Professional Documents
Culture Documents
A Theological Model of Healing To Inform
A Theological Model of Healing To Inform
A Theological Model of Healing To Inform
Healing was an important part of the mission of Jesus and the apostles. This ministry
continued throughout the history of the Church, taking many forms. Plagues, pandemics
and incurable diseases have always been a challenge to it. This challenge has been
UHQHZHGZLWKLQWKHFRQWH[WRI+,9DQG$,'67KLVDUWLFOHIRFXVHVRQWKHGHYHORSPHQW
of a contextual theological model which can inform the healing ministry within Southern
Africa. The narrative is constructed in terms of seven challenges which must be met to
ensure this goal is reached. Three of the challenges respond to issues emerging from a
VRFLDODQDO\VLVRIWKHFRQWH[WLQFOXGLQJWKHFRQÀLFWEHWZHHQWKRVH&KULVWLDQVZKRFODLP
miraculous cures and those who believe primarily in medical procedures. The other four
challenges respond to issues emerging from a theological analysis of the context. An
assessment is made of the theological merits of diverse healing procedures.
Introduction
The importance of constructing contextual theological models that inform ministry
cannot be overemphasised. Such models are essential for the methodology of
pastoral and practical theologies. Theological models need to bring together
disciplined analysis of the context, faithfulness to the Christian tradition, and
innovation in developing contextual theological categories to inform ministry.
The healing ministry is an important area for such construction.
We must recognise the importance of healing in the ministry of Jesus as attested
by the evangelists. He also established a band of followers whom he commissioned
to pursue the ministry of healing as he had done (Matthew 10).1 Healing thus
seems central to Christianity and indeed many forms of healing ministry have
existed throughout the history of the Church.2 Plagues, pandemics and incurable
1 Stuart C. Bate, The Inculturation of the Christian Mission to Heal in the South African Context
(NY: Edwin Mellen, 1999), 179-180.
2 Church is capitalised when it refers to expression of the one Church such as in Church teaching,
history of the Church etc. It is also capitalised when referring to the name of individual church
traditions such as the Catholic Church etc. It is also capitalised when acronyms such as AIC are
5VWCTV%$CVGKU4GUGCTEJCPF&GXGNQROGPV1HſEGTCV5V,QUGRJŏU6JGQNQIKECN+PUVKVWVG
Cedara and Honorary Lecturer in the School of Religion, Philosophy and Classics,
University of KwaZulu-Natal. <scbate@omi.org.za>
70 Bate
diseases have always been a challenge to this ministry. Today’s context of HIV
DQG$,'6DQGRWKHUGLI¿FXOWLOOQHVVHVDQGGLVDELOLWLHVKDVRQFHPRUHUHQHZHG
that challenge, with many faith healers claiming to elicit cures: “In a very general
sense we need to take account of the fact that those practicing the Coping-healing
ministry and those being healed report their experience as such.”3
2QWKHRWKHUKDQGPDQ\LQWKHPHGLFDODQGVFLHQWL¿FFRPPXQLW\GLVPLVV
the validity of such healing, claiming in their studies to have found no evidence
of cures and dismissing the phenomenon as “psychosomatic”, “quackery”,
“emotion of the moment”, “mental instability” or a dangerous use of the power
of suggestion.4
7KLVFRQÀLFWLQYLHZVKDVEHHQH[DFHUEDWHGRIODWHZLWKLQFUHDVLQJFULWLFLVPE\
VRPHFKXUFKHVRIIDLWKKHDOLQJEHLQJFRQGXFWHGLQRWKHU&KULVWLDQJURXSV$,'6
and other life threatening illnesses are claimed to be miraculously healed. In some
cases, those so healed are instructed to throw away their prescribed medication.
In 2010 the South African Council of Churches condemned this practice: “SA
Council of Churches secretary general Eddie Makue said it was ‘completely and
utterly irresponsible’ for churches to claim to have faith-healed patients. He said in
order to be cured from any illness, people needed to undergo a medical process.”5
0XFKRIWKHFRQIXVLRQDQGFRQÀLFWDULVHVEHFDXVHRIWKHODFNRIDGHHSDQDO\VLV
DQGXQGHUVWDQGLQJRIWKHKXPDQFRQWH[WZLWKLQZKLFKGLI¿FXOWLOOQHVVHVVXFKDV
+,9DQG$,'6DQGRWKHUGLVDELOLWLHVWKDWDIIHFWSHRSOHRQDQRQJRLQJEDVLVRFFXU
An example of such confusion is that between modern westerners who operate
within the culture of individualism, and traditional cultures and some religious
communities which are based on a communal notion of humanity. The former
tend to prioritise individual freedom and conscience over the requirements and
teaching of the community, be it church, culture or country. This is often not the
case in the latter.
,WZLOOQRWEHSRVVLEOHZLWKLQWKHFRQ¿QHVRIRQHDUWLFOHWRGHDOLQGHWDLOZLWK
the large number of controversies concerning the role of religion in healing
today, nor is that the goal. The purpose of this article is to construct a theological
framework within which such questions and controversies can be approached. This
will be done in two principal parts. First, an analysis of the social context will be
presented, focussing principally on the cultural factors since these are the most
expressed in full. In all other cases where it is one of many, the small case is used as in church
buildings and Neo-Pentecostal churches.
3 For examples of experiences by healers and those being healed from within the coping-healing
phenomenon, see Bate, Inculturation of the Christian Mission to Heal, 42-56.
4 The views and quotes are taken from Bate, Inculturation of the Christian Mission to Heal, 69-70.
5 “Faith Healers Anger Council of Churches”, IOL News August 6, 2010 [ www.iol.co.za/news/south-
africa/faith-healers-anger-council-of-churches-1.672243]. Accessed March 2012.
A Theological Model of Healing to Inform an Authentic Healing Ministry 71
important and the most misunderstood. The second part will be the construction
of the theological model to inform ministry. This will be based on a theological
anthropology founded on the social analysis, a biblical theology based on the
ministry of Jesus, and an ecclesiology based on Church doctrine and disciplinary
norms regarding the healing ministry.
The theological model will be developed in response to seven challenges
which must be met in order to construct a contextual theology which can inform
pastoral ministry within this context. Three of the challenges respond to issues
emerging from a social analysis of the context whereas the other four respond to
LVVXHVHPHUJLQJIURPDWKHRORJLFDODQDO\VLVRIWKHFRQWH[W+,9DQG$,'6DUH
not the only illnesses being considered here but they are often a metaphor for
DOOGLI¿FXOWVLFNQHVVHVDQGGLVDELOLWLHVWRZKLFKUHOLJLRXVDQGFXOWXUDOKHDOHUVDUH
called to respond. Our context is urban and peri-urban Southern Africa.
WKLQJDV$,'6FDOOLQJLWDQLQYHQWLRQRIVFLHQWLVWVDQGSKDUPDFHXWLFDOFRPSDQLHV8
6RPHVD\WKDW$,'6LV*RG¶VSXQLVKPHQWIRUHYLO9
,QVRFLHW\DGLI¿FXOWWRHUDGLFDWHSDQGHPLFVXFKDV$,'6RUSODJXHDIIHFWVVR
many different aspects of our human life. For some it is a matter of life and death,
for others it is a question of access to resources such as medicines and adequate
IRRG7KHUHDUHVRFLDOFRQVHTXHQFHVZKHUHDFFHVVWRUHVRXUFHVWR¿JKWWKHLOOQHVV
is linked to wealth and poverty. There are political consequences regarding the
SURYLVLRQRIUHVRXUFHVWR¿JKWWKHSDQGHPLF,QWKHUHOLJLRXVUHDOPVXFKLOOQHVVHV
always have a link to the spiritual world, and issues of spirits, witches, demons,
sin and evil become part of the narratives linked to the illness.
6RIRUH[DPSOHZKLOVWLQWKHVFLHQWL¿FPRGHUQFXOWXUH+,9LVXQGHUVWRRGWR
be a virus in the medical understanding of sickness and health, there are actually
GLIIHUHQWZD\VWKDWSHRSOHSHUFHLYHMXGJHDQGUHVSRQGWR+,9$,'6DQGRWKHU
serious illnesses that are far wider than the medical approaches. Our response to
$,'6UHYHDOVZKRZHDUHDVKXPDQEHLQJV,WUHYHDOVWKHUHDOWUXWKVEHOLHIVDQG
values of our society. Attitudes such as stigma, silence and denial are related to
perceptions within some groups in our society, and these attitudes are driven by
beliefs and values within their cultural horizon. This leads some groups to give
the phenomenon much greater power within the community than others who
consider it to be more of a personal matter.
An authentic response to a context like this requires a response to the complexus
of truths, beliefs and values within the context. As we shall see, this complexus
KDVDQLQÀXHQFHRQWKHLGHQWLW\RIWKHLOOQHVVDQGFRQVHTXHQWO\WKHQDWXUHRIWKH
remedy. So whilst the discovery of an organic cure would also remove many
other issues by changing a complex sickness into a curable disease, the healing
RIWKHVHGLI¿FXOWDQGVHULRXVLOOQHVVHVPXVWDOVRLQFOXGHDUHVSRQVHWRWKHKXPDQ
troubles it generates since these militate against wellbeing. These troubles emerge
as a result of the social, cultural and religious factors involved. Indeed, as we
shall demonstrate, the healing that heals our humanity is cultural and religious
healing.10 It is cultural because it affects our values and way of life. It is religious
because it affects our deepest beliefs about life, death and human limitation: our
deepest truths. This raises the next challenge we must respond to.
3HWHU+'XHVEHUJ³$,'6$FTXLUHGE\'UXJ&RQVXPSWLRQDQG2WKHU1RQFRQWDJLRXV5LVN)DFWRUV´
Pharmacology and Therapeutics 55, no. 3 (1992). See also John Lauritsen, The Risk-AIDS Hypothesis.
[www.duesberg.com/media/jlrisk-2.html]. Accessed March 2012.
9 Stuart C. Bate, “Good News for Aids Myths”, Missionalia 30, no. 1 (2002), 93-108, 96.
10 6WXDUW&%DWH³5HVSRQVLEOH+HDOLQJLQD:RUOGRI+,9$,'6´LQResponsibility in a Time of
AIDS, ed. Stuart C. Bate (Pietermaritzburg: Cluster, 2003), 146-165.
A Theological Model of Healing to Inform an Authentic Healing Ministry 73
as example.13 The second is Modern Western Culture for which I use the Medical
model as example.14 The third I call the Urban Neo-Pentecostal Culture which
describes the healing beliefs and practices within Neo-Pentecostal, Charismatic
and other Coping-healing churches.15
Table 1
Culture Illness Remedy
13 For a detailed presentation of the categories of sickness and their remedies in traditional Zulu culture see
V. Ncube, “Responsibility in Inculturation: The Healing Ministry in a Zulu Context”, in Responsibility
in a Time of AIDS, ed. Stuart C. Bate (Pietermaritzburg: Cluster, 2003), 78-115.
14 For a presentation of the medical model see R. Laing, The Politics of the Family and Other Essays
(London: Tavistock Publications, 1971).
15 )RUDJHQHUDORXWOLQHRIVXFKFKXUFKHVLQXUEDQ$IULFDVHH+'LOJHU³+HDOLQJWKH:RXQGVRI
0RGHUQLW\6DOYDWLRQ&RPPXQLW\DQG&DUHLQD1HR3HQWHFRVWDO&KXUFKLQ'DU(V6DODDP
Tanzania”, Journal of Religion in Africa 37 (2007), 59-83. For more on “Coping-healing churches”
see Bate, Inculturation of the Christian Mission to Heal.
A Theological Model of Healing to Inform an Authentic Healing Ministry 75
But if this remedy is not effective and the illness continues then I am driven to
seek a more powerful remedy within my cultural horizon in order to feel better.
Table 2
Culture Local Healing Resource
West (English) clinic/nurse/doctor
Zulu Traditional nyanga/iSangoma16
African Urban17 umthandazi, umprofeti, umkhokeli18
But if these local resources are not effective and the illness continues, I will
be inclined to seek out a more powerful healing resource within my culture in
order to feel well. This is a move to the next level of healing power, a more distant
cultural healing service.19 These are normally cultural resources that are further
away and bigger. Often the distance and effort required to access them gives an
emotional cultural power to them which motivates me to seek them out. In other
words, this is a movement onto the next level of cultural healing power.
20 The terms “Catholic Church” and “Catholic” are used throughout this article to refer to what some
authors call the “Roman Catholic Church”. Whilst the latter is common amongst English speakers
and it is true that other Christians profess their faith in terms of the Nicene and Constantinople
symbols which includes the term “Holy Catholic and Apostolic Church”, it is not the term this
church uses to refer to itself. See, for example, Lumen Gentium'RJPDWLF&RQVWLWXWLRQRQWKH
Church, Vatican Council II 1965, §8, 12, 13, 18. Similarly, its members refer to themselves as
Catholics and not Roman Catholics. For these reasons the terms “Catholic Church” and “Catholic”
is used throughout to refer to the 23 distinct churches which recognise the Pope as the Vicar of
Christ on earth.
21 S. Luzzatto, Padre Pio: Miracles and Politics in a Secular Age (NY: Metropolitan, 2010).
A Theological Model of Healing to Inform an Authentic Healing Ministry 77
of sickness by the direct intervention of God through the prayers and exhortation
of the minister and faith in Jesus of the sick person.28
Here, all sickness is spiritual in nature. Evil spirits continue to tempt us and
possess us when we do not live by the power of Christ. God continues to work
miracles of healing today through Jesus.
The limitation of this model is the necessity of faith for healing, which can
RVWUDFLVHWKHXQKHDOHGDVKDYLQJLQVXI¿FLHQWIDLWK29 Rituals and symbols from this
culture also inform practices in African Independent Churches (AIC).
The three models of sickness and health are compared below in Table 3. It
is important to note that many people in urban contexts have acculturated more
than one model into their lifestyles and will often pass from one to the other in
attempting to effect healing.
28 For the role of faith in healing see H. Solbrekken, “Healing Through Faith in Jesus Christ (Bible,
articles, miracles, healing testimonies)”, [www.mswm.org/healing.faithjesus.htm]. Accessed
September 2011.
29 '50F&RQQHOOThe Promise of Health and Wealth (London: Hodder & Stoughton, 1990), 165-166.
80 Bate
7KH¿UVWSDUWRIWKLVSDSHUKDVDWWHPSWHGWRDQDO\VHVRPHRIWKHFRQFHSWV
symbols and processes operating in the sickness and health domain in South
Africa. The next section will attempt to construct a local theology which responds
to this local context. Such a theology will be helpful in informing effective healing
ministries within it.
There are three principal Greek terms used for the healing work of Jesus in
WKHJRVSHOV7KH¿UVWRIWKHVHLViasthai (ȧȐıșĮȚ). It refers to the kind of healing
done by a physician (iatrosȓĮIJȡȩȢ,WDSSHDUVVHYHQWHHQWLPHVLQWKHJRVSHOV
especially in Luke.33
The second term used is sozoıȫȗȦ$VZHOODVPHDQLQJKHDOLQJLWDOVR
means to save, rescue or maintain integrity. It always refers to the whole person,
not individual members of the body. You cannot “sozo” an arm or an eye. This
WHUPDSSHDUVVL[WHHQWLPHVIRUKHDOLQJLQWKHJRVSHOVDQGWKLUW\¿YHWLPHVLQD
less clinical sense referring to other forms of saving a person. It is based on an
Aramaic term with a twofold meaning: make alive and make healthy. Saving and
healing are thus part of the same process.347KHUHLVFOHDUO\VRPHDI¿QLW\KHUH
with the notion of “ukuphilisa” in isiZulu.35
The third term used for healing is therapeuoșİȡĮʌİȪȦ7KLVLVWKHPRVW
common term used. It is used in the gospels in the “sense of to heal and always
in such a way that the reference is not to medical treatment which might fail but
to real healing.” It is used thirty-three times for healing in the gospels.36 It is often
translated “curing” in English translations, which has become problematic given
WKHVFLHQWL¿FGH¿QLWLRQJLYHQWRWKLVZRUGE\WKHPHGLFDOPRGHOLQ:HVWHUQFXOWXUH
33 Albrecht Oepke, “1965: s v iomai ȓȐȠȝĮȚ”, in Theological Dictionary of the New Testament, ed.
Gerhard Kittel, trans. Geoffrey W. Bromiley (Grand Rapids: Wm B. Eerdmans Publishing Company,
1965).
34 Werner Foerster, “1973: s v sozo (ıȫȗȦ)”, in Theological Dictionary of the New Testament, ed. Gerhard
Kittel, trans. Geoffrey W. Bromiley (Grand Rapids: Wm B. Eerdmans Publishing Company, 1973).
35 6WXDUW&%DWH³5HVSRQVLEOH+HDOLQJLQD:RUOGRI+,9$,'6´ in Responsibility in a Time of AIDS,
ed. Stuart C. Bate (Pietermaritzburg: Cluster, 2003), 146-165, 148.
36 +HUPDQ:ROIJDQJ%H\HU³VYWKHUDSHXRșİȡĮʌİȪȦ´LQTheological Dictionary of the
New Testament, ed. Gerhard Kittel, trans. Geoffrey W. Bromiley (Grand Rapids: Wm B. Eerdmans
Publishing Company, 1973).
84 Bate
37 Stuart C. Bate, “The Mission to Heal in a Global Context”, International Review of Mission 90, nos.
356-357 (2001), 70-80, 71.
A Theological Model of Healing to Inform an Authentic Healing Ministry 85
to note the use of “raise him up” in this text. The Greek word used is (ਥȖİȡİ;
egerei). This is the same term for raise up as used in Matthew 7 above where it
refers to the dead. In the same way as for “sozo”, a merely physical interpretation
of this text trivialises it.
38 J.M. Waliggo, “A Woman Confronts Social Stigma in Uganda”, in Catholic Ethicists on HIV/AIDS
Prevention, ed. J. Keenan (NY: Continuum, 2000), 48-56, 48.
39 6WXDUW&%DWH³'RHV5HOLJLRXV+HDOLQJ:RUN"´Neue Zeitschrift fur Missionswissenschaft 55, no. 4
(1999), 259-278, 262.
40 “The Word on the Word of Faith group blog” is part of a Christian Group ministry which includes
some former faith healers. It is advocating a move away from the faith in faith movement of
faith healers and a return to a Christ centered Christianity. A number of former faith healers have
exposed some of the techniques used to impress people and make money. A typical example is the
story of former faith healer Mark Haville: Peter Glover, “From Faith in Faith to Faith in Christ”,
[http://thewordonthewordoffaithinfoblog.com/2009/05/26/ex-faith-healer] Accessed March 2012.
86 Bate
Instruction on Prayers for Healing from the Vatican.41 Many of these teachings
would not be disputed by other churches though some of the disciplinary norms
would different. Nevertheless it is useful to examine this document as it provides
an indication of some of the main doctrinal and ministerial issues in the healing
ministry.
Doctrinal aspects
7KHLQVWUXFWLRQWRWKHFKXUFKDI¿UPVWKHQHHGWRSUD\IRUWKHKHDOLQJRIWKHVLFN,W
also reminds us that the power of the victory of sickness and death is rooted in the
SDVFKDOP\VWHU\,QDGGLWLRQRXURZQH[SHULHQFHRIVLFNQHVV¿QGVVROLGDULW\ZLWK
the sufferings of Christ in his passion as a result of the struggle against evil.42 As
Jesus did in his suffering, sick people are called to accept God’s will in their lives.43
When it comes to prayer for healing, the Catholic Church distinguishes between
healing rites in the liturgy and “prayer meetings for obtaining healing.”44 In
addition, prayer meetings for healing are further distinguished “between meetings
connected to a ‘charism of healing’ whether real or apparent, and those without
such a connection.”45
An important teaching is that the Holy Spirit “grants to some a special charism
of healing in order to show the power of the grace of the Risen Christ.” However,
this charism is not necessarily given to a particular class of people such as church
leaders. Nor is the healing dependent on the intensity and emotion of the prayer
and the meeting.46 Indeed, every Catholic has the right to pray for healing and
prayer meetings for healing may be led by non-ordained Catholics even in a
church. However, whilst non liturgical prayers for healing allow more freedom of
41 &RQJUHJDWLRQIRUWKH'RFWULQHRIWKH)DLWK5RPHInstruction On Prayers For
Healing [http://www.vatican.va/roman_curia/congregations/cfaith/documents/rc_con_cfaith_
doc_20001123_istruzione_en.html], Accessed September 2011. Hereafter referred to as Instruction
on Prayers for Healing.
42 “The messianic victory over sickness, as over other human sufferings, does not happen only by its
elimination through miraculous healing, but also through the voluntary and innocent suffering of
Christ in his passion, which gives every person the ability to unite himself to the sufferings of the
Lord.” Instruction on Prayers for Healing §1.
43 “Presuming the acceptance of God’s will, the sick person’s desire for healing is both good and deeply
human, especially when it takes the form of a trusting prayer addressed to God.” Instruction on Prayers
for Healing §2.
44 Instruction on Prayers for Healing §5. Note that Magisterial documents in the Catholic Church are
numbered by section. References are made using the section number.
45 Instruction on Prayers for Healing §5.
46 “Not even the most intense prayer obtains the healing of all sicknesses. St Paul had to learn from
the Lord that ‘my grace is enough for you; my power is made perfect in weakness’ (2 Cor 12:9).”
Instruction on Prayers for Healing §5.
A Theological Model of Healing to Inform an Authentic Healing Ministry 87
expression and format, the rules regarding formal worship services in the Church,
its Liturgy, are much more strictly controlled. These are presented in the document
under a section entitled “Norms”.47 They include the requirement to follow the
prescribed rites.48 In addition, liturgical and non-liturgical forms of healing must
not be combined within one service. This is to preserve the integrity, meaning and
purpose of the liturgy. The anthropological merit of this is obvious since rituals
can be compromised by changes to the form and the performance within them.
It is important to note that many coping-healing churches attempt to
create conditions of high emotion amongst participants. It is well-known that
overstimulation of the senses through drumming, singing raising hands and the like
can create conditions of altered states of consciousness, which promote emotion
transfer which can lead to feelings of wellbeing.49 The danger of such rituals is
that the feelings promoted are not linked to health, and the rituals can become
manipulative and addictive.50 Whilst not raising this matter, the norm promotes
“a climate of peaceful devotion in the assembly” in services for healing, whether
liturgical or non-liturgical.51
Authority regarding liturgical and non-liturgical forms of healing in a local
church rests with Church authorities, which in the case of the Catholic Church is
the bishop of the diocese.52 This means that a priest or local minister does not have
47 “It is licit for every member of the faithful to pray to God for healing. When this is organized in a church
or other sacred place, it is appropriate that such prayers be led by an ordained minister.” Instruction
on Prayers for Healing, Norms Art. 1.
48 Instruction on Prayers for Healing, Norms Art. 2 “Prayers for healing are considered to be liturgical
if they are part of the liturgical books approved by the Church’s competent authority; otherwise, they
are non-liturgical.”
“Liturgical prayers for healing are celebrated according to the rite prescribed in the Ordo
EHQHGLFWLRQLVLQ¿UPRUXPRIWKH5LWXDOH5RPDQXPDQGZLWKWKHSURSHUVDFUHGYHVWPHQWV
indicated therein.” Instruction on Prayers for Healing, Norms Art. 3 §1.
49 -'RZ³8QLYHUVDO$VSHFWVRI6\PEROLF+HDOLQJ$7KHRUHWLFDO6\QWKHVLV´American
Anthropologist 88, no. 1 (1986), 56-69, 64-65.
50 K. Pargament, “Religious Methods of Coping: Resources for the Conservation and Transformation
RI6LJQL¿FDQFH´LQReligion and the Clinical Practice of Psychology, ed. E.P. Shafranske
:DVKLQJWRQ'&$PHULFDQ3V\FKRORJLFDO$VVRFLDWLRQ
51 “Those who direct healing services, whether liturgical or non-liturgical, are to strive to maintain a
climate of peaceful devotion in the assembly and to exercise the necessary prudence if healings should
take place among those present; when the celebration is over, any testimony can be collected with
honesty and accuracy, and submitted to the proper ecclesiastical authority.” Instruction on Prayers
for Healing, Norms Art. 7.
52 ³7KH 'LRFHVDQ %LVKRS KDV WKH ULJKW WR LVVXH QRUPV IRU UHJDUGLQJ OLWXUJLFDO VHUYLFHV RI KHDOLQJ´
Instruction on Prayers for Healing, Norms Art. 4 §1.
“Those who prepare liturgical services of healing must follow these norms in the celebration of
such services.” Instruction on Prayers for Healing, Norms Art. 4 §2.
88 Bate
the right to make changes or adaptations in liturgies in his parish for the sake of,
for example, “inculturation”. This is clearly not the case in some other churches.
Nonetheless, the responsibility of leadership for the activity of ministers is an
important principal which must be upheld within religious practice.
“Permission to hold such services must be explicitly given, even if they are organized by Bishops
RU&DUGLQDOVRULQFOXGHVXFKDVSDUWLFLSDQWV*LYHQDMXVWDQGSURSRUWLRQDWHUHDVRQWKH'LRFHVDQ
Bishop has the right to forbid even the participation of an individual Bishop.” Instruction on
Prayers for Healing , Norms Art. 4 §3.
53 67&DUSHQWHU³:KDW3HUFHLYHG%HQH¿WV'R+,93RVLWLYH3DWLHQWV2Q$QWLUHWURYLUDO7KHUDS\'HULYH
From Participation In A Local Church? The Experience of Patients at Valley Trust ARV Centre, KwaZulu
1DWDO´5HVHDUFKSDSHULQSDUWLDOIXO¿OPHQWRIGHJUHHRI0DVWHULQ7KHRORJ\3DVWRUDO7KHRORJ\6W
Augustine College of South Africa, 2007).
54 For a detailed presentation of these healing therapies see Bate, “Responsible Healing”, 157-161.
A Theological Model of Healing to Inform an Authentic Healing Ministry 89
Medical therapies are supported and promoted in the pastoral ministry of the
Catholic Church as long as they do not include methods destructive of human life,
such as abortion and stem cell harvesting from foetuses. Other Christian churches
KDYHGLIIHUHQWDSSURDFKHVWRWKHVHPDWWHUV0DQ\&KXUFK$,'6PLQLVWULHVSURPRWH
access to antiretroviral drugs.
Therapies based on caring for people are a powerful form of healing. Home-
based care programmes, orphan care programmes and the development of small
scale income generating projects such as food production have become a vital
DVSHFWRIKHDOLQJFDUH6XI¿FLHQWIRRGLQWDNHLVHVVHQWLDOZKHQWDNLQJDQWLUHWURYLUDO
drugs.
Therapies for psychic wellness use counselling and psychotherapy to
restore wellbeing to the patient. They promote emotional wellbeing, greater
understanding, and acceptance in patients regarding their situation. The psychic
integration of beliefs, values and behaviour promotes a lifestyle which reinforces
self-identity and self-esteem.
Therapies based on cultural symbols and rituals employ one of the main ways
in which healing is mediated to people. Ritual healing has the ability to effect
psychic and social healing for those people who accept the worldview and symbol
system of the culture. Ritual healing processes effect cultural healing by restoring
wholeness within the community.
Social and political therapies recognise that issues of healing are issues of
society and of politics. Society’s leaders are responsible for ensuring acceptable
healing structures in the country. They are responsible for ensuring effective
resource management in services. In its healing ministry, the Church has a role
in advocating for better healing structures and promoting effective Christian
solutions for prevention.
Spiritual therapies recognise the importance of supernatural factors in both
illness etiology and healing remedies. These can be described as the activity of
evil in malevolent spiritual beings as well as the consequences of immoral human
behaviour, usually understood as sin. Healing therapies include a spiritual response
– in the courage to face evil and defeat it. This can be expressed in many ways
such as casting out demons or evil spirits, confessing sin and receiving forgiveness,
sacramental healing in penance, the anointing of the sick, and prayer for the sick.
Conclusion
The seven challenges I have presented should help Church ministers and pastoral
workers play a vital role within parishes, church institutions and in society in
general. It has been important to emphasise that serious sickness always has social
90 Bate
and religious dimensions which affect different people in different ways. This
is because illness and healing are themselves cultural constructs affected by the
values and beliefs of people. The people of different backgrounds who make up a
country like South Africa have been brought up within different cultural systems
of illness and healing which inform their behaviour. Failure to recognise this and
deal with it creates confusion and militates against healing.
In urban areas many people live within a culture that fuses two or more of
these traditions within urban consumerism. This often leads to a mix and match
approach which tries various therapies until one is perceived to be effective.
7KLVFDQOHDGWRHYHQPRUHGLI¿FXOWLHVDVVRPHHIIHFWLYHWKHUDSLHVRIWHQOHDGWR
an initial worsening of symptoms, for example in the case of strong medicines.
Other therapies can create initial experiences of wellness which are followed by
a worsening of the illness as underlying causes are not dealt with.
In addition, pastoral workers and ministers who impose their own solutions
in an arbitrary way, loosely based on a consumerist approach of supply and
demand, may not succeed precisely because they have refused to properly
incarnate themselves into the social context of the world they minister within.
Consequently churches must pay attention to developing local healing ministries
which are informed by a theological anthropology that incorporates these cultural
systems. Such ministries must also ensure that they are founded on a biblical
hermeneutic which brings the ministry of Jesus and the apostles in their context,
into the world of today. Such a context is also founded on the teachings of the
church in which we live our faith commitment and not just our personal interest
and opinions. The theological and ministerial value of a complex and diverse
healing response to illnesses that are not easily healed cannot be emphasised
enough, since responsibility in religious and cultural healing should open us up
to the value of providing therapies and ministries on many different levels, not
just the medical.
A widened understanding of the healing ministry as presented here can do
a much better job of restoring the centrality of healing/saving to the centre of
Christian praxis, as it was in the mission of Jesus and the apostles. Just as they
therapeuo’d and sozo’d within their own cultural framework, so we are called
to the same kind of mission within our own: the complex cultural fabric of the
networked globalised world. We have noted that biblical scholars have recognised
that sozo is actually very broad in meaning, being based on an Aramaic term
with a twofold meaning: to make alive and make healthy. In this way it resonates
with the isiZulu term “Ukuphilisa”. The injunction from Jesus to his disciples in
Matthew 10:8 to heal the sick rendered in isiZulu as
Philisani abagulayo (bring life and health to the sick) seems to me to provide
a valuable metaphor for healing in the wide sense of healing ministries promoted
A Theological Model of Healing to Inform an Authentic Healing Ministry 91
here. It is a symbol from traditional Zulu culture, which has been received into
Zulu inculturated forms of Christianity. It reveals healing as incorporating
all of these elements and can be seen as a metaphor for healing in the global
community. It widens the notion of healing to look at praxis which brings a
fuller life to those who are ailing for whatever reason. This could be seen as an
example of inculturation where the gospel expressed in one culture illuminates all
Christianity. True inculturation is always about the universal consequences of the
SDUWLFXODULQFDUQDWLRQRIWKHZRUGRI*RGZLWKLQDVSHFL¿FFXOWXUH7KDWLVZK\
true inculturation always promotes the union of the universal church. It is also
why many expressions of Christianity, which began as local phenomena, have
FRPHWRKDYHXQLYHUVDOVLJQL¿FDQFH0RQDVWLFLVPWKH&HOWLFIRUPVRISHQDQFH
and Pentecostalism are but three examples of this.
3DVWRUDO ZRUNHUV KDYH D PLQLVWU\ WR SURPRWH VSHFL¿FDOO\ UHOLJLRXV KHDOLQJ
approaches, since religious categories respond to the limited areas of human power
where our ordinary ability to be on top of the situation is compromised. Praying
for healing is an essential ministry. In a time of pandemic and plague, the faith,
hope and love that we bring saves and heals people even when their bodies die
from the disease. Philisani abagulayo!