHUHSUHVHQWDWLRQZKLFKLQFOXGHVPDNLQJDYDLODEOHWKHQDPHRIWKHSHUVRQPDNLQJWKHUHSUHVHQWDWLRQKHUHDIWHUNQRZQDVµUHSUHVHQWHU¶IRUSXEOLFLQVSHFWLRQZKHQPDNLQJDYDLODEOHWKHUHSUHVHQWDWLRQIRUSXEOLFLQVSHFWLRQDQG
E IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQWKHµUHSUHVHQWHU¶DQGWKH6HFUHWDU\RIWKH%RDUG*RYHUQPHQWGHSDUWPHQWV
LQDFFRUGDQFHZLWKWKHSURYLVLRQVRIWKH2UGLQDQFHDQGWKHUHOHYDQW7RZQ3ODQQLQJ%RDUG*XLGHOLQHV.

SCHEDULE OF AMENDMENTS TO THE APPROVED MA TAU KOK OUTLINE ZONING PLAN NO. S/K10/22
MADE BY THE TOWN PLANNING BOARD
UNDER THE TOWN PLANNING ORDINANCE (Chapter 131)
I. Amendments to Matters shown on the Plan
,WHP$ 5HYLVLRQWRWKHEXLOGLQJKHLJKWUHVWULFWLRQRID³*RYHUQPHQW,QVWLWXWLRQRU&RPPXQLW\´³*,&´VLWHDW/XQJ.RQJ5RDGIURPDQGVWRUH\VWRPHWUHVDERYH3ULQFLSDO'DWXP.
,WHP% 5H]RQLQJRIDVLWHDWWKHMXQFWLRQRI.R6KDQ5RDGDQG6KDQVL6WUHHWIURP³*,&´DQG³5HVLGHQWLDO*URXS$´³5$´DQGDQDUHDVKRZQDVµ5RDG¶WR³5$´ZLWKVWLSXODWLRQRIEXLOGLQJKHLJKWUHVWULFWLRQ.
,WHP& 5H]RQLQJRI6KDQVL6WUHHWIURP³*,&´WRDQDUHDVKRZQDVµ5RDG¶.
,WHP& 5H]RQLQJRIDVWULSRIODQGDORQJ.R6KDQ5RDGIURPDQDUHDVKRZQDVµ5RDG¶WR³5$´.

II. Amendments to the Notes of the Plan

(a) 5HYLVLRQWRWKH5HPDUNVRIWKH1RWHVIRU³5$´]RQHWRLQFRUSRUDWHWKH³5$´]RQH
(b) ,QFRUSRUDWLRQRIµ3XEOLF9HKLFOH3DUNH[FOXGLQJFRQWDLQHUYHKLFOHRQODQGGHVLJQDWHG³5$´RQO\¶DVD&ROXPQXVHLQWKH1RWHVIRU³5$´]RQHDQGFRUUHVSRQGLQJDPHQGPHQWWRUHSODFHµ3XEOLF9HKLFOH3DUNH[FOXGLQJFRQWDLQHU
YHKLFOH¶XQGHU&ROXPQE\µ3XEOLF9HKLFOH3DUNH[FOXGLQJFRQWDLQHUYHKLFOHQRWHOVHZKHUHVSHFL¿HG¶.
(c) 5HYLVLRQWRWKHH[HPSWLRQFODXVHIRUSORWUDWLRJURVVÀRRUDUHDFDOFXODWLRQLQUHODWLRQWRFDUHWDNHUV¶TXDUWHUVDQGUHFUHDWLRQDOIDFLOLWLHVLQWKH5HPDUNVRIWKH1RWHVIRUWKH³&RPSUHKHQVLYH'HYHORSPHQW$UHD´³5$´³5HVLGHQWLDO*URXS%´
³5HVLGHQWLDO*URXS(´]RQHV
(d) ,QFRUSRUDWLRQRIDFODXVHLQWKH5HPDUNVRIWKH1RWHVIRUWKH³5$´]RQHVWDWLQJWKHDSSOLFDWLRQRISORWUDWLRRIWKHH[LVWLQJEXLOGLQJ.

Town Planning Board

0DUFK

AEON STORES (HONG KONG) CO., LIMITED

永 旺（ 香 港 ）百 貨 有 限 公 司
(Incorporated in Hong Kong with limited liability)
(Stock Code: 984)
CLOSURE OF REGISTER OF MEMBERS
The Register of Members of the Company will be closed (i) from 11 May 2018 to 18 May 2018 (both days
inclusive), and (ii) from 7 June 2018 to 8 June 2018 (both days inclusive), during which periods no transfer of
shares will be registered.
By Order of the Board
AEON Stores (Hong Kong) Co., Limited
CHAN Kwong Leung, Eric
Company Secretary

Hong Kong, 13 April 2018

TOWN PLANNING ORDINANCE (Chapter 131)

APPLICATION FOR REVIEW OF SECTION 16 DECISION
In the exercise of the power conferred by section 16(3) of the Town Planning Ordinance (the Ordinance), the Town
Planning Board (the Board) has made a decision on the application(s) made under section 16(1) of the Ordinance as set
out in the Schedule below. In accordance with section 17(1) of the Ordinance, the applicant(s) now applies/apply for
a review of the Board’s decision.
Pursuant to section 17(2A) of the Ordinance, the application(s) for review is/are available for public inspection
GXULQJQRUPDORI¿FHKRXUVDWWKHIROORZLQJORFDWLRQV
(i) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW
Hong Kong; and
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ
New Territories.
In accordance with section 17(2D) of the Ordinance, any person may make comment to the Board in respect of
the review application(s). The comment should state the application number to which the comment relates and should
EHPDGHWRWKH6HFUHWDU\7RZQ3ODQQLQJ%RDUGE\KDQGSRVWWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD
5RDG1RUWK3RLQW+RQJ.RQJID[RURUHPDLOWSESG#SODQGJRYKNRUWKURXJKWKH%RDUG¶V
ZHEVLWHKWWSZZZLQIRJRYKNWSEQRWODWHUWKDQWKHGDWHVSHFL¿HGLQWKH6FKHGXOH
Any person who intends to make comment is advised to read the “Town Planning Board Guidelines on Publication
RI$SSOLFDWLRQVIRU$PHQGPHQWRI3ODQ3ODQQLQJ3HUPLVVLRQDQG5HYLHZDQG6XEPLVVLRQRI&RPPHQWVRQ9DULRXV
Applications under the Town Planning Ordinance” (the Guidelines) for details. The Guidelines are available at the
DERYHORFDWLRQVDQGWKH6HFUHWDULDWRIWKH%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK
Point, Hong Kong) as well as the Board’s website (http://www.info.gov.hk/tpb/).
In accordance with section 17(2G) of the Ordinance, any comment made to the Board will be available for public
LQVSHFWLRQ GXULQJ QRUPDO RI¿FH KRXUV DW ORFDWLRQV L DQG LL DERYH XQWLO WKH %RDUG KDV UHYLHZHG WKH GHFLVLRQ LQ
question under section 17(6).
The gists of the applications (including location plans) can be viewed at the above locations, the Secretariat of the
Board and the Board’s website.
The tentative date of the Board to consider the application has been uploaded to the Board’s website (http://www.
info.gov.hk/tpb/). The meeting for considering planning applications, except the deliberation parts, will be open to the
public. For observation of the meeting, reservation of seat can be made with the Secretariat of the Board by telephone
ID[RURUHPDLOWSESG#SODQGJRYKNDWOHDVWRQHGD\EHIRUHWKHPHHWLQJ6HDWV
ZLOOEHDOORFDWHGRQD¿UVWFRPH¿UVWVHUYHGEDVLV
The paper for consideration of the Board in relation to the application will be available for public inspection after
LVVXHWRWKH%RDUG0HPEHUVDWWKH3ODQQLQJ(QTXLU\&RXQWHUVRIWKH3ODQQLQJ'HSDUWPHQW+RWOLQHDQGDW
WKH3XEOLF9LHZLQJ5RRPRQWKHGD\RIPHHWLQJ
$IWHUWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQHQTXLU\DERXWWKHGHFLVLRQPD\EHPDGHDWWHOQRRU
RUWKHJLVWRIWKHGHFLVLRQFDQEHYLHZHGDWWKH%RDUG¶VZHEVLWHDIWHUWKHPHHWLQJ
Statement on Personal Data
The personal data submitted to the Board in any comment will be used by the Secretary of the Board and Government
departments for the following purposes:
(a) the processing of the application which includes making available the name of the person making the comment
(hereafter known as “commenter”) for public inspection when making available the comment for public inspection;
and
(b) facilitating communication between the “commenter” and the Secretary of the Board/Government departments
in accordance with the provisions of the Ordinance and the relevant Town Planning Board Guidelines.
Schedule
Deadline for Making
Application Subject of the Review made by
Location Comment on the
No. the Applicant
Review Application
$  < /  /RW  53 LQ ''  .XQJ 8P 5HIXVDO RI 3URSRVHG $QLPDO $SULO
7<67 5RDG<XHQ/RQJ1HZ7HUULWRULHV Boarding Establishment

$SULO       7RZQ3ODQQLQJ%RDUG

A2 ANNOUNCEMENT Friday, April 13, 2018 C H I N A DA I LY H O N G KO N G E D I T I O N

TOWN PLANNING ORDINANCE (Chapter 131)
DRAFT SIU HO WAN OUTLINE ZONING PLAN NO. S/I-SHW/1
Pursuant to section 5 of the Town Planning Ordinance (the Ordinance), the draft Siu Ho Wan Outline Zoning Plan
No. S/I-SHW/1 prepared by the Town Planning Board (the Board) is exhibited for public inspection for a period of two
PRQWKVIURP0DUFKWR0D\GXULQJQRUPDORI¿FHKRXUVDWWKHIROORZLQJORFDWLRQV QRUPDORI¿FHKRXUVDWWKHIROORZLQJORFDWLRQV
(i) WKH6HFUHWDULDWRIWKH7RZQ3ODQQLQJ%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG
North Point, Hong Kong;
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW
Hong Kong;
(iii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ
New Territories;
(iv) WKH6DL.XQJDQG,VODQGV'LVWULFW3ODQQLQJ2I¿FHWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R
TOWN PLANNING ORDINANCE (Chapter 131)
APPLICATION FOR AMENDMENT OF PLAN
Pursuant to section 12A(6) of the Town Planning Ordinance (the Ordinance), the application(s) for amendment of plan
made under section 12A(1) of the Ordinance as set out in the Schedule below are available for public inspection during
(i) WKH 3ODQQLQJ (QTXLU\ &RXQWHU WK )ORRU 1RUWK 3RLQW *RYHUQPHQW 2I¿FHV  -DYD 5RDG 1RUWK 3RLQW
Hong Kong; and
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ
New Territories.
In accordance with section 12A(9) of the Ordinance, any person may make comment to the Town Planning Board
(the Board) in respect of the application(s). The comment should state the application number to which the comment
relates and should be made to the Secretary, Town Planning Board by hand, post (15th Floor, North Point Government
&KH5RDG6KD7LQ1HZ7HUULWRULHV 2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJID[RURUHPDLOWSESG#SODQGJRYKNRU
WKURXJKWKH%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSEQRWODWHUWKDQWKHGDWHVSHFL¿HGLQWKH6FKHGXOH
(v) WKH,VODQGV'LVWULFW2I¿FHWK)ORRU+DUERXU%XLOGLQJ3LHU5RDG&HQWUDO+RQJ.RQJ
Any person who intends to make comment is advised to read the “Town Planning Board Guidelines on Publication
(vi) WKH ,VODQGV 'LVWULFW 2I¿FH 0XL :R 6XERI¿FH *URXQG )ORRU 0XL :R *RYHUQPHQW 2I¿FHV  1JDQ RI$SSOLFDWLRQVIRU$PHQGPHQWRI3ODQ3ODQQLQJ3HUPLVVLRQDQG5HYLHZDQG6XEPLVVLRQRI&RPPHQWVRQ9DULRXV
.ZRQJ:DQ5RDG0XL:R/DQWDX,VODQG Applications under the Town Planning Ordinance” (the Guidelines) for details. The Guidelines are available at the
(vii) WKH,VODQGV'LVWULFW2I¿FH7XQJ&KXQJ6XERI¿FHVW)ORRU7XQJ&KXQJ3RVW2I¿FH%XLOGLQJ0HL DERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW
7XQJ6WUHHW7XQJ&KXQJ/DQWDX,VODQGDQG Hong Kong) as well as the Board’s website (http://www.info.gov.hk/tpb/).
(viii) WKH7VXHQ:DQ'LVWULFW2I¿FHVW)ORRU7VXHQ:DQ0XOWLVWRUH\&DUSDUN%XLOGLQJ&DVWOH3HDN In accordance with section 12A(12) of the Ordinance, any comment made to the Board will be available for public
5RDG7VXHQ:DQ1HZ7HUULWRULHV LQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWORFDWLRQVLDQGLLDERYHXQWLOWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQVLQ
,QDFFRUGDQFHZLWKVHFWLRQRIWKH2UGLQDQFHDQ\SHUVRQPD\PDNHUHSUHVHQWDWLRQWRWKH%RDUGLQUHVSHFWRI question under section 12A(16).
the draft plan. The representation should be made in writing to the Secretary, Town Planning Board, 15th Floor, North The gists of the applications (including location plans) can be viewed at the above locations, the Secretariat of the
3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJQRWODWHUWKDQ0D\ Board and the Board’s website.
,QDFFRUGDQFHZLWKVHFWLRQRIWKH2UGLQDQFHDUHSUHVHQWDWLRQVKDOOLQGLFDWH± The tentative date of the Board to consider the application has been uploaded to the Board’s website (http://www.
(a) the particular matter in the draft plan to which the representation relates; LQIRJRYKNWSE7KHPHHWLQJIRUFRQVLGHULQJSODQQLQJDSSOLFDWLRQVH[FHSWWKHGHOLEHUDWLRQSDUWVZLOOEHRSHQWRWKH
public. For observation of the meeting, reservation of seat can be made with the Secretariat of the Board by telephone
(b) the nature of and reasons for the representation; and ID[RURUHPDLOWSESG#SODQGJRYKNDWOHDVWRQHGD\EHIRUHWKHPHHWLQJ6HDWV
(c) the amendments (if any) proposed to the draft plan. ZLOOEHDOORFDWHGRQD¿UVWFRPH¿UVWVHUYHGEDVLV
$Q\UHSUHVHQWDWLRQPDGHWRWKH%RDUGZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQXQGHUVHFWLRQRIWKH2UGLQDQFH The paper for consideration of the Board in relation to the application will be available for public inspection after
until the Chief Executive in Council has made a decision in respect of the draft plan in question under section 9. Any
SHUVRQZKRLQWHQGVWRPDNHUHSUHVHQWDWLRQLVDGYLVHGWRUHDGWKH³7RZQ3ODQQLQJ%RDUG*XLGHOLQHVRQ6XEPLVVLRQDQG
3XEOLFDWLRQRI5HSUHVHQWDWLRQV&RPPHQWVRQ5HSUHVHQWDWLRQVDQG)XUWKHU5HSUHVHQWDWLRQVXQGHUWKH7RZQ3ODQQLQJ
Ordinance” (the Guidelines) for details. The Guidelines and the sample submission form are available at locations (i)
to (iii) above and the Board’s website (KWWSZZZLQIRJRYKNWSE).
Copies of the draft Siu Ho Wan Outline Zoning Plan No. S/I-SHW/1 are available on payment of a fee at the
LVVXHWRWKH%RDUG0HPEHUVDWWKH3ODQQLQJ(QTXLU\&RXQWHUVRIWKH3ODQQLQJ'HSDUWPHQW+RWOLQHDQGDW
WKH3XEOLF9LHZLQJ5RRPRQWKHGD\RIPHHWLQJ
$IWHUWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQHQTXLU\DERXWWKHGHFLVLRQPD\EHPDGHDWWHOQRRU
RUWKHJLVWRIWKHGHFLVLRQFDQEHYLHZHGDWWKH%RDUG¶VZHEVLWHDIWHUWKHPHHWLQJ
Statement on Personal Data
6XUYH\DQG0DSSLQJ2I¿FH0DS3XEOLFDWLRQV&HQWUH+RQJ.RQJUG)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV The personal data submitted to the Board in any comment will be used by the Secretary of the Board and Government
 -DYD5RDG1RUWK3RLQW+RQJ.RQJDQGWKH6XUYH\DQG0DSSLQJ2I¿FH0DS3XEOLFDWLRQV&HQWUH.RZORRQ departments for the following purposes:
*URXQG)ORRU1DWKDQ5RDG.RZORRQ7KHHOHFWURQLFYHUVLRQRIWKHSODQFDQEHYLHZHGDWWKH%RDUG¶VZHEVLWH (a) the processing of the application which includes making available the name of the person making the comment
The location of the planning area covered by the draft plan is shown on the location plan attached hereto. The (hereafter known as "commenter") for public inspection when making available the comment for public inspection;
ORFDWLRQSODQLVIRULGHQWL¿FDWLRQSXUSRVHVRQO\DQGWKHGUDIWSODQVKRXOGEHUHIHUUHGWRIRUGHWDLOV. and
Statement on Personal Data (b) facilitating communication between the "commenter" and the Secretary of the Board/Government departments
The personal data submitted to the Board in any representation will be used by the Secretary of the Board and in accordance with the provisions of the Ordinance and the relevant Town Planning Board Guidelines.
*RYHUQPHQWGHSDUWPHQWVIRUWKHIROORZLQJSXUSRVHV Schedule
D WKH SURFHVVLQJ RI WKH UHSUHVHQWDWLRQ ZKLFK LQFOXGHV PDNLQJ DYDLODEOH WKH QDPH RI WKH SHUVRQ PDNLQJ WKH Deadline for
UHSUHVHQWDWLRQKHUHDIWHUNQRZQDV³UHSUHVHQWHU´IRUSXEOLFLQVSHFWLRQZKHQPDNLQJDYDLODEOHWKHUHSUHVHQWDWLRQ Application
Location Proposed Amendment Making Comment
for public inspection; and No.
on the Application
E IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQWKH³UHSUHVHQWHU´DQGWKH6HFUHWDU\RIWKH%RDUG*RYHUQPHQWGHSDUWPHQWV Y/TM/21 Yan Oi Town Square, Tuen To rezone the application site from "Open 0D\
in accordance with the provisions of the Ordinance and the relevant Town Planning Board Guidelines. Mun Space" to "Government, Institution or
Community (2)"
Town Planning Board
$SULO       7RZQ3ODQQLQJ%RDUG
29 March 2018
 C H I N A DA I LY H O N G KO N G E D I T I O N Friday, April 13, 2018 ANNOUNCEMENT A3

TOWN PLANNING ORDINANCE (Chapter 131)

APPLICATION FOR PLANNING PERMISSION
Pursuant WRVHFWLRQ'RIWKH7RZQ3ODQQLQJ2UGLQDQFHWKH2UGLQDQFHWKHSODQQLQJDSSOLFDWLRQVPDGHXQGHUVHFWLRQRIWKH2UGLQDQFHDVVHWRXWLQWKH6FKHGXOHEHORZDUHDYDLODEOHIRUSXEOLFLQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWWKHIROORZLQJ
locations -
(i) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDQG
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ1HZ7HUULWRULHV
,QDFFRUGDQFHZLWKVHFWLRQ)RIWKH2UGLQDQFHDQ\SHUVRQPD\PDNHFRPPHQWWRWKH7RZQ3ODQQLQJ%RDUGWKH%RDUGLQUHVSHFWRIWKHDSSOLFDWLRQV7KHFRPPHQWVKRXOGVWDWHWKHDSSOLFDWLRQQXPEHUWRZKLFKWKHFRPPHQWUHODWHVDQGVKRXOG
EHPDGHWRWKH6HFUHWDU\7RZQ3ODQQLQJ%RDUGE\KDQGSRVWWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJID[RURUHPDLOWSESG#SODQGJRYKNRUWKURXJKWKH%RDUG¶VZHEVLWHKWWS
ZZZLQIRJRYKNWSEQRWODWHUWKDQWKHGDWHVSHFL¿HGLQWKH6FKHGXOH
$Q\SHUVRQZKRLQWHQGVWRPDNHFRPPHQWLVDGYLVHGWRUHDGWKH³7RZQ3ODQQLQJ%RDUG*XLGHOLQHVRQ3XEOLFDWLRQRI$SSOLFDWLRQVIRU$PHQGPHQWRI3ODQ3ODQQLQJ3HUPLVVLRQDQG5HYLHZDQG6XEPLVVLRQRI&RPPHQWVRQ9DULRXV$SSOLFDWLRQV
XQGHUWKH7RZQ3ODQQLQJ2UGLQDQFH´WKH*XLGHOLQHVIRUGHWDLOV7KH*XLGHOLQHVDUHDYDLODEOHDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDVZHOODVWKH
%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSE
,QDFFRUGDQFHZLWKVHFWLRQ,RIWKH2UGLQDQFHDQ\FRPPHQWPDGHWRWKH%RDUGZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWORFDWLRQVLDQGLLDERYHXQWLOWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQLQTXHVWLRQXQGHU
VHFWLRQ
7KHJLVWVRIWKHDSSOLFDWLRQVLQFOXGLQJORFDWLRQSODQVFDQEHYLHZHGDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGDQGWKH%RDUG¶VZHEVLWH
7KHWHQWDWLYHGDWHRIWKH%RDUGWRFRQVLGHUWKHDSSOLFDWLRQKDVEHHQXSORDGHGWRWKH%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSE7KHPHHWLQJIRUFRQVLGHULQJSODQQLQJDSSOLFDWLRQVH[FHSWWKHGHOLEHUDWLRQSDUWVZLOOEHRSHQWRWKHSXEOLF)RU
REVHUYDWLRQRIWKHPHHWLQJUHVHUYDWLRQRIVHDWFDQEHPDGHZLWKWKH6HFUHWDULDWRIWKH%RDUGE\WHOHSKRQHID[RURUHPDLOWSESG#SODQGJRYKNDWOHDVWRQHGD\EHIRUHWKHPHHWLQJ6HDWVZLOOEHDOORFDWHGRQD¿UVW
FRPH¿UVWVHUYHGEDVLV
7KHSDSHUIRUFRQVLGHUDWLRQRIWKH%RDUGLQUHODWLRQWRWKHDSSOLFDWLRQZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQDIWHULVVXHWRWKH%RDUG0HPEHUVDWWKH3ODQQLQJ(QTXLU\&RXQWHUVRIWKH3ODQQLQJ'HSDUWPHQW+RWOLQHDQGDWWKH3XEOLF9LHZLQJ
5RRPRQWKHGD\RIPHHWLQJ
$IWHUWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQHQTXLU\DERXWWKHGHFLVLRQPD\EHPDGHDWWHOQRRURUWKHJLVWRIWKHGHFLVLRQFDQEHYLHZHGDWWKH%RDUG¶VZHEVLWHDIWHUWKHPHHWLQJ
Statement on Personal Data
7KHSHUVRQDOGDWDVXEPLWWHGWRWKH%RDUGLQDQ\FRPPHQWZLOOEHXVHGE\WKH6HFUHWDU\RIWKH%RDUGDQG*RYHUQPHQWGHSDUWPHQWVIRUWKHIROORZLQJSXUSRVHV
D WKHSURFHVVLQJRIWKHDSSOLFDWLRQZKLFKLQFOXGHVPDNLQJDYDLODEOHWKHQDPHRIWKHSHUVRQPDNLQJWKHFRPPHQWKHUHDIWHUNQRZQDV³FRPPHQWHU´IRUSXEOLFLQVSHFWLRQZKHQPDNLQJDYDLODEOHWKHFRPPHQWIRUSXEOLFLQVSHFWLRQDQG
(b) IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQWKH³FRPPHQWHU´DQGWKH6HFUHWDU\RIWKH%RDUG*RYHUQPHQWGHSDUWPHQWV
LQDFFRUGDQFHZLWKWKHSURYLVLRQVRIWKH2UGLQDQFHDQGWKHUHOHYDQW7RZQ3ODQQLQJ%RDUG*XLGHOLQHV
Schedule
Deadline for
Application No. Location Applied Use / Development Making Comment
on the Application
$1(/<7 /RWV6(3DUW6)533DUWDQG533DUWLQ'')DQOLQJ1HZ7HUULWRULHV 7HPSRUDU\ 2SHQ 6WRUDJH RI 5HF\FODEOH 3URGXFWV DQG$QFLOODU\:RUNVKRS IRU D 3HULRG RI  $SULO
<HDUV
$1(/<7 /RWLQ''.ZDQ7HL7VXHQ)DQOLQJ1HZ7HUULWRULHV 3URSRVHG7HPSRUDU\3ULYDWH9HKLFOH3DUNIRUD3HULRGRI<HDUV $SULO
$</.76 /RW3DUWLQ''0D2Q.RQJ.DP7LQ<XHQ/RQJ 7HPSRUDU\2SHQ6WRUDJHRI&RQVWUXFWLRQ0DWHULDOVDQG0DFKLQHULHVIRUD3HULRGRI<HDUV $SULO
$</170 /RWV3DUW3DUW3DUWDQG533DUWLQ''DQG$GMRLQLQJ*RYHUQPHQW/DQG 7HPSRUDU\)LVK)DUPLQJIRUD3HULRGRI<HDUV $SULO
1JDX7DP0HL<XHQ/RQJ
$+ 0LQJ:DK'DL+D$.XQJ1JDP5RDG6KDX.HL:DQ+RQJ.RQJ 3URSRVHG FRPSUHKHQVLYH UHGHYHORSPHQW RI 0LQJ :DK 'DL +D LQFOXGLQJ ÀDWV VKRS DQG 0D\
services, and social welfare facilities)
$1()7$ /RWV533DUW533DUW533DUW6)3DUW3DUWDQG6%3DUWLQ''6KD 3URSRVHG7HPSRUDU\3XEOLF9HKLFOH3DUNIRUD3HULRGRI<HDUV 0D\
/LQJ6KHXQJ6KXL1HZ7HUULWRULHV
$1(./+ *RYHUQPHQW/DQGLQ''.DX/XQJ+DQJ9LOODJH.DX/XQJ+DQJ7DL3R 3URSRVHG+RXVH1HZ7HUULWRULHV([HPSWHG+RXVH6PDOO+RXVH 0D\
$6.3. /RWV6$536$DQG53LQ''6KD.RN0HL6DL.XQJ1HZ7HUULWRULHV 3URSRVHG7ZR+RXVHV1HZ7HUULWRULHV([HPSWHG+RXVHV 0D\
$73 *RYHUQPHQW/DQGLQ''.DP6KHN1HZ9LOODJH7DL3R 7HPSRUDU\(DWLQJ3ODFH2XWVLGH6HDWLQJ$FFRPPRGDWLRQRID5HVWDXUDQWIRUD3HULRGRI 0D\
<HDUV
$</.71 /RWV67686%VVDQG6%VVLQ''6KHN.RQJ6DQ7VXHQ.DP7LQ5RDG 5HQHZDO RI 3ODQQLQJ $SSURYDO IRU 7HPSRUDU\ 2SHQ 6WRUDJH RI &RQVWUXFWLRQ 0DFKLQHU\ 0D\
.DP7LQ<XHQ/RQJ 3ULYDWH9HKLFOHVDQG9HKLFOH3DUWVIRUD3HULRGRI<HDUV
$</.76 /RW3DUWLQ''.DP7LQ<XHQ/RQJ 3URSRVHG7HPSRUDU\6KRSDQG6HUYLFHV0DUWLDO$UW*RRGV5HWDLO6WRUHIRUD3HULRGRI<HDUV 0D\
$</.76 /RWV3DUW3DUW3DUW3DUWDQG3DUWLQ''DQG$GMRLQLQJ*RYHUQPHQW/DQG 7HPSRUDU\:DUHKRXVHIRU6WRUDJHRI'UDLQDJH3LSHVZLWK$QFLOODU\6LWH2I¿FHIRUD3HULRG 0D\
.DP7LQ<XHQ/RQJ RI<HDUV
$</3+ /RWLQ''3DW+HXQJ<XHQ/RQJ 3URSRVHG7HPSRUDU\3ODFHRI5HFUHDWLRQ6SRUWVRU&XOWXUH+REE\)DUPIRUD3HULRGRI 0D\
<HDUV
$</7<67 /RWV3DUW3DUW3DUW3DUWDQG3DUWLQ''DQG$GMRLQLQJ*RYHUQPHQW 5HQHZDORI3ODQQLQJ$SSURYDOIRU7HPSRUDU\6KRS*URFHU\6WRUHIRUD3HULRGRI<HDUV 0D\
/DQG3DN6KD7VXHQ<XHQ/RQJ1HZ7HUULWRULHV

$SULO Town Planning Board

TOWN PLANNING ORDINANCE (Chapter 131)

APPLICATION FOR PLANNING PERMISSION
SUBMISSION OF FURTHER INFORMATION
Pursuant to section 16(2D)(b) of the Town Planning Ordinance (the Ordinance), the Town Planning Board (the Board) has published newspaper notice(s) of the planning application(s) made under section 16(1) of the Ordinance as set out in the Schedule
below. Pursuant to section 16(2K) of the Ordinance, the Board has accepted further information from the applicant(s) to supplement the information included in the application(s). The further information is now available for public inspection during
QRUPDORI¿FHKRXUVDWWKHIROORZLQJORFDWLRQV
(i) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDQG
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ1HZ7HUULWRULHV
In accordance with sections 16(2K)(c) and 16(2F) of the Ordinance, any person may make comment to the Board in respect of the further information. The comment should state the application number to which the comment relates and should be
PDGHWRWKH6HFUHWDU\7RZQ3ODQQLQJ%RDUGE\KDQGSRVWWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJID[RURUHPDLOWSESG#SODQGJRYKNRUWKURXJKWKH%RDUG¶VZHEVLWHKWWS
ZZZLQIRJRYKNWSEQRWODWHUWKDQWKHGDWHVSHFL¿HGLQWKH6FKHGXOH
$Q\SHUVRQZKRLQWHQGVWRPDNHFRPPHQWLVDGYLVHGWRUHDGWKH³7RZQ3ODQQLQJ%RDUG*XLGHOLQHVRQ3XEOLFDWLRQRI$SSOLFDWLRQVIRU$PHQGPHQWRI3ODQ3ODQQLQJ3HUPLVVLRQDQG5HYLHZDQG6XEPLVVLRQRI&RPPHQWVRQ9DULRXV$SSOLFDWLRQV
XQGHUWKH7RZQ3ODQQLQJ2UGLQDQFH´WKH*XLGHOLQHVIRUGHWDLOV7KH*XLGHOLQHVDUHDYDLODEOHDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDVZHOODVWKH
%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSE
,QDFFRUGDQFHZLWKVHFWLRQV.FDQG,RIWKH2UGLQDQFHDQ\FRPPHQWPDGHWRWKH%RDUGZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWORFDWLRQVLDQGLLDERYHXQWLOWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQLQ
TXHVWLRQXQGHUVHFWLRQ
7KHJLVWVRIWKHDSSOLFDWLRQVLQFOXGLQJORFDWLRQSODQVFDQEHYLHZHGDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGDQGWKH%RDUG¶VZHEVLWH
7KHWHQWDWLYHGDWHRIWKH%RDUGWRFRQVLGHUWKHDSSOLFDWLRQKDVEHHQXSORDGHGWRWKH%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSE7KHPHHWLQJIRUFRQVLGHULQJSODQQLQJDSSOLFDWLRQVH[FHSWWKHGHOLEHUDWLRQSDUWVZLOOEHRSHQWRWKHSXEOLF)RU
REVHUYDWLRQRIWKHPHHWLQJUHVHUYDWLRQRIVHDWFDQEHPDGHZLWKWKH6HFUHWDULDWRIWKH%RDUGE\WHOHSKRQHID[RURUHPDLOWSESG#SODQGJRYKNDWOHDVWRQHGD\EHIRUHWKHPHHWLQJ6HDWVZLOOEHDOORFDWHGRQD¿UVW
FRPH¿UVWVHUYHGEDVLV
7KHSDSHUIRUFRQVLGHUDWLRQRIWKH%RDUGLQUHODWLRQWRWKHDSSOLFDWLRQZLOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQDIWHULVVXHWRWKH%RDUG0HPEHUVDWWKH3ODQQLQJ(QTXLU\&RXQWHUVRIWKH3ODQQLQJ'HSDUWPHQW+RWOLQHDQGDWWKH3XEOLF9LHZLQJ
5RRPRQWKHGD\RIPHHWLQJ
$IWHUWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQHQTXLU\DERXWWKHGHFLVLRQPD\EHPDGHDWWHOQRRURUWKHJLVWRIWKHGHFLVLRQFDQEHYLHZHGDWWKH%RDUG¶VZHEVLWHDIWHUWKHPHHWLQJ
Statement on Personal Data
7KHSHUVRQDOGDWDVXEPLWWHGWRWKH%RDUGLQDQ\FRPPHQWZLOOEHXVHGE\WKH6HFUHWDU\RIWKH%RDUGDQG*RYHUQPHQWGHSDUWPHQWVIRUWKHIROORZLQJSXUSRVHV
D WKHSURFHVVLQJRIWKHDSSOLFDWLRQZKLFKLQFOXGHVPDNLQJDYDLODEOHWKHQDPHRIWKHSHUVRQPDNLQJWKHFRPPHQWKHUHDIWHUNQRZQDV³FRPPHQWHU´IRUSXEOLFLQVSHFWLRQZKHQPDNLQJDYDLODEOHWKHFRPPHQWIRUSXEOLFLQVSHFWLRQDQG
E IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQWKH³FRPPHQWHU´DQGWKH6HFUHWDU\RIWKH%RDUG*RYHUQPHQWGHSDUWPHQWV
in accordance with the provisions of the Ordinance and the relevant Town Planning Board Guidelines.
Schedule
Deadline for Making
Applied Use/ Further
Application No. Location Comment on the
Development Information
Further Information
$6.6.7 +RQJ7LQJ5RDG6DL.XQJ1HZ7HUULWRULHV 3URSRVHG :KROHVDOH &RQYHUVLRQ RI ([LVWLQJ ,QGXVWULDO 7KH DSSOLFDQW VXEPLWWHG QHZ :DWHU 6XSSO\ ,PSDFW $VVHVVPHQW UHYLVHG 7UDI¿F ,PSDFW $SULO
Building for Private School $VVHVVPHQWUHYLVHG6HZHUDJH,PSDFW$VVHVVPHQWUHYLVHG4XDQWLWDWLYH5LVN$VVHVVPHQWV
revised Environmental Assessment, and responses to departmental comments.
$73 /RWV6&VV6'DQG6(LQ'' 3URSRVHG +RXVH 1HZ7HUULWRULHV ([HPSWHG +RXVH  6PDOO 7KHDSSOLFDQWVXEPLWWHG*HRWHFKQLFDO3ODQQLQJ5HYLHZ5HSRUWLQUHVSRQVHWRGHSDUWPHQWDO $SULO
6DQ8N.D9LOODJH7DL3R +RXVH comments.
$. &DVWOH3HDN5RDG.RZORRQ 3URSRVHG6KRSDQG6HUYLFHV(DWLQJ3ODFH2I¿FHDQG6FKRRO 7KHDSSOLFDQWRQDQGVXEPLWWHGIXUWKHULQIRUPDWLRQLQFOXGLQJ 0D\
&RRNHU\UHODWHG a table of responses to departmental comments, a revised Sewerage Impact Assessment,
XSGDWHG SKRWRPRQWDJHV DQG VXSSOHPHQWDU\ LQIRUPDWLRQ WR WKH7UDI¿F ,PSDFW$VVHVVPHQW
report.

$SULO                   7RZQ3ODQQLQJ%RDUG
A4 ANNOUNCEMENT
TOWN PLANNING ORDINANCE (Chapter 131)
REPRESENTATION IN RESPECT OF DRAFT PLAN
Pursuant to section 6(1) of the Town Planning Ordinance (the Ordinance), the
Town Planning Board (the Board) has received representation(s) in respect of
the plan(s) as set out in the Schedule. In accordance with section 6(4) of the
Ordinance, the representation(s) are available for public inspection during
QRUPDORI¿FHKRXUVDWWKHIROORZLQJORFDWLRQV
(i) the Planning Enquiry Counter, 17th Floor, North Point Government
2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDQG
(ii) the Planning Enquiry Counter, 14th Floor, Sha Tin Government
2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ1HZ7HUULWRULHV
Friday, April 13, 2018 C H I N A DA I LY H O N G KO N G E D I T I O N
TOWN PLANNING ORDINANCE (Chapter 131)
APPLICATION FOR AMENDMENT OF PLAN
SUBMISSION OF FURTHER INFORMATION
Pursuant to section 12A(7)(b) of the Town Planning Ordinance (the Ordinance), the Town Planning Board (the Board) has published newspaper notice(s) of the
application(s) for amendment of plan made under section 12A(1) of the Ordinance as set out in the Schedule below. Pursuant to section 12A(14) of the Ordinance,
the Board has accepted further information from the applicant(s) to supplement the information included in the application(s). The further information is now
DYDLODEOHIRUSXEOLFLQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWWKHIROORZLQJORFDWLRQV±
(i) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDQG
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ1HZ7HUULWRULHV
In accordance with sections 12A(14)(c) and 12A(9) of the Ordinance, any person may make comment to the Board in respect of the further information. The
comment should state the application number to which the comment relates and should be made to the Secretary, Town Planning Board by hand, post (15th Floor,
In accordance with section 6A(1) of the Ordinance, any person may 1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJID[RURUHPDLOWSESG#SODQGJRYKNRUWKURXJKWKH%RDUG¶V
make comment to the Board in respect of the representation(s). The comment ZHEVLWHKWWSZZZLQIRJRYKNWSEQRWODWHUWKDQWKHGDWHVSHFL¿HGLQWKH6FKHGXOH
should indicate the representation to which the comment relates and should Any person who intends to make comment is advised to read the “Town Planning Board Guidelines on Publication of Applications for Amendment of Plan,
be made to the Secretary, Town Planning Board by hand, post (15th Floor, 3ODQQLQJ3HUPLVVLRQDQG5HYLHZDQG6XEPLVVLRQRI&RPPHQWVRQ9DULRXV$SSOLFDWLRQVXQGHUWKH7RZQ3ODQQLQJ2UGLQDQFH´WKH*XLGHOLQHVIRUGHWDLOV7KH
1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJ *XLGHOLQHVDUHDYDLODEOHDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJ
ID[RURUHPDLOWSESG#SODQGJRYKNRUWKURXJK DVZHOODVWKH%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSE
the Board’s website (http://www.info.gov.hk/tpb/) not later than the date
VSHFL¿HGLQWKH6FKHGXOH In accordance with sections 12A(14)(c) and 12A(12) of the Ordinance, any comment made to the Board will be available for public inspection during normal
RI¿FHKRXUVDWORFDWLRQVLDQGLLDERYHXQWLOWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQLQTXHVWLRQXQGHUVHFWLRQ$
Any person who intends to make comment is advised to read the “Town
3ODQQLQJ%RDUG*XLGHOLQHVRQ6XEPLVVLRQDQG3XEOLFDWLRQRI5HSUHVHQWDWLRQV 7KHJLVWVRIWKHDSSOLFDWLRQVLQFOXGLQJORFDWLRQSODQVFDQEHYLHZHGDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGDQGWKH%RDUG¶VZHEVLWH
&RPPHQWVRQ5HSUHVHQWDWLRQVDQG)XUWKHU5HSUHVHQWDWLRQVXQGHUWKH7RZQ 7KH WHQWDWLYH GDWH RI WKH %RDUG WR FRQVLGHU WKH DSSOLFDWLRQ KDV EHHQ XSORDGHG WR WKH %RDUG¶V ZHEVLWH KWWSZZZLQIRJRYKNWSE  7KH PHHWLQJ IRU
Planning Ordinance” (the Guidelines) for details. The Guidelines and sample FRQVLGHULQJSODQQLQJDSSOLFDWLRQVH[FHSWWKHGHOLEHUDWLRQSDUWVZLOOEHRSHQWRWKHSXEOLF)RUREVHUYDWLRQRIWKHPHHWLQJUHVHUYDWLRQRIVHDWFDQEHPDGHZLWK
submission form are available at the above locations, the Secretariat of the WKH6HFUHWDULDWRIWKH%RDUGE\WHOHSKRQHID[RURUHPDLOWSESG#SODQGJRYKNDWOHDVWRQHGD\EHIRUHWKHPHHWLQJ6HDWV
%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK ZLOOEHDOORFDWHGRQD¿UVWFRPH¿UVWVHUYHGEDVLV
3RLQW+RQJ.RQJDVZHOODVWKH%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKN The paper for consideration of the Board in relation to the application will be available for public inspection after issue to the Board Members at the Planning
tpb/). (QTXLU\&RXQWHUVRIWKH3ODQQLQJ'HSDUWPHQW+RWOLQHDQGDWWKH3XEOLF9LHZLQJ5RRPRQWKHGD\RIPHHWLQJ
In accordance with section 6A(4) of the Ordinance, any comment made $IWHUWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQHQTXLU\DERXWWKHGHFLVLRQPD\EHPDGHDWWHOQRRURUWKHJLVWRIWKHGHFLVLRQFDQEH
to the Board under section 6A(1) will be available for public inspection during YLHZHGDWWKH%RDUG¶VZHEVLWHDIWHUWKHPHHWLQJ
QRUPDORI¿FHKRXUVDWORFDWLRQVLDQGLLDERYHXQWLOWKH&KLHI([HFXWLYH
in Council has made a decision in respect of the draft plan in question under Statement on Personal Data
section 9. The personal data submitted to the Board in any comment will be used by the Secretary of the Board and Government departments for the following purposes:
Copies of the concerned draft plan(s) are available on payment of a fee D WKHSURFHVVLQJRIWKHDSSOLFDWLRQZKLFKLQFOXGHVPDNLQJDYDLODEOHWKHQDPHRIWKHSHUVRQPDNLQJWKHFRPPHQWKHUHDIWHUNQRZQDV³FRPPHQWHU´IRUSXEOLF
DWWKH6XUYH\DQG0DSSLQJ2I¿FH0DS3XEOLFDWLRQV&HQWUH+RQJ.RQJ LQVSHFWLRQZKHQPDNLQJDYDLODEOHWKHFRPPHQWIRUSXEOLFLQVSHFWLRQDQG
UG )ORRU 1RUWK 3RLQW *RYHUQPHQW 2I¿FHV  -DYD 5RDG 1RUWK 3RLQW E IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQWKH³FRPPHQWHU´DQGWKH6HFUHWDU\RIWKH%RDUG*RYHUQPHQWGHSDUWPHQWV
+RQJ.RQJDQGWKH6XUYH\DQG0DSSLQJ2I¿FH0DS3XEOLFDWLRQV&HQWUH
.RZORRQ *URXQG )ORRU  1DWKDQ 5RDG .RZORRQ  7KH HOHFWURQLF in accordance with the provisions of the Ordinance and the relevant Town Planning Board Guidelines.
version of the plan(s) can be viewed at the Board’s website.
Schedule
Statement on Personal Data
Deadline for
The personal data submitted to the Board in any comment will be used by Application No. Location Proposed Amendment Further Information Making Comment
the Secretary of the Board and Government departments for the following on the Application
purposes: <67 /RWVDQG53LQ'' To rezone the application $PHQGPHQW WR PD[LPXP SORW UDWLR UHVWULFWLRQ 0D\
(a) the processing of the comment which includes making available the name 7XQJ/R:DQ+LOO5RDG site from "Green Belt", IURP  WR  DQG PD[LPXP EXLOGLQJ KHLJKW
of the person making the comment (hereafter known as “commenter”) Sha Tin "Government, Institution or UHVWULFWLRQIURPP3'WRP3'WRWKHSURSRVHG
for public inspection when making available the comment for public &RPPXQLW\ WR 5HVLGHQWLDO 5HVLGHQWLDO *URXS %  ]RQH ZLWK VXEPLVVLRQ RI
LQVSHFWLRQDQG (Group B) 4" revised technical assessment reports and responses to
Government departmental and public comments.
(b) facilitating communication between the “commenter” and the Secretary
of the Board/Government departments <7: /RWV  53 3DUW  To rezone the application The applicant provided responses to departmental and 0D\
DQG  LQ ''  DQG site from "Green Belt" to SXEOLF FRPPHQWV DQG D )UHVK :DWHU DQG )OXVKLQJ
in accordance with the provisions of the Ordinance and the relevant Town adjoining Government Land, "Government, Institution or :DWHU 'HPDQG $VVHVVPHQW 5HSRUW LQ UHVSRQVH WR
Planning Board Guidelines. /R:DL7VXHQ:DQ &RPPXQLW\ FRPPHQWVIURP:DWHU6HUYLFHV'HSDUWPHQW
Schedule
$SULO           7RZQ3ODQQLQJ%RDUG
Number of Deadline for Making
Plan Representation Comment on the
Received Representation
'UDIW.ZDL&KXQJ2=31R 2 27 April 2018
6.&

$SULO    7RZQ3ODQQLQJ%RDUG

TOWN PLANNING ORDINANCE (Chapter 131)

APPLICATION FOR REVIEW OF SECTION 16 DECISION
SUBMISSION OF FURTHER INFORMATION
Pursuant to section 17(2B)(b) of the Town Planning Ordinance (the Ordinance), the Town Planning Board (the Board) has published newspaper notice(s) of the
application(s) for review made under section 17(1) of the Ordinance as set out in the Schedule below. Pursuant to section 17(2I) of the Ordinance, the Board
has accepted further information from the applicant(s) to supplement the information included in the application(s). The further information is now available for
SXEOLFLQVSHFWLRQGXULQJQRUPDORI¿FHKRXUVDWWKHIROORZLQJORFDWLRQV
(i) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJDQG
(ii) WKH3ODQQLQJ(QTXLU\&RXQWHUWK)ORRU6KD7LQ*RYHUQPHQW2I¿FHV6KHXQJ:R&KH5RDG6KD7LQ1HZ7HUULWRULHV
In accordance with sections 17(2I)(c) and 17(2D) of the Ordinance, any person may make comment to the Board in respect of the further information. The
comment should state the application number to which the comment relates and should be made in writing to the Secretary, Town Planning Board by hand, post
WK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ.RQJID[RURUHPDLOWSESG#SODQGJRYKNRU
WKURXJKWKH%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSEQRWODWHUWKDQWKHGDWHVSHFL¿HGLQWKH6FKHGXOH
Any person who intends to make comment is advised to read the “Town Planning Board Guidelines on Publication of Applications for Amendment of Plan,
3ODQQLQJ3HUPLVVLRQDQG5HYLHZDQG6XEPLVVLRQRI&RPPHQWVRQ9DULRXV$SSOLFDWLRQVXQGHUWKH7RZQ3ODQQLQJ2UGLQDQFH´WKH*XLGHOLQHVIRUGHWDLOV7KH
*XLGHOLQHVDUHDYDLODEOHDWWKHDERYHORFDWLRQVWKH6HFUHWDULDWRIWKH%RDUGWK)ORRU1RUWK3RLQW*RYHUQPHQW2I¿FHV-DYD5RDG1RUWK3RLQW+RQJ
.RQJDQGWKH%RDUG¶VZHEVLWHKWWSZZZLQIRJRYKNWSE
In accordance with sections 17(2I)(c) and 17(2G) of the Ordinance, any comments made to the Board will be available for public inspection during normal
RI¿FHKRXUVDWORFDWLRQVLDQGLLDERYHXQWLOWKH%RDUGKDVUHYLHZHGWKHGHFLVLRQLQTXHVWLRQXQGHUVHFWLRQ
The gists of the applications (including location plans) can be viewed at the above locations, the Secretariat of the Board and the Board’s website.
The tentative date of the Board to consider the application has been uploaded to the Board’s website (http://www.info.gov.hk/tpb/). The meeting for
FRQVLGHULQJSODQQLQJDSSOLFDWLRQVH[FHSWWKHGHOLEHUDWLRQSDUWVZLOOEHRSHQWRWKHSXEOLF)RUREVHUYDWLRQRIWKHPHHWLQJUHVHUYDWLRQRIVHDWFDQEHPDGHZLWK
WKH6HFUHWDULDWRIWKH%RDUGE\WHOHSKRQHID[RURUHPDLOWSESG#SODQGJRYKNDWOHDVWRQHGD\EHIRUHWKHPHHWLQJ6HDWV
ZLOOEHDOORFDWHGRQD¿UVWFRPH¿UVWVHUYHGEDVLV
The paper for consideration of the Board in relation to the application will be available for public inspection after issue to the Board Members at the Planning
(QTXLU\&RXQWHUVRIWKH3ODQQLQJ'HSDUWPHQW+RWOLQHDQGDWWKH3XEOLF9LHZLQJ5RRPRQWKHGD\RIPHHWLQJ
$IWHUWKH%RDUGKDVFRQVLGHUHGWKHDSSOLFDWLRQHQTXLU\DERXWWKHGHFLVLRQPD\EHPDGHDWWHOQRRURUWKHJLVWRIWKHGHFLVLRQFDQEH
viewed at the Board’s website after the meeting.
Statement on Personal Data
The personal data submitted to the Board in any comment will be used by the Secretary of the Board and Government departments for the following purposes:
D WKHSURFHVVLQJRIWKHDSSOLFDWLRQZKLFKLQFOXGHVPDNLQJDYDLODEOHWKHQDPHRIWKHSHUVRQPDNLQJWKHFRPPHQWKHUHDIWHUNQRZQDV³FRPPHQWHU´IRUSXEOLF
LQVSHFWLRQZKHQPDNLQJDYDLODEOHWKHFRPPHQWIRUSXEOLFLQVSHFWLRQDQG
E IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQWKH³FRPPHQWHU´DQGWKH6HFUHWDU\RIWKH%RDUG*RYHUQPHQWGHSDUWPHQWV
in accordance with the provisions of the Ordinance and the relevant Town Planning Board Guidelines.
Schedule
Deadline for Making
Application Subject of the Review made by the
Location Further Information Comment on the
No. Applicant
Further Information
$6.3. /RW6%VVLQ''3DN 5HIXVDORI3URSRVHG+RXVH1HZ7HUULWRULHV First written submission $SULO
.RQJ6DL.XQJ1HZ7HUULWRULHV ([HPSWHG+RXVH6PDOO+RXVH supporting s.17 review

$SULO          7RZQ3ODQQLQJ%RDUG

NOTICE OF HEARING OF APPLICATION TO COURT FOR ANNULMENT OF

BANKRUPTCY ORDER AND DISMISSAL OF BANKRUPTCY PETITION
IN THE HIGH COURT OF THE
NOTICE OF GENERAL MEETING NOTICE OF GENERAL MEETING HONG KONG SPECIAL ADMINISTRATIVE REGION
OF CREDITORS OF CREDITORS COURT OF FIRST INSTANCE
-------------------- -------------------- IN BANKRUPTCY PROCEEDINGS NO. 7785 OF 2015
IN THE HIGH COURT OF THE IN THE HIGH COURT OF THE Re: WONG KIT SUM AMY (“the Bankrupt”)
HONG KONG SPECIAL HONG KONG SPECIAL
ADMINISTRATIVE REGION ADMINISTRATIVE REGION TAKE NOTICE that the High Court has appointed Thursday, the 10th day of May 2018
COURT OF FIRST INSTANCE COURT OF FIRST INSTANCE at 10:00 a.m. to hear the application of the Bankrupt pursuant to Section 33(1) (b) of the
-------------------- -------------------- Bankruptcy Ordinance to annul the bankruptcy order made against the Bankrupt on 8th
BANKRUPTCY PROCEEDINGS BANKRUPTCY PROCEEDINGS December 2015 and to dismiss the bankruptcy petition presented by the Bankrupt on 8th
NO. 7129 OF 2017 NO. 7127 OF 2016 October 2015.
RE: YIM WAI KEI RE: WONG CHI HO Any Creditor who wishes to support or oppose the said application shall give notice in
-------------------- -------------------- ZULWLQJWRWKH2I¿FLDO5HFHLYHUDW)4XHHQVZD\*RYHUQPHQW2I¿FHV4XHHQVZD\
Hong Kong and Pauline Wong & Co. at Suite 2515, 25th )ORRU 2I¿FH 7RZHU /DQJKDP
NOTICE is hereby given that the NOTICE is hereby given that the Place, No.8 Argyle Street, Mongkok, Kowloon, Hong Kong and may appear at the High
General Meeting of Creditors of the General Meeting of Creditors of the Court on the appointed day for the purpose by himself or his solicitors.
above named bankrupt will be held at above named bankrupt will be held at Dated this 13th day of April 2018.
Suite 2302, 23/F, Seaview Commercial Suite 2302, 23/F, Seaview Commercial
Building, 21 Connaught Road West, Building, 21 Connaught Road West, Pauline Wong & Co.
Sheung Wan, Hong Kong on 20 April Sheung Wan, Hong Kong on 20 April Solicitors for the Bankrupt
Suite 2515, 25th Floor,
2018 at 9:45 a.m. 2018 at 10:15 a.m. 2I¿FH7RZHU/DQJKDP3ODFH
Dated this 13th day of April 2018. Dated this 13th day of April 2018. No.8 Argyle Street, Mongkok,
Kowloon, Hong Kong
Cheung Hok Hin, Alan Cheung Hok Hin, Alan Tel: 3583 3083 Fax: 3583 1805
Joint and Several Provisional Trustee Joint and Several Provisional Trustee 5HI0,6&3: