Beta Galactosidase

Uploaded by

Shahil Alam

0% found this document useful (0 votes)

12 views1 page

Copyright

Available Formats

TXT, PDF, TXT or read online from Scribd

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Report this Document

Copyright:

Available Formats

Download as TXT, PDF, TXT or read online from Scribd

Flag for inappropriate content

Download as txt, pdf, or txt

0% found this document useful (0 votes)

12 views1 page

Beta Galactosidase

Uploaded by

Shahil Alam

Copyright:

Available Formats

Download as TXT, PDF, TXT or read online from Scribd

Flag for inappropriate content

Download as txt, pdf, or txt

Jump to Page

You are on page 1of 1

Search inside document

>AAC60538.

1 beta-galactosidase [Aspergillus niger]

MKLSSACAIALLAAQAAGASIKHRINGFTLTEHSDPAKRELLQKYVTWDDKSLFINGERIMIFSGEFHPF
RLPVKELQLDIFQKVKALGFNCVSFYVDWALVEGKPGEYRADGIFDLEPFFDAASEAGIYLLARPGPYIN
AESSGGGFPGWLQRVNGTLRSSDKAYLDATDNYVSHVAATIAKYQITNGGPIILYQPENEYTSGCSGVEF
PDPVYMQYVEDQARNAGVVIPLINNDASASGNNAPGTGKGAVDIYGHDSYPLGFDCANPTVWPSGDLPTN
FRTLHLEQSPTTPYAIVEFQGGSYDPWGGPGFAACSELLNNEFERVFYKNDFSFQIAIMNLYMIFGGTNW
GNLGYPNGYTSYDYGSAVTESRNITREKYSELKLLGNFAKVSPGYLTASPGNLTTSGYADTTDLTVTPLL
GNSTGSFFVVRHSDYSSEESTSYKLRLPTSAGSVTIPQLGGTLTLNGRDSKIHVTDHNVSGTNIIYSTAE
VFTWKKFADGKVLVLYGGAGEHHELAISTKSNVTVIEGSESGISSKQTSSSVVVGWDVSTTRRIIQVGDL
KILLLDRNSAYNYWVPQLATDGTSPGFSTPEKVASSIIVKAGYLVRTAYLKGSGLYLTADFNATTSVEVI
GVPSTAKNLFINGDKTSHTVDKNGIWSATVDYNAPDISLPSLKDLDWKYVDTLPEIQSSYDDSLWPAADL
KQTKNTLRSLTTPTSLYSSDYGFHTGYLLYRGHFTATGNESTFAIDTQGGSAFGSSVWLNGTYLGSWTGL
YANSDYNATYNLPQLQAGKTYVITVVIDNMGLEENWTVGEDLMKSPRGISTSCLPDGQAAPISWKLTGNL
GGEDYEDKVRGPLNEGGLYAERQGFHQPEPPSQNWKSSSPLEGLSEAGIGFYSASFDLDLPKDGMSHCSS
TSVTALRHPRTACRSTSTDIVCEIHKQHRTSDQLPCPRGNPELSRNELVGGDPVALDSAGGKLESLELSY
TTPVLTALGEVESVDQPKYKKRKGAY

The Subtle Art of Not Giving a F*ck: A Counterintuitive Approach to Living a Good Life
From Everand
The Subtle Art of Not Giving a F*ck: A Counterintuitive Approach to Living a Good Life
Mark Manson
Rating: 4 out of 5 stars
4/5 (5822)
The Gifts of Imperfection: Let Go of Who You Think You're Supposed to Be and Embrace Who You Are
From Everand
The Gifts of Imperfection: Let Go of Who You Think You're Supposed to Be and Embrace Who You Are
Brené Brown
Rating: 4 out of 5 stars
4/5 (1093)
Never Split the Difference: Negotiating As If Your Life Depended On It
From Everand
Never Split the Difference: Negotiating As If Your Life Depended On It
Chris Voss
Rating: 4.5 out of 5 stars
4.5/5 (852)
Principles: Life and Work
From Everand
Principles: Life and Work
Ray Dalio
Rating: 4 out of 5 stars
4/5 (610)
The Glass Castle: A Memoir
From Everand
The Glass Castle: A Memoir
Jeannette Walls
Rating: 4.5 out of 5 stars
4.5/5 (1717)
Grit: The Power of Passion and Perseverance
From Everand
Grit: The Power of Passion and Perseverance
Angela Duckworth
Rating: 4 out of 5 stars
4/5 (590)
Sing, Unburied, Sing: A Novel
From Everand
Sing, Unburied, Sing: A Novel
Jesmyn Ward
Rating: 4 out of 5 stars
4/5 (1105)
Hidden Figures: The American Dream and the Untold Story of the Black Women Mathematicians Who Helped Win the Space Race
From Everand
Hidden Figures: The American Dream and the Untold Story of the Black Women Mathematicians Who Helped Win the Space Race
Margot Lee Shetterly
Rating: 4 out of 5 stars
4/5 (898)
Shoe Dog: A Memoir by the Creator of Nike
From Everand
Shoe Dog: A Memoir by the Creator of Nike
Phil Knight
Rating: 4.5 out of 5 stars
4.5/5 (540)
The Perks of Being a Wallflower
From Everand
The Perks of Being a Wallflower
Stephen Chbosky
Rating: 4.5 out of 5 stars
4.5/5 (2104)
The Hard Thing About Hard Things: Building a Business When There Are No Easy Answers
From Everand
The Hard Thing About Hard Things: Building a Business When There Are No Easy Answers
Ben Horowitz
Rating: 4.5 out of 5 stars
4.5/5 (349)
Bad Feminist: Essays
From Everand
Bad Feminist: Essays
Roxane Gay
Rating: 4 out of 5 stars
4/5 (1025)
Elon Musk: Tesla, SpaceX, and the Quest for a Fantastic Future
From Everand
Elon Musk: Tesla, SpaceX, and the Quest for a Fantastic Future
Ashlee Vance
Rating: 4.5 out of 5 stars
4.5/5 (474)
The Outsider: A Novel
From Everand
The Outsider: A Novel
Stephen King
Rating: 4 out of 5 stars
4/5 (1867)
Her Body and Other Parties: Stories
From Everand
Her Body and Other Parties: Stories
Carmen Maria Machado
Rating: 4 out of 5 stars
4/5 (822)
The Sympathizer: A Novel (Pulitzer Prize for Fiction)
From Everand
The Sympathizer: A Novel (Pulitzer Prize for Fiction)
Viet Thanh Nguyen
Rating: 4.5 out of 5 stars
4.5/5 (122)
Angela's Ashes: A Memoir
From Everand
Angela's Ashes: A Memoir
Frank McCourt
Rating: 4.5 out of 5 stars
4.5/5 (441)
PDF Decoding Cardiac Electrophysiology Understanding The Techniques and Defining The Jargon Afzal Sohaib Ebook Full Chapter
Document53 pages
PDF Decoding Cardiac Electrophysiology Understanding The Techniques and Defining The Jargon Afzal Sohaib Ebook Full Chapter
linda.peterson910
100% (4)
The Emperor of All Maladies: A Biography of Cancer
From Everand
The Emperor of All Maladies: A Biography of Cancer
Siddhartha Mukherjee
Rating: 4.5 out of 5 stars
4.5/5 (271)
Brooklyn: A Novel
From Everand
Brooklyn: A Novel
Colm Tóibín
Rating: 3.5 out of 5 stars
3.5/5 (1948)
The Little Book of Hygge: Danish Secrets to Happy Living
From Everand
The Little Book of Hygge: Danish Secrets to Happy Living
Meik Wiking
Rating: 3.5 out of 5 stars
3.5/5 (403)
A Man Called Ove: A Novel
From Everand
A Man Called Ove: A Novel
Fredrik Backman
Rating: 4.5 out of 5 stars
4.5/5 (4771)
The World Is Flat 3.0: A Brief History of the Twenty-first Century
From Everand
The World Is Flat 3.0: A Brief History of the Twenty-first Century
Thomas L. Friedman
Rating: 3.5 out of 5 stars
3.5/5 (2259)
Steve Jobs
From Everand
Steve Jobs
Walter Isaacson
Rating: 4.5 out of 5 stars
4.5/5 (808)
Devil in the Grove: Thurgood Marshall, the Groveland Boys, and the Dawn of a New America
From Everand
Devil in the Grove: Thurgood Marshall, the Groveland Boys, and the Dawn of a New America
Gilbert King
Rating: 4.5 out of 5 stars
4.5/5 (266)
The Art of Racing in the Rain: A Novel
From Everand
The Art of Racing in the Rain: A Novel
Garth Stein
Rating: 4 out of 5 stars
4/5 (4208)
A Tree Grows in Brooklyn
From Everand
A Tree Grows in Brooklyn
Betty Smith
Rating: 4.5 out of 5 stars
4.5/5 (1929)
The Yellow House: A Memoir (2019 National Book Award Winner)
From Everand
The Yellow House: A Memoir (2019 National Book Award Winner)
Sarah M. Broom
Rating: 4 out of 5 stars
4/5 (98)
Accp 2021 P 1
Document584 pages
Accp 2021 P 1
Sarra Hassan
No ratings yet
Yes Please
From Everand
Yes Please
Amy Poehler
Rating: 4 out of 5 stars
4/5 (1903)
A Heartbreaking Work Of Staggering Genius: A Memoir Based on a True Story
From Everand
A Heartbreaking Work Of Staggering Genius: A Memoir Based on a True Story
Dave Eggers
Rating: 3.5 out of 5 stars
3.5/5 (231)
Team of Rivals: The Political Genius of Abraham Lincoln
From Everand
Team of Rivals: The Political Genius of Abraham Lincoln
Doris Kearns Goodwin
Rating: 4.5 out of 5 stars
4.5/5 (234)
The Woman in Cabin 10
From Everand
The Woman in Cabin 10
Ruth Ware
Rating: 3.5 out of 5 stars
3.5/5 (2522)
Wolf Hall: A Novel
From Everand
Wolf Hall: A Novel
Hilary Mantel
Rating: 4 out of 5 stars
4/5 (3973)
Fear: Trump in the White House
From Everand
Fear: Trump in the White House
Bob Woodward
Rating: 3.5 out of 5 stars
3.5/5 (738)
John Adams
From Everand
John Adams
David McCullough
Rating: 4.5 out of 5 stars
4.5/5 (2409)
On Fire: The (Burning) Case for a Green New Deal
From Everand
On Fire: The (Burning) Case for a Green New Deal
Naomi Klein
Rating: 4 out of 5 stars
4/5 (74)
The Light Between Oceans: A Novel
From Everand
The Light Between Oceans: A Novel
M.L. Stedman
Rating: 4.5 out of 5 stars
4.5/5 (789)
Manhattan Beach: A Novel
From Everand
Manhattan Beach: A Novel
Jennifer Egan
Rating: 3.5 out of 5 stars
3.5/5 (880)
The Constant Gardener: A Novel
From Everand
The Constant Gardener: A Novel
John le Carré
Rating: 3.5 out of 5 stars
3.5/5 (104)
The Unwinding: An Inner History of the New America
From Everand
The Unwinding: An Inner History of the New America
George Packer
Rating: 4 out of 5 stars
4/5 (45)
Rise of ISIS: A Threat We Can't Ignore
From Everand
Rise of ISIS: A Threat We Can't Ignore
Jay Sekulow
Rating: 3.5 out of 5 stars
3.5/5 (137)
Little Women
From Everand
Little Women
Louisa May Alcott
Rating: 4 out of 5 stars
4/5 (105)
ITT Mackay Instruction Manual For Model 3030A-3030AR Synthesized Receiver Issue 3 June 1982
Document110 pages
ITT Mackay Instruction Manual For Model 3030A-3030AR Synthesized Receiver Issue 3 June 1982
antoni
No ratings yet
NCP For Geriatric by Mikki Kaio Lim
Document1 page
NCP For Geriatric by Mikki Kaio Lim
Jeffrey Mariano
No ratings yet
919 Antibody
Document83 pages
919 Antibody
Shahil Alam
No ratings yet
ITC Explained
Document6 pages
ITC Explained
Shahil Alam
No ratings yet
ELISA E-Book
Document26 pages
ELISA E-Book
Shahil Alam
No ratings yet
ELISA Handbook
Document31 pages
ELISA Handbook
Shahil Alam
No ratings yet
CVL 425
Document20 pages
CVL 425
Shahil Alam
No ratings yet
Sitting Arrangement Venn Diagrams - PMD
Document8 pages
Sitting Arrangement Venn Diagrams - PMD
Shahil Alam
No ratings yet
BTY 405 IGAP Format
Document4 pages
BTY 405 IGAP Format
Shahil Alam
No ratings yet
Kumon Mathematics Progress Tracker Levels C To O PDF
Document2 pages
Kumon Mathematics Progress Tracker Levels C To O PDF
charmradeek
No ratings yet
Part Winding Start
Document2 pages
Part Winding Start
mark amthony
No ratings yet
Lorentz PS1800 CS-36-1
Document4 pages
Lorentz PS1800 CS-36-1
SINES France
No ratings yet
BME
Document11 pages
BME
temesgen adugna
No ratings yet
Easy Giantess Calculator
Document1 page
Easy Giantess Calculator
Arthur Dutra Recco
No ratings yet
Encyclopaedia of Popular Science (Steven N.shore)
Document353 pages
Encyclopaedia of Popular Science (Steven N.shore)
Muhammad Ali Haider
No ratings yet
SONY CAR Power Amplifier SM PDF
Document24 pages
SONY CAR Power Amplifier SM PDF
Joselorenzo Torres A
0% (1)
Reddit - PDF For Handbook On PCT
Document43 pages
Reddit - PDF For Handbook On PCT
Gagandeep Singh
No ratings yet
Article 5
Document10 pages
Article 5
frenlolman
No ratings yet
Food Fraud and Adulteration in China
Document7 pages
Food Fraud and Adulteration in China
ToroPolaco
No ratings yet
DAILY REPORT (29/01/2015) Project: BK-TNG Wellhead Platform Item: Fabrication of Pressure Vessel
Document20 pages
DAILY REPORT (29/01/2015) Project: BK-TNG Wellhead Platform Item: Fabrication of Pressure Vessel
Vanvien Le
No ratings yet
Naze32 Rev6 Manual v1.2
Document30 pages
Naze32 Rev6 Manual v1.2
Cheryl Laura Lamam
No ratings yet
Untitled
Document50 pages
Untitled
Katrina F Jones
No ratings yet
Eep19 5
Document38 pages
Eep19 5
Balamurugan Arumugam
No ratings yet
Vortec Lh6 5.3l v8 MT Org
Document837 pages
Vortec Lh6 5.3l v8 MT Org
gabriel mega
No ratings yet
MingCha Product Guide 2004
Document20 pages
MingCha Product Guide 2004
Leo CL Kwan
No ratings yet
@canotes - Final Customs Question Bank May, Nov 20 by ICAI PDF
Document111 pages
@canotes - Final Customs Question Bank May, Nov 20 by ICAI PDF
Praneel
No ratings yet
9-5 Complex Numbers and de Moivre - S Theorem
Document45 pages
9-5 Complex Numbers and de Moivre - S Theorem
binode
100% (1)
Berube Et Al 2003 - Laboratory and Field Investigations of The Influence of Sodium Chloride On ASR
Document8 pages
Berube Et Al 2003 - Laboratory and Field Investigations of The Influence of Sodium Chloride On ASR
rodrigo.vilela.gorga
No ratings yet
Iso 13938 2 2019
Document9 pages
Iso 13938 2 2019
Long Vu
No ratings yet
Weighted Average Method
Document16 pages
Weighted Average Method
Kevin Estay
100% (2)
7 E's
Document9 pages
7 E's
Shiello Juanico
No ratings yet
Radial Fan Conical Vs Parallel Impeller Casing Analysis
Document10 pages
Radial Fan Conical Vs Parallel Impeller Casing Analysis
virgilio
No ratings yet
Jsy Ea Ky : Vuqla/Kku Vfhkdyi VKSJ Ekud Laxbu Y (Kuå&226 011
Document67 pages
Jsy Ea Ky : Vuqla/Kku Vfhkdyi VKSJ Ekud Laxbu Y (Kuå&226 011
Bala Raju
No ratings yet
Electronics System Design Manufacturing ESDM May 2021
Document35 pages
Electronics System Design Manufacturing ESDM May 2021
wofedor973
No ratings yet
Urine Examination# Divya
Document69 pages
Urine Examination# Divya
Medicine 0786
No ratings yet