Notices

787 -- 887/21
T & P Notices in Force

ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 08
25 February 2021
(Published on the ADMIRALTY website 15 February 2021)

CONTENTS

I Explanatory Notes. Publications List

II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services

For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: navwarnings@ukho.gov.uk
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@ukho.gov.uk
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@ukho.gov.uk
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2021. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
intellectual.property@ukho.gov.uk
 I

GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS

ON THE UKHO WEBSITE

The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
admiralty.co.uk/msi or the searchable NM Website www.ukho.gov.uk/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.

NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.

Software required:

Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website (www.adobe.com).

SEARCHABLE NOTICES TO MARINERS

Enter the www.ukho.gov.uk/nmwebsearch website and select the search option that you require
following the on screen instructions:

ƒ Search NMs by - Chart Number only

ƒ Search NMs by - Chart Number + Previous NM Number/Year
ƒ Search NMs by - Chart Number + Between Previous and Present Dates
ƒ Search for Single NM by NM Number/Year

To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.

NOTICES TO MARINERS ON-LINE

Enter the admiralty.co.uk/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List

FURTHER GUIDANCE NOTES

For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
ƒ File content and description
ƒ PC and printer specifications

CUSTOMER SERVICE

If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:

Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: customerservices@ukho.gov.uk

Our Singapore team can also be contacted outside of UK hours on:

Tel: +65 6424 4200

Wk08/21 1.2
 ,

ADMIRALTY NOTICES TO MARINERS

7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10% LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH8.+27KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ  RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ 5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\

:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN13
IRUIXUWKHUGHWDLOV

7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV

Planning for the future

Plan with ADMIRALTY Maritime Data Solutions, brought to you by the United Kingdom Hydrographic Office.

Admiralty Way, Taunton, Somerset

TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
customerservices@ukho.gov.uk
gov.uk/ukho

Find out more about our market-leading

ADMIRALTY Maritime Data Solutions:
admiralty.co.uk

and are trademarks of the Secretary of State for Defence

© Crown Copyright 2020. All rights reserved. Correct at the time of publishing.

 Wk08/21
 I

EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as
this is held in greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon
information will be removed from new editions of each Sailing Direction volume, and AIS and Racon information present in
existing Sailing Direction volumes will no longer be updated. For accurate, up-to-date information on AIS and Racons, refer
to ADMIRALTY Radio Signals publications.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.

Wk08/21 1.4
 ,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJLQ6HFWLRQ9,WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13 $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN13JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13 $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
aWKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
bWKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQVXFKDVDQHZK\GURJUDSKLFVXUYH\LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN137KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO$'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1&YHUVLRQVRIFKDUWV

 Wk08/21
 I
[08/21]
ADMIRALTY Charts affected by the Publication List

ADMIRALTY Charts ADMIRALTY Charts International Charts

341 5125(7) INT 655

932 5125(8) INT 1424
933 5125(9) INT 1456
1076 5125(10)
1201 5125(11) ADMIRALTY Publication
1280 5125(12)
1368 8024 NP 88
1378 8030
1490 8031
1657 8057
1853 8112
2247 8113
2293 8181
4655 8227
4780 8236
5125(1) 8262
5125(2) DE 2
5125(3) DE 20
5125(4) JP 1064
5125(5)
5125(6)

UPDATE ON THE EFFECTS OF COVID-19 ON THE DELIVERY OF

NAUTICAL PUBLICATIONS

As a result of ongoing effects of COVID-19 on distribution infrastructure around the world, for
safety reasons, we took the decision a few months ago to delay the publication of any
non-essential ADMIRALTY Nautical Publications until further notice.
We started to ease the restrictions on the dispatch of some of our paper publications for
July 2020.
We are continuing this effort and following some positive feedback on successful receipts of
publications, we are now in a position to confirm the publications schedule for the rest of the year.
As previously, we will continue to closely monitor our distribution network capacities.
We reserve ourselves the right to amend this publications schedule accordingly should significant
dispatch issues start arising again.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk08/21 1.6
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 25 February 2021

Chart Title, limits and other remarks Scale Folio 2021 Catalogue
page

341 South China Sea, Macao to Hong Kong. 1:75,000 47 78

Includes significant safety-related information as follows: new submarine

cables.

Note: On publication of this New Edition former Notice 386(P)/21 is

cancelled. This chart remains affected by Notices 5172(T)/10, 3997(T)/12,
1948(P)/19, 5171(T)/19, 356(P)/21 and 614(T)/21.

932 Indonesia, Jawa - North Coast, Pelabuhan Tanjung Priok and Approaches. 46 66, 72
A Pelabuhan Tanjung Priok. 1:12,500
6° 04´·20 S. — 6° 07´·20 S., 106° 51´·50 E. — 106° 56´·00 E.
B Approaches to Pelabuhan Tanjung Priok. 1:30,000
5° 58´·40 S. — 6° 07´·00 S., 106° 49´·60 E. — 106° 57´·60 E.

Includes changes to depths and coastline. The limits of Panels A and B have
been changed. The title has been changed.

933 Indonesia, Jawa - North Coast, Approaches to Tanjung Priok. 1:55,000 46 66, 72

Includes changes to depths and coastline. The title has been changed.

1076 Wales - South Coast, Linney Head to Oxwich Point. 1:75,000 2 20

Continuation of Afon Tywi. 1:75,000

Includes changes to depths from the latest British Government surveys.

1201 China - Huang Hai, Guanhe Kou to Rizhao Gang. 1:120,000 52 82

Includes significant safety-related information as follows: a new light and

changes to fairway limit, buoyage and breakwater.

Note: On publication of this New Edition former Notice 357(P)/21 is

cancelled.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.7 Wk08/21
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 25 February 2021 (continued)

Chart Title, limits and other remarks Scale Folio 2021 Catalogue
page

2247 France - South Coast, Golfe de La Napoule and Golfe Juan including Îles de 1:15,000 25 42
Lérins and the Approaches to Cannes.
A Mandelieu - La Napoule and La Rague. 1:7,500
B Cannes Marina. 1:7,500
C Cannes. 1:7,500
D Port Pierre Canto. 1:7,500
E Ports de Golfe Juan. 1:7,500
F Port Gallice and Port du Crouton. 1:7,500

Includes significant safety-related information as follows: changes to

anchorage, anchoring prohibited areas and submarine cables. (A modified
reproduction of Chart 7205 published by France.)

Note: On publication of this New Edition former Notice 340(P)/21 is

cancelled.

2293 Korea - Russia – Japan, Northern Japan and Adjacent Seas. 1:1,500,000 55 82, 84, 86

Includes general updating throughout.

4655 International Chart Series, South Pacific Ocean, Mururoa to Ducie Island. 1:1,500,000 73 104
INT 655
Includes changes to depths and lines of equal magnetic variation for 2020.
(A modified reproduction of INT655 published by France.)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk08/21 1.8
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 25 February 2021 (continued)

Chart Title, limits and other remarks Scale Folio 2021 Catalogue
page

5125(1) Routeing Chart, South Atlantic Ocean, January 1:20,000,000 - 142

5125(2) Routeing Chart, South Atlantic Ocean, February 1:20,000,000 - 142

5125(3) Routeing Chart, South Atlantic Ocean, March 1:20,000,000 - 142

5125(4) Routeing Chart, South Atlantic Ocean, April 1:20,000,000 - 142

5125(5) Routeing Chart, South Atlantic Ocean, May 1:20,000,000 - 142

5125(6) Routeing Chart, South Atlantic Ocean, June 1:20,000,000 - 142

5125(7) Routeing Chart, South Atlantic Ocean, July 1:20,000,000 - 142

5125(8) Routeing Chart, South Atlantic Ocean, August 1:20,000,000 - 142

5125(9) Routeing Chart, South Atlantic Ocean, September 1:20,000,000 - 142

5125(10) Routeing Chart, South Atlantic Ocean, October 1:20,000,000 - 142

5125(11) Routeing Chart, South Atlantic Ocean, November 1:20,000,000 - 142

5125(12) Routeing Chart, South Atlantic Ocean, December 1:20,000,000 - 142

Meteorological data has been updated throughout these routeing charts,

including a new Chart index diagram. Principal ports, shipping routes,
ocean current flow and load line zones are also shown on the charts to
facilitate trans-oceanic passage planning. (All twelve monthly versions of the
chart are being published simultaneously.)

Reproductions of Japan Coast Guard Charts

(Publication dates of these charts reflect the dates shown on the Japan Coast Guard Charts)

Chart Published Title and other remarks Scale Folio 2021 Catalogue
page

JP1064 18/02/2021 Nippon, Honshu-South Coast, Irago Suido. 1:20,000 53 86

Includes changes to depths and fish traps.

Note: This chart remains affected by Notices 1609(T)/18 and

5095(T)/18.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.9 Wk08/21
 I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

ADMIRALTY Publications

NP No. Title and other remarks Date Remarks

NP88 ADMIRALTY List of Lights and Fog Signals 25/02/21 Updated to NM Week 03/21
Volume Q 2021 Edition 1 (07/01/21) First updates in NM
Eastern Indian Ocean, South of the Equator Including Java, Banda and week 08/21. Edition 1 supersedes
Timor Seas NP88 2020/21 Edition which is
cancelled.
ISBN No: 978-0-70-772-4263

ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 11 MARCH 2021

New Editions of ADMIRALTY Charts

Charts to be 2021
Chart Title, limits and other remarks Scale WITHDRAWN Folio Catalogue
page

1280 China - Bo Hai - Liaodong Wan, Approaches to Bayuquan Gangqu 1:50,000 1280 52 82
and Xianrendao Gangqu.

Includes general updating throughout.

1657 Greece - East Coast, Saronikós Kólpos. 1:100,000 1657 28 50

Includes general updating throughout.

1853 South America - West Coast, Peru, Approaches to Bahía Del Callao. 1:50,000 1853 98 114
Puerto Callo. 1:10,000

Includes significant safety related information as follow: updates to

anchorage areas.

4780 Canada, Québec/Quebec, Fjord du Saguenay/Saguenay Fjord , Cap 1:37,500 4780 79 130
Éternité à/to Saint-Fulgence.
Continuation A. 1:37,500
Baie des Ha! Ha! 1:15,000
Terminal Maritime de Grande-Anse. 1:10,000

Includes changes to depths and drying heights. (A modified

reproduction of chart 1202 published by Canada.)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk08/21 1.10
 I
CHARTS TO BE AVAILABLE 11 MARCH 2021

New Editions

Reproductions of German Government Charts

Charts to be 2021
Chart Title, limits and other remarks Scale WITHDRAWN Folio Catalogue
page

DE2 International Chart Series, North Sea – Germany, Approaches to 1:50,000 DE2 9 32
INT 1456 Rivers Jade, Weser and Elbe. INT 1456

Includes changes to depths, pilot boarding positions and

obstructions. (Published jointly by the UKHO and by the German
Hydrographic Office.)

DE20 International Chart Series, North Sea, Germany, Entrance to Rivers 1:30,000 DE20 9 32
INT 1424 Jade and Weser. INT 1424

Includes changes to depths, obstructions and buoyage. (Published

jointly by the UKHO and by the German Hydrographic Office.)

ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

341 South China Sea, Macao to Hong Kong. 341

932 Indonesia, Jawa - North Coast, Pelabuhan Tanjungpriok and Approaches. 932

933 Indonesia, Jawa - North Coast, Approaches to Tanjungpriok. 933

1076 Wales - South Coast, Linney Head to Oxwich Point. 1076

1201 China - Huang Hai, Guanhe Kou to Rizhao Gang. 1201

2247 France - South Coast, Golfe de La Napoule and Golfe Juan including Îles de 2247
Lérins and the approaches to Cannes.

2293 Korea - Russia – Japan, Northern Japan and Adjacent Seas. 2293

4655 International Chart Series, South Pacific Ocean, Mururoa to Ducie Island. 4655
INT 655 INT 655

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.11 Wk08/21
 I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts (continued)

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

5125(1) Routeing Chart, South Atlantic Ocean, January 5125(1)

5125(2) Routeing Chart, South Atlantic Ocean, February 5125(2)

5125(3) Routeing Chart, South Atlantic Ocean, March 5125(3)

5125(4) Routeing Chart, South Atlantic Ocean, April 5125(4)

5125(5) Routeing Chart, South Atlantic Ocean, May 5125(5)

5125(6) Routeing Chart, South Atlantic Ocean, June 5125(6)

5125(7) Routeing Chart, South Atlantic Ocean, July 5125(7)

5125(8) Routeing Chart, South Atlantic Ocean, August 5125(8)

5125(9) Routeing Chart, South Atlantic Ocean, September 5125(9)

5125(10) Routeing Chart, South Atlantic Ocean, October 5125(10)

5125(11) Routeing Chart, South Atlantic Ocean, November 5125(11)

5125(12) Routeing Chart, South Atlantic Ocean, December 5125(12)

JP1064 Nippon, Honshu-South Coast, Irago Suido. JP1064

INTENTION TO WITHDRAW CHARTS

It is proposed to withdraw without replacement, the following ADMIRALTY Charts:-

Chart to be Date of
WITHDRAWN Main Title withdrawal

1368 United States – Hawaii, Island of Oahu, Honolulu Harbor. 25 March 2021

1378 United States – Hawaii, Southern Part of Oahu. 25 March 2021

1490 North Pacific Ocean, Harbours in the Hawaiian Islands. 25 March 2021

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk08/21 1.12
 I
ADMIRALTY CHARTS INDEPENDENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be Date of
WITHDRAWN Main Title withdrawal

8024 Port Approach Guide, Savannah. 25 February 2021

Note: On withdrawal of this chart former Notices 5098(P)/19, 555(P)/21

and 617(P)/21 are cancelled.

8030 Port Approach Guide, Jacksonsville. 25 February 2021

Note: On withdrawal of this chart former Notices 5552(P)/15 and

4152(P)/20 are cancelled.

8031 Port Approach Guide, Mobile Bay. 25 February 2021

Note: On withdrawal of this chart former Notice 5454(P)/20 is cancelled.

8057 Port Approach Guide, New Orleans. 25 February 2021

Note: On withdrawal of this chart former Notices 5307(P)/17 and

2299(P)/19 are cancelled.

8112 Port Approach Guide, Tampa Bay. 25 February 2021

Note: On withdrawal of this chart former Notices 340(P)/16, 2821(P)/17,

4530(P)/18, 475(P)/20, 2133(P)/20 and 3776(P)/20 are cancelled.

8113 Port Approach Guide, Approaches to Tampa Bay. 25 February 2021

Note: On withdrawal of this chart former Notices 1349(P)/16, 474(P)/20,

2134(P)/20 and 5951(P)/20 are cancelled.

8181 Port Approach Guide, Port Everglades. 25 February 2021

Note: On withdrawal of this chart former Notices 3188(P)/16,

3140(P)/17, 3381(P)/17, 4333(P)/19 and 1592(P)/20 are cancelled.

8227 Port Approach Guide, Miami. 25 February 2021

Note: On withdrawal of this chart former Notices 4653(P)/17,

3941(P)/19, 4923(P)/19, 5406(P)/19 and 4504(P)/20 are cancelled.

8236 Port Approach Guide, Lake Charles. 25 February 2021

Note: On withdrawal of this chart former Notices 5202(P)/19, 6209(P)/19

and 308(P)/21 are cancelled. This chart is to be deleted from the list of
charts affected by Notice 4250(T)/19.

8262 Port Approach Guide, Brunswick. 25 February 2021

Note: On withdrawal of this chart former Notices 2298(P)/19 and

1544(P)/20 are cancelled.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.13 Wk08/21
 IA
TEMPORARY AND PRELIMINARY NOTICES
In Force 19 February 2021

(Former In Force List dated 22 January 2021 is cancelled)

Cancelled Notices

Area Notice No.

2 2758(T)/19, 3605(T)/19, 5600(T)/19, 197(T)/20, 373(T)/20, 1410(T)/20, 2999(T)/20, 4652(P)/20, 6218(T)/20
4 3607(T)/16, 6072(T)/18, 3553(T)/19, 6572(T)/19, 1138(T)/20, 2143(T)/20, 2374(T)/20, 3576(P)/20, 4231(T)/20,
4988(T)/20, 5691(T)/20, 5924(P)/20, 169(P)/21, 574(T)/21
5 1382(T)/19, 2666(P)/19, 1671(P)/20, 2199(P)/20, 5934(T)/20
6 1525(T)/18, 2122(T)/18, 931(T)/20, 933(T)/20, 2880(T)/20, 2909(T)/20, 4133(T)/20, 4577(T)/20, 4594(T)/20,
382(P)/21, 593(P)/21
7 1875(T)/20, 316(T)/21
8 189(T)/17, 2607(T)/17, 3690(T)/17, 3409(T)/19, 368(T)/20, 1589(P)/20, 5388(T)/20, 5439(T)/20, 206(P)/21,
340(P)/21, 639(P)/21
9 4509(P)/20
11 4177(T)/18, 5623(T)/20, 5788(T)/20
12 4552(P)/16, 1168(P)/19, 2697(T)/19, 3539(P)/20, 3958(T)/20, 4961(T)/20, 4968(T)/20, 567(T)/21, 568(P)/21
13 336(P)/21
14 4061(P)/18, 6237(P)/19, 2605(T)/20, 3222(P)/20, 5635(T)/20, 357(P)/21, 386(P)/21
15 2443(T)/17, 4745(T)/18, 4869(T)/18, 3519(T)/19, 1475(T)/20, 1784(T)/20, 2278(T)/20, 3946(T)/20, 4435(T)/20,
4721(P)/20, 5425(P)/20, 5532(T)/20, 5875(P)/20, 5876(T)/20, 6120(T)/20, 6262(P)/20, 128(P)/21, 129(P)/21,
131(P)/21, 257(T)/21
16 3133(T)/20, 149(T)/21
18 1998(T)/17, 3580(T)/20, 5708(T)/20, 84(T)/21, 461(T)/21
21 4279(P)/15, 6663(P)/15, 6664(P)/15, 2077(P)/16, 5379(P)/18, 2211(P)/19, 3368(P)/19, 4982(P)/20
22 86(P)/21
24 6159(P)/20
25 136(P)/16, 340(P)/16, 813(P)/16, 1349(P)/16, 5819(P)/16, 461(P)/17, 2807(P)/17, 2821(P)/17, 3557(P)/17,
4940(P)/17, 5307(P)/17, 2614(P)/18, 2695(P)/18, 3248(P)/18, 3692(P)/18, 4338(P)/18, 4530(P)/18, 5604(P)/18,
5948(P)/18, 2228(P)/19, 2299(P)/19, 2438(P)/19, 2960(P)/19, 3998(P)/19, 4678(P)/19, 5202(P)/19, 6209(P)/19,
474(P)/20, 475(P)/20, 1921(P)/20, 2096(P)/20, 2118(P)/20, 2133(P)/20, 2134(P)/20, 2781(P)/20, 3588(T)/20,
3672(P)/20, 3776(P)/20, 4161(P)/20, 5454(P)/20, 5771(T)/20, 5818(P)/20, 5951(P)/20, 6302(P)/20, 308(P)/21,
310(P)/21
26 5552(P)/15, 3188(P)/16, 3140(P)/17, 3381(P)/17, 4653(P)/17, 2298(P)/19, 3941(P)/19, 4333(P)/19, 4923(P)/19,
5098(P)/19, 5406(P)/19, 1544(P)/20, 1592(P)/20, 4152(P)/20, 4504(P)/20, 555(P)/21, 617(P)/21

No. of No- Charts affected Locality & Subject Folio(s)

tice

2. BRITISH ISLES
397(T)/14 2792 ......................
2521(P)/15 Q 6403, Q 6404......
5506(P)/15 8064 ......................
3304(P)/16 Q 6403, Q 6404......
5111(P)/16 8156 ......................
5769(P)/16 8264 ......................
5838(P)/16 8264 ......................
5959(P)/16 8264 ......................
6110(P)/16 8047 ......................
6113(P)/16 8197 ......................
6163(P)/16 8047 ......................
1178(P)/17 8123 ......................
1407(P)/17 8123 ......................
1986(P)/17 8263 ......................
IRELAND, West Coast: Light-beacons; Pontoon.............................................. 4
SCOTLAND, West Coast: Firing practice area ................................................. 350
ENGLAND, East Coast: Note............................................................................ 7
SCOTLAND, West Coast: Military practice areas ............................................ 350
ENGLAND, East Coast: Landmark................................................................... 8
WALES, South Coast: Note ............................................................................... 2
WALES, South Coast: General information ...................................................... 2
WALES, South Coast: Dredged area ................................................................. 2
ENGLAND, East Coast: Note............................................................................ 7
ENGLAND, South West Coast: Note ................................................................ 1
ENGLAND, East Coast: Note............................................................................ 7
SCOTLAND, East Coast: Harbour limit; Legends............................................ 6
SCOTLAND, East Coast: Note.......................................................................... 6
WALES, South Coast: Note ............................................................................... 2

1A.1
Wk08/21

2. BRITISH ISLES - continued
2066(P)/17 8263 ......................
2885(P)/17 8123 ......................
3748(P)/17 8271 ......................
4638(P)/17 8001 ......................
4820(P)/17 8271 ......................
4997(P)/17 8197 ......................
5048(P)/17 8156 ......................
3771(P)/18 871, 1902 .............
3869(P)/18 8156 ......................
4041(P)/18 8156 ......................
4059(P)/18 8067 ......................
503(P)/19 8290 ......................
614(T)/19 1447 ......................
647(P)/19 8264 ......................
1358(P)/19 8290 ......................
1379(P)/19 8263 ......................
2189(P)/19 8045 ......................
2349(P)/19 2480, 2498, 2528
2614(P)/19 8120 ......................
2688(T)/19 536 ........................
2900(T)/19 106, 1503, 1504 ..
3426(T)/19 2474 ......................
4196(P)/19 8095 ......................
4297(T)/19 2388 ......................
4447(P)/19 44, 267, 268, 1191,
1192, 1422, 1468,
1826, 1981, 2094,
2182A, 2182B,
2696, 4140, DE 50
4529(P)/19 2037 ......................
5024(P)/19 8279, 8280 ...........
5458(P)/19 1535 ......................
5544(T)/19 2022 ......................
5730(P)/19 2905 ......................
5785(P)/19 2702, 2725, 2767,
2792 ......................
5788(P)/19 8095 ......................
5832(P)/19 8095 ......................
6028(P)/19 2793 ......................
6271(P)/19 2628 ......................
6596(T)/19 1463, 1977 ...........
69(T)/20 2793 ......................
88(T)/20 442, 1267, 1613,
1900, 2655, 2656,
2675 ......................
97(T)/20 3273, 3274 ...........
418(T)/20 1777 ......................
445(P)/20 1125, 2667, 2704.
620(P)/20 8269 ......................
657(T)/20 175, 190 ...............
825(T)/20 1994, 2000 ...........
1569(P)/20 8280 ......................
1629(P)/20 2825 ......................
1651(P)/20 2209, 2480, 2498,
2528, 2534 ...........
IA
WALES, South Coast: Light .............................................................................. 2
SCOTLAND, East Coast: Restricted area; Legends.......................................... 6
SCOTLAND, Shetland Islands: Note ................................................................ 6
ENGLAND, East Coast: Jetty; Legend.............................................................. 7
SCOTLAND, Shetland Islands: Legends .......................................................... 6
ENGLAND, South West Coast: Note ................................................................ 1
ENGLAND, East Coast: Landmarks ................................................................. 8
ENGLAND, South Coast: Works....................................................................... 1
ENGLAND, East Coast: Jetty; Berth................................................................. 8
ENGLAND, East Coast: Note............................................................................ 8
IRELAND, East Coast: Note ............................................................................. 3
SCOTLAND, East Coast: Lights ....................................................................... 7
IRELAND, East Coast: Buoyage ....................................................................... 3
WALES, South Coast: Buoyage......................................................................... 2
SCOTLAND, East Coast: Legend ..................................................................... 7
WALES, South Coast: Light .............................................................................. 2
ENGLAND, East Coast: Pilot boarding place; Legend ..................................... 7
SCOTLAND, West Coast: Depths ..................................................................... 5
ENGLAND, Bristol Channel: Reported anchorage ........................................... 2
ENGLAND, South Coast: Wreck ...................................................................... 1
ENGLAND, East Coast: Offshore installation; Works ...................................... 7
SCOTLAND, West Coast: Pier; Works.............................................................. 5
IRELAND, East Coast: Maintained channel ..................................................... 3
SCOTLAND, West Coast: Scientific instruments ............................................. 5
IRISH SEA: Works; Submarine cables .............................................................. 3, 7, 9
ENGLAND, South Coast: Wreck ...................................................................... 1
SCOTLAND, Firth of Clyde: Radio reporting point ......................................... 2, 3
ENGLAND, East Coast: Depths ........................................................................ 7
ENGLAND, South Coast: Works; Lights .......................................................... 1
SCOTLAND, West Coast: Works; Pontoons; Dredging area; Reclamation area 5
IRELAND, West Coast: Works; Spoil ground ................................................... 4
IRELAND, East Coast: Notes............................................................................ 3
IRELAND, East Coast: Works; Jetty; Lights; RoRo; Reclamation area; Berth; 3
Dredging area .....................................................................................................
ENGLAND, South Coast: Depths; Works; Pontoons ........................................ 1
ENGLAND, South Coast: Maintained channels; Dredged areas; Depths; 1
Works; Jetty........................................................................................................
WALES, North Coast: Measuring instrument; Buoy......................................... 3
ENGLAND, South Coast: Buoy ........................................................................ 1
ENGLAND, South Coast: Buoyage................................................................... 1
WALES, South Coast: Buoy .............................................................................. 2
IRELAND, South Coast: Works ........................................................................ 2
IRELAND, West Coast: Submarine cable ......................................................... 4
IRELAND, North Coast: Lights; Buoy; Light-beacons..................................... 3
SCOTLAND, East Coast: Scientific instrument ................................................ 6, 7
SCOTLAND, West Coast: Pier .......................................................................... 3
SCOTLAND, Firth of Clyde: Note .................................................................... 3
SCOTLAND, Hebrides: Works.......................................................................... 5
SCOTLAND, West Coast: Depths; Drying height............................................. 5

1A.2
Wk08/21
 IA
2. BRITISH ISLES - continued
1667(T)/20 1413, 2011............ WALES, North Coast: Wrecks ........................................................................... 3
1684(P)/20 2011....................... WALES, North Coast: Light; Obstructions; Buoy; Works................................. 3
1728(T)/20 2, 1127, 4010, IRELAND, West Coast: Buoy............................................................................ 5, 6, 15,19
4011, 4014, 4102.
1755(T)/20 741 ........................ SCOTLAND, East Coast: Wreck....................................................................... 6
1872(T)/20 2210 ...................... SCOTLAND, West Coast: Scientific instruments; Buoyage ............................. 5
1878(P)/20 8290 ...................... SCOTLAND, East Coast: Restricted areas ........................................................ 7
1906(T)/20 1975, 3741 ........... ENGLAND, East Coast: Scientific instrument; Buoy ....................................... 7
1908(T)/20 2511, 2811............ IRELAND, North Coast: Scientific instruments; Buoyage ............................... 3
2002(P)/20 8279 ...................... SCOTLAND, Firth of Clyde: Pontoon .............................................................. 2
2456(P)/20 1794, 2209, 2210, SCOTLAND, West Coast: Depths ..................................................................... 5
2479, 2480, 2528
2532(T)/20 3496, 3497 ........... ENGLAND, East Coast: Works ......................................................................... 7
2604(P)/20 1934, 1935 ........... ENGLAND, East Coast: Safe vertical clearance ............................................... 7
2744(T)/20 2702, 2725, 2767, IRELAND, West Coast: Buoyage ...................................................................... 4
2792 ......................
2834(T)/20 1121, 1411, 1826, WALES, West Coast: Buoy; Automatic Identification System; Restricted area 3
1970, 1977 ...........
2848(P)/20 2290 ...................... ENGLAND, South Coast: Drying heights; Depths; Buoyage; Pontoon; Wreck 1
2868(P)/20 1503, 1504 ........... ENGLAND, East Coast: Depths; Wrecks .......................................................... 7
2917(T)/20 26, 1613, 3315 .... ENGLAND, South Coast: Obstructions ............................................................ 1
3151(T)/20 104, 107, 1190..... ENGLAND, East Coast: Buoyage ..................................................................... 7
3233(P)/20 3746 ...................... SCOTLAND, Firth of Clyde: Works; Lights ..................................................... 3
3310(T)/20 1267, 1613, 1900 ENGLAND, South Coast: Measuring instrument; Buoy ................................... 1
3350(T)/20 3496 ...................... ENGLAND, East Coast: Measuring instrument ................................................ 7
3360(P)/20 8156 ...................... ENGLAND, East Coast: Radio reporting point................................................. 8
3482(P)/20 223 ........................ SCOTLAND, East Coast: Wreck; Obstruction.................................................. 6
3704(T)/20 2 ............................ CELTIC SEA, Irish Sector: Scientific instruments ............................................ 6
3728(T)/20 2046 ...................... IRELAND, South Coast: Buoy .......................................................................... 2
3755(P)/20 8156 ...................... ENGLAND, East Coast: Restricted area ........................................................... 8
3758(T)/20 2131, 2221 ........... SCOTLAND, West Coast: Scientific instruments; Buoyage ............................. 3
3809(P)/20 8095 ...................... IRELAND, East Coast: Maintained channels; Pilot boarding places ................ 3
3862(T)/20 3741 ...................... ENGLAND, East Coast: Marine farms; Buoyage ............................................. 7
4054(P)/20 2611....................... ENGLAND, South Coast: Pilot boarding place................................................. 1
4079(T)/20 1406, 1504, 1610, ENGLAND, East Coast: Buoy........................................................................... 7, 9
1630 ......................
4165(P)/20 8095 ...................... IRELAND, East Coast: Notes............................................................................ 3
4172(P)/20 8280 ...................... SCOTLAND, Firth of Clyde: Note .................................................................... 3
4174(P)/20 1183, 2052............ ENGLAND, East Coast: Depth.......................................................................... 7
4224(P)/20 1463, 1977, 1978 WALES, North Coast: Depths............................................................................ 3
4331(T)/20 3319 ...................... ENGLAND, East Coast: Bridge ........................................................................ 8
4369(T)/20 3282, 3284 ........... SCOTLAND, Shetland Islands: Buoy; Current meter....................................... 6
4370(T)/20 3294 ...................... SCOTLAND, Shetland Islands: Current meter; Buoy....................................... 6
4385(T)/20 807, 808, 3140, CHANNEL ISLANDS, Guernsey: Buoyage; Measuring instruments .............. 16
3654 ......................
4386(T)/20 3281, 3282, 3283, SCOTLAND, Shetland Islands: Current meter; Buoy....................................... 6
3294 ......................
4507(T)/20 1410, 1411, 1468, IRELAND, East Coast: Scientific instruments; Buoyage.................................. 3
1787 ......................
4661(P)/20 31 .......................... ENGLAND, South Coast: Vertical clearances................................................... 1
4981(T)/20 1161....................... WALES, South Coast: Pier ................................................................................ 2
5062(T)/20 1772, 1787 ........... IRELAND, East Coast: Buoy ............................................................................ 3
5183(T)/20 2500, 2501 ........... SCOTLAND, West Coast: Scientific instrument ............................................... 5
5185(T)/20 1464 ...................... WALES, North Coast: Wreck ............................................................................ 3
5203(T)/20 104, 107, 1190, ENGLAND, East Coast: Radar beacon ............................................................. 7
2182A, 2182B......

1A.3
Wk08/21

2. BRITISH ISLES - continued
5240(P)/20 2, 190, 210, 1407,
1409, 1481, 2182B
5338(P)/20 1481 ......................
5378(T)/20 1610, 2052, 2692,
2693 ......................
5462(T)/20 1889, 1890 ...........
5551(T)/20 3294 ......................
5585(P)/20 2046 ......................
5762(P)/20 1415 ......................
5791(P)/20 2207, 2208 ...........
5804(T)/20 219, 1785, 1954,
2635, 2720 ...........
5806(T)/20 1151, 1152............
5864(T)/20 1951, 1953, 1978
5903(P)/20 2253 ......................
5905(T)/20 1954, 2162 ...........
5970(T)/20 2209, 2498, 2528
5983(T)/20 1410, 1512, 1971
6039(P)/20 8082 ......................
6128(T)/20 3282, 3284 ...........
6186(T)/20 323, 1406, 1610,
2449 ......................
6187(P)/20 1610 ......................
6238(P)/20 1757, 2209, 2210,
2479, 2480, 2498,
2534 ......................
6252(T)/20 1820, 3339 ...........
6264(P)/20 1267, 1613 ...........
6266(T)/20 219, 1127, 1128,
1785, 2635, 2720,
2721, 2722 ...........
51(T)/21 35, 2249 ...............
56(T)/21 190, 1407 .............
59(T)/21 1535, 1543 ...........
114(T)/21 108, 1190, 1503...
119(T)/21 3275 ......................
195(T)/21 2036, 2045 ...........
196(T)/21 1994, 3746 ...........
201(T)/21 1183, 1975, 3741,
3750 ......................
202(T)/21 2254, 2739 ...........
215(T)/21 1994 ......................
309(P)/21 8095 ......................
437(P)/21 26 ..........................
453(P)/21 223, 1077 .............
482(P)/21 8289 ......................
503(P)/21 1479 ......................
552(T)/21 2172, 2175, 2611,
2615 ......................
601(P)/21 1794, 2500, 2501,
2509 ......................
654(P)/21 8001 ......................
744(T)/21 2629, 2631 ...........
752(T)/21 2131, 2381 ...........
762(T)/21 1411, 1468............
775(T)/21 222, 1462 .............
823(T)/21 536, 1652, 2450,
2451 ......................
IA
SCOTLAND, East Coast: Works; Wind farm; Submarine power cable............ 6, 7
SCOTLAND, East Coast: Works ....................................................................... 6
ENGLAND, East Coast: Foul ............................................................................ 7
SCOTLAND, East Coast: Buoyage ................................................................... 6
SCOTLAND, Shetland Islands: Current meter; Buoy....................................... 6
IRELAND, South Coast: Depths; Buoyage; Bridge; Submarine pipeline......... 2
IRELAND, East Coast: Works........................................................................... 3
SCOTLAND, West Coast: Depths ..................................................................... 5
SCOTLAND, North Coast: Light ...................................................................... 5, 6
ENGLAND, Bristol Channel: Buoy .................................................................. 2
ENGLAND, West Coast: Scientific instruments; Buoyage ............................... 3
ENGLAND, South Coast: Buoyage; Works ...................................................... 1
SCOTLAND, North Coast: Measuring instruments; Buoyage; Depths ............ 6
SCOTLAND, West Coast: Measuring instrument ............................................. 5
WALES, West Coast: Buoy................................................................................ 3
ENGLAND, West Coast: Automatic Identification System .............................. 3
SCOTLAND, Shetland Islands: Buoy ............................................................... 6
ENGLAND, South East Coast: Buoy ................................................................ 1, 7, 9
ENGLAND, East Coast: Submarine power cables ............................................ 7
SCOTLAND, West Coast: Depths ..................................................................... 5
IRELAND, West Coast: Buoy............................................................................ 4
ENGLAND, South Coast: Depths...................................................................... 1
SCOTLAND, West Coast: Scientific instruments ............................................. 5, 6
SCOTLAND, Orkney Islands: Platform; Light ................................................. 6
SCOTLAND, East Coast: Scientific instruments .............................................. 6
ENGLAND, East Coast: Depth; Light............................................................... 7
ENGLAND, East Coast: Buoy........................................................................... 7
WALES, South Coast: Works; Buoy.................................................................. 2
ENGLAND, South Coast: Beacon..................................................................... 1
SCOTLAND, Firth of Clyde: Scientific instrument; Buoy ............................... 3
ENGLAND, East Coast: Measuring instruments; Buoyage .............................. 7
IRELAND, West Coast: Buoy............................................................................ 4
SCOTLAND, West Coast: Works; Buoyage...................................................... 3
IRELAND, East Coast: Automatic Identification System ................................. 3
ENGLAND, South Coast: Anchorage areas ...................................................... 1
SCOTLAND, East Coast: Depths ...................................................................... 6
SCOTLAND, East Coast: Notes ........................................................................ 7
SCOTLAND, East Coast: Obstructions; Depths; Drying heights ..................... 6
ENGLAND, South Coast: Works; Buoyage ...................................................... 1
SCOTLAND, West Coast: Depths ..................................................................... 5
ENGLAND, East Coast: Note............................................................................ 7
ENGLAND, South Coast: Light-beacon............................................................ 1
SCOTLAND, West Coast: Scientific instruments; Buoy................................... 3, 5
IRELAND, East Coast: Buoy ............................................................................ 3
SCOTLAND, East Coast: Works ....................................................................... 6
ENGLAND, South Coast: Wreck; Restricted area ............................................ 1
1A.4
Wk08/21

2. BRITISH ISLES - continued
851(P)/21 8095 ......................
3. NORTH RUSSIA, NORWAY, THE FÆROE ISLANDS AND ICELAND
4644(T)/12 2961 ......................
4973(T)/16 2966 ......................
3336(T)/18 2966 ......................
4351(T)/18 2966 ......................
1031(T)/19 2966 ......................
1959(P)/19 1429, 4101 ...........
6220(P)/19 3569 ......................
1697(P)/20 1427, 2182C,
2182D ...................
2191(T)/20 1427, 2182D ........
2774(T)/20 1427, 1428 ...........
3035(P)/20 1429 ......................
4398(T)/20 2683, 3136, 3137,
4010, 4100 ...........
4776(T)/20 2683 ......................
4860(T)/20 2683, 4100 ...........
5320(P)/20 259, 1402, 4140 ..
5927(T)/20 2683, 4010, 4100
6176(T)/20 2682, 2683, 3137,
4010 ......................
208(T)/21 1429, 4101 ...........
359(T)/21 2683 ......................
436(T)/21 1427 ......................
556(P)/21 1428, 1429, 1430,
2182D, 4101 ........
4. BALTIC SEA AND APPROACHES
2306(P)/16 811, 820................
248(T)/17 857 ........................
1679(T)/17 2018, 2054, 2816
3431(T)/17 2048, 2231, 2288
4165(T)/17 820 ........................
4859(T)/17 944 ........................
5308(P)/17 831, 832, 881 ......
477(T)/18 3800, 3863 ...........
3341(T)/18 902 ........................
4808(T)/18 811.........................
5393(T)/18 2292 ......................
333(T)/19 911.........................
729(T)/19 2115, 2945............
747(T)/19 894 ........................
1062(T)/19 2014, 2018, 2816
1070(T)/19 802 ........................
1364(T)/19 2014, 2018, 2040
1388(T)/19 800 ........................
2348(P)/19 902 ........................
2822(T)/19 857, 858 ...............
3389(T)/19 2215 ......................
3478(P)/19 2856 ......................
3740(T)/19 811, 820................
4290(T)/19 2264 ......................
4460(T)/19 875 ........................
5941(T)/19 902 ........................
6375(T)/19 2018, 2040 ...........
Wk08/21
IA
IRELAND, East Coast: Dredged depths ............................................................ 3
RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
RUSSIA, Barents Sea Coast: Mooring buoys.................................................... 14
RUSSIA, Barents Sea Coast: Jetties .................................................................. 14
RUSSIA, Barents Sea Coast: Buoy.................................................................... 14
RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
NORWAY, West Coast: Works; Submarine pipeline; Offshore installation....... 13
FØROYAR: Depths; Restricted area; Works; Light........................................... 15
NORWAY, West Coast: Works; Submarine pipeline.......................................... 6, 13
NORWAY, West Coast: Buoy............................................................................. 13
NORWAY, West Coast: Well.............................................................................. 13
NORWAY, West Coast: Submarine cable........................................................... 13
NORWEGIAN SEA, Svalbard: Measuring instruments.................................... 14, 15
NORWAY, North Coast: Buoy ........................................................................... 14
NORWAY, North Coast: Buoyage...................................................................... 14
NORWAY, South Coast: Submarine cable ......................................................... 7, 9, 10
NORWAY, North Coast: Measuring instruments ............................................... 14, 15
NORWEGIAN SEA, Svalbard: Measuring instruments.................................... 14, 15
NORWAY, West Coast: Measuring instruments................................................. 13
NORWAY, North Coast: Buoy ........................................................................... 14
NORWAY, West Coast: Buoy............................................................................. 13
NORWAY, West Coast: Traffic separation schemes; Two-way routes; 13
Recommended routes .........................................................................................
SWEDEN, East Coast: Works; Restricted area; Buoyage ................................. 10
SWEDEN, West Coast: Horizontal clearance; Works ....................................... 10
SWEDEN, East Coast: Measuring instruments ................................................. 10
LATVIA: Buoy................................................................................................... 10
SWEDEN, East Coast: Works; Buoyage ........................................................... 10
DENMARK, Islands: Leading line .................................................................... 10
SWEDEN, East Coast: Depths........................................................................... 10
FINLAND, West Coast: Depth .......................................................................... 11
DENMARK, Islands: Works; Buoyage.............................................................. 10
SWEDEN, East Coast: Works; Restricted area.................................................. 10
LATVIA: Works; Buoyage................................................................................. 10
SWEDEN, West Coast: Depths.......................................................................... 10
GERMANY, Baltic Coast: Restricted area ........................................................ 10
DENMARK, East Coast: Submarine pipelines; Buoyage ................................. 10
POLAND: Buoy................................................................................................. 10
SWEDEN, East Coast: Works............................................................................ 10
POLAND: Buoy; Automatic Identification System........................................... 10
SWEDEN, East Coast: Restricted area .............................................................. 10
DENMARK, Islands: Dredged depths; Submarine cable .................................. 10
SWEDEN, West Coast: Depths.......................................................................... 10
ESTONIA: Buoy ................................................................................................ 10
SWEDEN, East Coast: Submarine pipeline....................................................... 10
SWEDEN, East Coast: Restricted area; Bridge; Works; Buoyage .................... 10
RUSSIA, Baltic Sea Coast: Mooring buoys ...................................................... 11
SWEDEN, West Coast: Depth; Maximum authorised draught.......................... 10
DENMARK, Islands: Measuring instruments; Buoyage ................................... 10
POLAND: Buoy................................................................................................. 10
1A.5

4. BALTIC SEA AND APPROACHES - continued
6402(P)/19 2014, 2015, 2018,
2248, 2264, 2816,
2817, 2945 ...........
6569(T)/19 802 ........................
309(T)/20 2018, 2040, 2288
648(P)/20 5503 ......................
663(T)/20 2014, 2018, 2040,
2288, 2816 ...........
826(T)/20 2014, 2018 ...........
916(P)/20 2015, 2115, 2816,
2945 ......................
917(T)/20 857, 858 ...............
973(T)/20 2018, 2040 ...........
1264(T)/20 2248 ......................
1436(P)/20 940, 2583 .............
1763(P)/20 888 ........................
1839(T)/20 2276 ......................
1944(T)/20 902 ........................
1959(T)/20 857 ........................
2285(T)/20 2014, 2015, 2018,
2040, 2288, 2679,
2688 ......................
2316(T)/20 2612 ......................
2495(T)/20 810 ........................
2499(T)/20 2855 ......................
2501(T)/20 911.........................
2502(P)/20 845 ........................
2602(T)/20 2098, 3864 ...........
2793(T)/20 2276 ......................
2815(T)/20 2677 ......................
2825(T)/20 2227, 2241, 2248
2964(T)/20 2620, 3863 ...........
3318(T)/20 2014, 2018, 2040,
2816 ......................
3375(T)/20 877 ........................
3906(T)/20 2015, 2018, 2816
3907(T)/20 2843 ......................
3960(T)/20 2248, 3817, 3818
4144(P)/20 929 ........................
4366(T)/20 857 ........................
4446(T)/20 2354 ......................
4475(P)/20 810 ........................
4583(T)/20 847 ........................
4635(T)/20 811.........................
4640(T)/20 2241, 2248 ...........
4641(T)/20 2215, 2816, 2817
4672(P)/20 2276 ......................
4882(T)/20 798 ........................
4987(T)/20 891 ........................
5061(P)/20 902 ........................
5087(T)/20 2014, 2018 ...........
5211(T)/20 940 ........................
5617(T)/20 2227 ......................
5618(T)/20 2227 ......................
5645(T)/20 2452 ......................
IA
BALTIC SEA: Submarine pipelines .................................................................. 10, 11
SWEDEN, East Coast: Works; Berths ............................................................... 10
POLAND: Measuring instruments; Buoyage .................................................... 10
DENMARK, East Coast: Traffic separation schemes; Routeing measures; 10
Precautionary areas ............................................................................................
POLAND: Buoyage ........................................................................................... 10
POLAND: Measuring instruments..................................................................... 10
DENMARK, Islands: Works; Wind farm; Buoyage .......................................... 10
SWEDEN, West Coast: Depths.......................................................................... 10
POLAND: Buoy................................................................................................. 10
ESTONIA: Restricted area................................................................................. 11
DENMARK, Islands: Bridge; Channels; Buoyage; Restricted areas ................ 10
SWEDEN, East Coast: Works............................................................................ 10
LITHUANIA: Buoy ........................................................................................... 10
DENMARK, Islands: Depths............................................................................. 10
SWEDEN, West Coast: Maximum authorised draught...................................... 10
POLAND: Measuring instruments..................................................................... 10
FINLAND, West Coast: Fairways; Swept areas; Buoyage; Recommended 11
tracks ..................................................................................................................
SWEDEN, East Coast: Works; Bridges; Buoyage............................................. 10
SWEDEN, South Coast: Quay; Buoyage; Works .............................................. 10
SWEDEN, West Coast: Works........................................................................... 10
SWEDEN, East Coast: Works; Lights; Floodlights ........................................... 10
FINLAND, West Coast: Buoyage ...................................................................... 11
LITHUANIA: Measuring instrument ................................................................ 10
POLAND: Submarine pipelines; Buoyage; Restricted areas............................. 10
ESTONIA: Restricted area................................................................................. 10, 11
FINLAND, West Coast: Light............................................................................ 11
POLAND: Explosives dumping ground ............................................................ 10
SWEDEN, West Coast: Quay; Works ................................................................ 10
SWEDEN, South Coast: Measuring instruments............................................... 10
SWEDEN, East Coast: Maximum authorised draughts; Berths ........................ 10
FINLAND, South Coast: Spoil ground.............................................................. 11
DENMARK, East Coast: Works ........................................................................ 10
SWEDEN, West Coast: Berth ............................................................................ 10
GERMANY, Baltic Coast: Berth ....................................................................... 10
SWEDEN, East Coast: Submarine cables.......................................................... 10
SWEDEN, East Coast: Quay; Works ................................................................. 10
SWEDEN, East Coast: Depth ............................................................................ 10
ESTONIA: Restricted area................................................................................. 10, 11
ESTONIA: Buoy ................................................................................................ 10
LITHUANIA: Depths; Maintained channels; Works; Submarine pipeline ....... 10
SWEDEN, East Coast: Works............................................................................ 10
SWEDEN, East Coast: Buoy ............................................................................. 11
DENMARK, Islands: Works.............................................................................. 10
POLAND: Buoy; Automatic Identification System........................................... 10
DENMARK, Islands: Buoy ............................................................................... 10
ESTONIA: Depths ............................................................................................. 11
ESTONIA: Restricted area................................................................................. 11
POLAND: Works; Piles; Buoyage ..................................................................... 10
1A.6
Wk08/21

4. BALTIC SEA AND APPROACHES - continued
5799(T)/20 875 ........................
5964(T)/20 2218, 3818 ...........
6068(T)/20 2677, 2678 ...........
6305(T)/20 2218, 3818 ...........
83(T)/21 2452 ......................
427(P)/21 889 ........................
428(T)/21 857, 858 ...............
575(T)/21 837, 872 ...............
580(P)/21 259, 2014, 2018,
2040, 2816, 5503
600(T)/21 2276 ......................
635(T)/21 893, 2085 .............
666(P)/21 798, 2040, 2048,
2054, 2055, 2059,
2073, 2075, 2241,
2248, 2264, 2288,
3818, 3819 ...........
671(T)/21 811, 820................
686(P)/21 2117, 2942............
864(T)/21 2014, 2015, 2018,
2040, 2288, 2677,
2679, 2688 ...........
876(T)/21 893, 2085 .............
5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM
1994(P)/17 1632 ......................
66(P)/18 8011.......................
1256(P)/18 272, 274, 1405,
1422, 2182B,
2182C....................
1375(P)/18 8010 ......................
1766(P)/18 8010 ......................
2429(P)/18 268, 272, 273, 274,
278, 1191, 1192,
1405, 1427, 2182A,
2182B, 2182C,
4140 ......................
2800(P)/18 8231 ......................
4360(T)/18 128 ........................
4715(T)/18 207 ........................
428(P)/19 1872, 1874 ...........
1038(P)/19 1408, 1503, 2182A
1040(P)/19 8230 ......................
1516(P)/19 208 ........................
1648(T)/19 1457 ......................
1681(T)/19 128 ........................
1684(P)/19 8010 ......................
2320(T)/19 323, 1406, 1610,
1872, 1873, 2449
2741(P)/19 1406, 1630, 8297
2927(P)/19 1406, 1630, 1872,
1874, 2449, 8012,
8297 ......................
3321(P)/19 1402, 1422, 2182A,
2182B, 2182C,
3766, 4140, DE 50,
DE 87, DE 103.......
Wk08/21
IA
SWEDEN, West Coast: Depths; Virtual aid to navigation................................. 10
FINLAND, South Coast: Spoil ground.............................................................. 11
POLAND: Buoyage ........................................................................................... 10
FINLAND, South Coast: Buoyage .................................................................... 11
POLAND: Works; Buoyage............................................................................... 10
SWEDEN, East Coast: Buoyage........................................................................ 11
SWEDEN, West Coast: Works........................................................................... 10
SWEDEN, East Coast: Works; Quay ................................................................. 10
POLAND: Traffic separation schemes; Two-way routes; Inshore traffic zones 10
LITHUANIA: Buoy ........................................................................................... 10
SWEDEN, East Coast: Traffic separation scheme; Two-way routes................. 11
BALTIC SEA: Submarine cable ........................................................................ 10, 11
SWEDEN, East Coast: Quay; Works ................................................................. 10
DENMARK, Islands: Works; Restricted areas; Buoyage .................................. 10
POLAND: Measuring instruments..................................................................... 10
SWEDEN, East Coast: Restricted area .............................................................. 11
NORTH SEA, Netherlands Sector: Submarine pipeline.................................... 9
NETHERLANDS: Legend; Maritime limit ....................................................... 9
NORTH SEA, Norwegian Sector: Works; Submarine pipeline ......................... 6, 7, 9, 13
NETHERLANDS: Maritime limits.................................................................... 9
BELGIUM: Note................................................................................................ 9
NORTH SEA: Submarine power cable.............................................................. 6, 7, 13
NETHERLANDS: Restricted areas ................................................................... 9
BELGIUM: Moorings ........................................................................................ 9
NETHERLANDS: Restricted area; Buoyage; Light-beacon............................. 9
NETHERLANDS: Submarine power cable....................................................... 9
NORTH SEA, United Kingdom Sector: Works; Platform; Obstructions .......... 7
NETHERLANDS: Jetty; Lights......................................................................... 9
NETHERLANDS: Works; Jetty......................................................................... 9
NETHERLANDS: Pile ...................................................................................... 9
BELGIUM: Pontoon .......................................................................................... 9
NETHERLANDS: Buoyage .............................................................................. 9
BELGIUM: Wreck; Virtual aid to navigation .................................................... 1, 7, 9
BELGIUM: Works; Wind farm; Buoyage.......................................................... 7, 9
BELGIUM: Works; Wind farm; Buoyage.......................................................... 7, 9
NORTH SEA, Norwegian Sector: Works; Submarine cables............................ 6, 7, 9
1A.7
 IA
5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM - continued
3844(P)/19 1632, 2182A, NORTH SEA, Netherlands Sector: Works; Platform......................................... 7, 9
2182B, 4140, DE 50
4084(P)/19 8230 ...................... NETHERLANDS: Buoy.................................................................................... 9
5541(T)/19 1546 ...................... NETHERLANDS: Buoy.................................................................................... 9
5829(P)/19 1630, 8012, 8297 NORTH SEA, Netherlands Sector: Precautionary areas; Restricted areas ........ 9
6023(T)/19 110......................... NORTH SEA, Netherlands Sector: Buoy .......................................................... 9
442(P)/20 1402, 1405, 2182B, NORTH SEA, Norwegian Sector: Submarine cable.......................................... 6, 7, 9, 13
2182C, 4140, DE 50
451(T)/20 128 ........................ BELGIUM: Light; Obstruction; Buoy ............................................................... 9
940(P)/20 8010 ...................... BELGIUM: Notes .............................................................................................. 9
1049(P)/20 1422, 2182A, NETHERLANDS: Submarine power cable....................................................... 7, 9
2182B, 3766,
DE 50, DE 87,
DE 103 ...................
1196(P)/20 122, 125, 130, NETHERLANDS: Works; Wind farm ............................................................... 7, 9
1406, 1408, 1630,
1631, 8231, 8297
1688(P)/20 274, 292, 1405, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Offshore 6, 7, 13
1427, 2182C......... installation ..........................................................................................................
1693(T)/20 274, 1405, 2182C NORTH SEA, Norwegian Sector: Buoy............................................................ 6, 7, 13
1713(P)/20 8230 ...................... NETHERLANDS: Restricted area..................................................................... 9
1806(T)/20 207 ........................ NETHERLANDS: Works; Vertical clearance.................................................... 9
2088(P)/20 8015 ...................... NETHERLANDS: Note; Fixed point ................................................................ 9
2090(P)/20 8016 ...................... NETHERLANDS: Notes ................................................................................... 9
2606(T)/20 208 ........................ NETHERLANDS: Buoy.................................................................................... 9
2739(T)/20 DE 50, DE 87, GERMANY, North Sea Coast: Buoy; Fog signal .............................................. 9
DE 103 ...................
2750(P)/20 8010 ...................... BELGIUM: Note................................................................................................ 9
2778(T)/20 295, 1427, 1428 .. NORTH SEA, Norwegian Sector: Well ............................................................. 6, 13
2973(P)/20 8012 ...................... BELGIUM: Wind farm; Restricted area; Submarine power cable; Lights; 9
Works; Buoyage .................................................................................................
3000(P)/20 274, 292, 1405, NORTH SEA, Norwegian Sector: Works; Precautionary area .......................... 6, 7, 13
2182C....................
3078(T)/20 128, 8010 ............. BELGIUM: Works; Buoyage............................................................................. 9
3095(T)/20 1408, 1457, 1632, NETHERLANDS: Traffic separation schemes; Obstructions ........................... 7, 9
1633, DE 50, DE 87,
DE 90 .....................
3228(P)/20 8012 ...................... BELGIUM: Marine Reserves; Restricted areas; Mine laying practice area ...... 9
3570(P)/20 295, 1427, 1428, NORTH SEA, Norwegian Sector: Submarine cable.......................................... 6, 13
2182D ...................
4153(P)/20 8297 ...................... NETHERLANDS: Light; Automatic Identification System; Radar beacon...... 9
4462(P)/20 105, 106, 1408, NORTH SEA, United Kingdom Sector: Submarine pipelines; Platforms; 7
1503 ...................... Works .................................................................................................................
4568(T)/20 294, 295, 1427 .... NORTH SEA, Norwegian Sector: Buoy............................................................ 6, 13
4693(P)/20 8297 ...................... BELGIUM: Wind farm; Restricted area ............................................................ 9
4708(P)/20 8012 ...................... BELGIUM: Platform; Automatic Identification System; Radar beacon; Fog 9
signal; Restricted area ........................................................................................
5095(P)/20 8010 ...................... BELGIUM: Dredged areas; Dredged depths ..................................................... 9
5231(T)/20 267, 1422, DE 50 . NORTH SEA, Danish Sector: Measuring instruments ...................................... 7, 9
5401(T)/20 122, 130 ............... NORTH SEA, Netherlands Sector: Obstruction ................................................ 9
5410(P)/20 130, 1408, 1630, NORTH SEA, Netherlands Sector: Platform; Fog signal; Restricted area ........ 7, 9
1631 ......................
5644(T)/20 1187....................... NORTH SEA, United Kingdom Sector: Light................................................... 7
5681(T)/20 208 ........................ NETHERLANDS: Buoyage .............................................................................. 9
5690(P)/20 8010 ...................... NETHERLANDS: Maritime limits.................................................................... 9
5938(P)/20 292, 1405, 1427, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Submarine 6, 13
2182C.................... cable ...................................................................................................................

1A.8
Wk08/21

5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM - continued
5943(T)/20 1631, 1632, 1633,
2182A, 2182B,
DE 50, DE 87.........
5944(T)/20 110, 116, 266,
1633, DE 90 ..........
5968(P)/20 8016 ......................
5969(T)/20 420 ........................
6047(T)/20 1872, 1873, 1874,
2449 ......................
6191(T)/20 1457 ......................
67(P)/21 110, 122, 130, 207,
1406, 1408, 1630,
1631, 2182A.........
76(P)/21 8015, 8016 ...........
306(P)/21 8230 ......................
430(T)/21 116, 1872, 1874...
431(T)/21 126, 1546 .............
812(P)/21 420 ........................
6. FRANCE AND SPAIN, NORTH AND WEST COASTS, AND PORTUGAL
6155(P)/15 3224 ......................
2473(P)/16 8136 ......................
3270(P)/16 8133 ......................
5297(P)/16 8137 ......................
61(P)/17 8247 ......................
1657(P)/17 8136 ......................
3662(P)/17 8186 ......................
3927(P)/17 8136 ......................
907(P)/18 8136 ......................
1343(P)/18 8247 ......................
1512(T)/18 3220 ......................
2079(P)/18 8040 ......................
2083(P)/18 8137 ......................
4626(P)/18 8186 ......................
4937(P)/18 8247 ......................
5180(P)/18 3258 ......................
5353(P)/18 8163 ......................
5450(T)/18 2522, 2986 ...........
5803(T)/18 89, 3636 ...............
5805(P)/18 1764 ......................
5809(T)/18 91, 93 ...................
5831(T)/18 3634 ......................
476(T)/19 3257 ......................
534(P)/19 8179 ......................
708(T)/19 3220 ......................
1573(T)/19 2148, 2451, 2613
3320(T)/19 3259 ......................
3974(T)/19 3220, 3221 ...........
4331(P)/19 2350, 2356 ...........
5898(T)/19 83 ..........................
5900(T)/19 3259, 3260 ...........
6434(T)/19 83 ..........................
6438(T)/19 3228 ......................
421(T)/20 2148, 2451 ...........
924(P)/20 8247 ......................
929(P)/20 1142.......................
Wk08/21
IA
NETHERLANDS: Traffic separation scheme ................................................... 7, 9
NORTH SEA, Netherlands Sector: Measuring instruments; Buoyage .............. 7, 9
NETHERLANDS: Jetties; Coastline ................................................................. 9
DENMARK, North Sea Coast: Depth ............................................................... 9
BELGIUM: Buoy............................................................................................... 9
NETHERLANDS: Lights; Pile .......................................................................... 9
NETHERLANDS: Submarine power cable....................................................... 7, 9
NETHERLANDS: Dredged depths ................................................................... 9
NETHERLANDS: Coastline; Dredged areas .................................................... 9
NETHERLANDS: Explosive dumping ground ................................................. 9
NETHERLANDS: Buoy.................................................................................... 9
DENMARK, North Sea Coast: Restricted area; Buoyage ................................. 9
PORTUGAL, West Coast: Depths; Drying height............................................. 18
FRANCE, North Coast: Maritime limits; Legends; Coastline........................... 16
PORTUGAL, West Coast: Anchorage areas ...................................................... 18
PORTUGAL, West Coast: Coastline; Legends; Maritime limit ........................ 16
FRANCE, North Coast: Automatic Identification Systems ............................... 16
FRANCE, North Coast: Note............................................................................. 16
FRANCE, West Coast: Spoil grounds................................................................ 17
FRANCE, North Coast: Spoil ground................................................................ 16
FRANCE, North Coast: Obstructions ................................................................ 16
FRANCE, West Coast: Note .............................................................................. 16
PORTUGAL, West Coast: Buoyage .................................................................. 18
FRANCE, West Coast: Quay ............................................................................. 17
PORTUGAL, West Coast: Recommended track; Maritime limit ...................... 16
FRANCE, West Coast: Channel limits; Anchorage area; Note.......................... 17
FRANCE, West Coast: Buoy ............................................................................. 16
PORTUGAL, West Coast: Buoyage; Light-beacons ......................................... 18
FRANCE, North Coast: Light............................................................................ 16
FRANCE, West Coast: Measuring instruments ................................................. 17
PORTUGAL, South Coast: Scientific instrument.............................................. 18
SPAIN, West Coast: Depths; Maintained channel; Alongside depths................ 18
PORTUGAL, South Coast: Wreck..................................................................... 18
PORTUGAL, West Coast: Marine farm............................................................. 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
PORTUGAL, West Coast: Lights ...................................................................... 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
FRANCE, North Coast: Buoy; Automatic Identification System...................... 1, 16
PORTUGAL, West Coast: Buoy ........................................................................ 18
PORTUGAL, West Coast: Depths ..................................................................... 18
FRANCE, West Coast: Depths; Rock; Drying height........................................ 16
PORTUGAL, South Coast: Depth ..................................................................... 18
PORTUGAL, West Coast: Buoyage .................................................................. 18
PORTUGAL, South Coast: Depths.................................................................... 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
FRANCE, North Coast: Wreck; Restricted area ................................................ 1, 16
FRANCE, West Coast: Notes............................................................................. 16
SPAIN, North Coast: Lights; Coastline; Wrecks................................................ 17
1A.9

6. FRANCE AND SPAIN, NORTH AND WEST COASTS, AND PORTUGAL - continued
1357(T)/20 3259, 3635, 3636,
8160 ......................
1594(T)/20 73 ..........................
1609(P)/20 8092 ......................
2069(P)/20 8247 ......................
2876(T)/20 3635 ......................
2884(T)/20 3224 ......................
2912(T)/20 87, 3634, 4011,
4014, 4103 ...........
3248(P)/20 8164 ......................
3447(T)/20 83 ..........................
4135(T)/20 87, 3635, 4103 ....
4149(P)/20 2819, 2820 ...........
4162(P)/20 8160 ......................
4393(T)/20 2980 ......................
4517(T)/20 2028, 2029, 2648,
2669, 2675, 3659
4593(T)/20 3227 ......................
4636(P)/20 8164 ......................
4674(T)/20 2522, 2986, 2989,
8040 ......................
5099(T)/20 87, 3132, 3636 ....
5157(T)/20 2663, 2998, 2999
5505(T)/20 86, 88 ...................
5580(P)/20 3224, 3636, 8137
6045(P)/20 8040 ......................
6181(T)/20 3638 ......................
68(T)/21 323, 1872, 1873,
2449 ......................
69(T)/21 2522, 2986 ...........
279(T)/21 3224, 3636 ...........
325(T)/21 2980 ......................
402(P)/21 323, 1350, 1351,
1406, 1610, 1892,
2449, 8163, 8164
500(T)/21 3634 ......................
501(T)/21 3258 ......................
505(T)/21 3227 ......................
507(T)/21 3221, 3222 ...........
527(T)/21 3220 ......................
529(T)/21 3224 ......................
532(T)/21 89, 3636 ...............
563(P)/21 8164 ......................
597(T)/21 2986, 2989 ...........
788(P)/21 1175.......................
807(P)/21 2522, 2986 ...........
810(P)/21 20, 1104, 2522,
2663, 2997, 4103
7. NORTH ATLANTIC OCEAN
2974(T)/14 4407 ......................
1804(T)/19 1685, 1831 ...........
5962(T)/19 4012, 4013, 4216,
4407 ......................
IA
PORTUGAL, West Coast: Buoy; Automatic Identification System; Virtual aid 18
to navigation.......................................................................................................
SPAIN, South West Coast: Buoyage; Pier; Works ............................................. 18
SPAIN, South West Coast: Pilot boarding place ................................................ 20
FRANCE, West Coast: Note .............................................................................. 16
PORTUGAL, West Coast: Buoy ........................................................................ 18
PORTUGAL, West Coast: Scientific instrument ............................................... 18
PORTUGAL, West Coast: Buoy ........................................................................ 18, 19
FRANCE, North Coast: Notes ........................................................................... 16
PORTUGAL, South Coast: Alongside depth ..................................................... 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
FRANCE, West Coast: Depths; Drying height; Rock........................................ 17
PORTUGAL, West Coast: Buoy ........................................................................ 18
SPAIN, South West Coast: Works ...................................................................... 18
FRANCE, North Coast: Restricted area............................................................. 1, 16
PORTUGAL, West Coast: Buoyage .................................................................. 18
FRANCE, North Coast: Anchorage areas; Anchor berths; Maritime limits ...... 16
FRANCE, West Coast: Works............................................................................ 17
PORTUGAL, West Coast: Buoy ........................................................................ 18
FRANCE, West Coast: Measuring instruments; Buoyage................................. 17
SPAIN, South West Coast: Wreck; Works; Buoyage ......................................... 18
PORTUGAL, West Coast: Breakwater; Works; Buoyage; Light....................... 16, 18
FRANCE, West Coast: Automatic Identification Systems ................................ 17
FRANCE, West Coast: Buoyage........................................................................ 17
FRANCE, North Coast: Buoy............................................................................ 1, 9
FRANCE, West Coast: Restricted areas; Works ................................................ 17
PORTUGAL, West Coast: Scientific instrument ............................................... 18
SPAIN, South West Coast: Works; Buoyage...................................................... 18
FRANCE, North Coast: Pilotage ....................................................................... 1, 7, 9, 16
PORTUGAL, West Coast: Wreck ...................................................................... 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
PORTUGAL, West Coast: Buoy ........................................................................ 18
PORTUGAL, South Coast: Marine farm; Works; Buoyage .............................. 18
FRANCE, North Coast: Note............................................................................. 16
FRANCE, West Coast: Restricted area; Buoyage.............................................. 17
FRANCE, West Coast: Restricted area .............................................................. 18
FRANCE, West Coast: Submarine cable; Wind farm........................................ 17
FRANCE, West Coast: Submarine cable ........................................................... 16, 17, 18
NORTH ATLANTIC OCEAN: Sub-surface oceanographic buoys and 82
moorings.............................................................................................................
NORTH ATLANTIC OCEAN, Arquipélago da Madeira: Buoy ....................... 20
NORTH ATLANTIC OCEAN: Buoy ................................................................ 19, 82, 87
1A.10
Wk08/21
 IA
7. NORTH ATLANTIC OCEAN - continued
110(P)/20 306, 311, 595, 658, NORTH ATLANTIC OCEAN: Works; Submarine cables ................................ 18, 20, 34,
1381, 1383, 1384, 35
1385, 1684, 1685,
1771, 1831, 3100,
3118, 3432, 3635,
3636, 3859, 4138,
4146, 4148, 4150,
4151, 4152, 4175,
4176 ......................
1483(T)/20 529, 709, 716, 721, NORTH ATLANTIC OCEAN: Data buoys ....................................................... 19, 20, 32,
1510, 4104, 4115, 34, 35, 36,
4202, 4203, 4209, 38, 42, 43,
4215, 4216, 4510, 46, 53, 74,
4702, 4703, 4705, 87, 95
4706, 4707, 4714,
4809, IN 31, IN 33
1547(T)/20 1690, 3134 ........... NORTH ATLANTIC OCEAN: Buoy ................................................................ 20
2877(T)/20 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Buoy........................ 19
3448(T)/20 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Anchorage area........ 19
4148(P)/20 332, 334, 867, 868, NORTH ATLANTIC OCEAN, Bermuda: Depths; Drying heights ................... 82
1073, 1315 ...........
5648(P)/20 2, 20, 1104, 1123, NORTH ATLANTIC OCEAN: Submarine cable .............................................. 1, 2, 6, 16,
1148, 1149, 1156, 17, 78, 80,
1178, 1227, 2427, 81
2483, 2492, 2565,
2649, 2664, 2666,
2670, 4746 ...........
116(P)/21 2, 87, 305, 306, NORTH ATLANTIC OCEAN: Works............................................................... 1, 2, 6, 18,
307, 311, 312, 595, 20, 34, 35
1000, 1123, 1156,
1178, 1381, 1383,
1384, 1385, 1386,
1392, 1663, 1856,
1861, 1862, 2649,
3100, 3101, 3118,
3133, 3134, 3135,
3220, 3286, 3325,
3327, 3328, 3432,
3635, 3859, 4138,
4146, 4151, 4175,
4176, 4177, 4178
531(T)/21 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Platforms; Buoyage; 19
Works .................................................................................................................
760(T)/21 517, 4216 ............. NORTH ATLANTIC OCEAN: Platforms; Restricted area ............................... 87
8. MEDITERRANEAN AND BLACK SEAS
938(T)/12 2214, 2233 ........... RUSSIA, Black Sea Coast: Scientific instruments ............................................ 31
2188(T)/13 965 ........................ ITALY, Sicilia: Piers........................................................................................... 24
4821(T)/13 1578 ...................... MONTENEGRO: Buoy ..................................................................................... 27
5325(T)/15 183, 4300, 4302 .. CYPRUS: Scientific instruments ....................................................................... 24
1978(P)/16 8178 ...................... LEBANON: Wrecks........................................................................................... 30
2172(P)/16 8213 ...................... ITALY, East Coast: Restricted area; Works........................................................ 27
2640(P)/16 8052 ...................... CYPRUS: Marine Reserves ............................................................................... 30
3102(P)/16 8213 ...................... SLOVENIA: Marine Reserve ............................................................................ 27
4017(T)/16 1211....................... ITALY, Sardegna: Wreck; Restricted area.......................................................... 25
4211(T)/16 3318 ...................... RUSSIA, Black Sea Coast: Works; Buoyage..................................................... 31
5194(T)/16 2216 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
5398(T)/16 2233 ...................... RUSSIA, Black Sea Coast: Measuring instruments .......................................... 31
6529(P)/16 8226 ...................... ITALY, West Coast: Notes.................................................................................. 26

1A.11
Wk08/21
 IA
8. MEDITERRANEAN AND BLACK SEAS - continued
6572(P)/16 2203 ...................... UKRAINE: Legend............................................................................................ 31
992(P)/17 8009 ...................... FRANCE, South Coast: Radar beacon............................................................... 25
1046(P)/17 8178 ...................... LEBANON: Light; Buoy ................................................................................... 30
1260(P)/17 8017 ...................... GREECE, Aegean Sea Coast: Wreck; Buoy ...................................................... 28
1419(P)/17 8226 ...................... ITALY, West Coast: Lights................................................................................. 26
1854(P)/17 8161 ...................... MALTA: Note .................................................................................................... 24
1966(P)/17 8228 ...................... ITALY, East Coast: Light-beacon....................................................................... 27
2108(T)/17 3312 ...................... RUSSIA, Black Sea Coast: Scientific instruments; Mooring buoys.................. 31
2221(P)/17 8044 ...................... GREECE, Aegean Sea Coast: Note ................................................................... 28
2912(T)/17 1159, 1198............ TURKEY, İstanbul Boğazi: Buoyage................................................................. 29
3187(P)/17 8092 ...................... MOROCCO, North Coast: Dredged depths; Legends; Note ............................. 20
3363(P)/17 8226 ...................... ITALY, West Coast: Restricted area ................................................................... 26
3511(P)/17 8257 ...................... SPAIN, Mediterranean Sea Coast: Dredged areas ............................................. 25
3738(P)/17 3402 ...................... LIBYA: Anchorage areas; Submarine pipelines; Buoyage; Restricted area ...... 24
4311(P)/17 8225 ...................... ITALY, West Coast: Note ................................................................................... 26
4403(P)/17 8220 ...................... ITALY, West Coast: Breakwaters; Lights........................................................... 26
4926(T)/17 2242 ...................... UKRAINE: Buoy ............................................................................................... 31
5058(P)/17 8178 ...................... LEBANON: Works ............................................................................................ 30
5712(T)/17 1996 ...................... CROATIA: Buoyage .......................................................................................... 27
5788(P)/17 8178 ...................... LEBANON: Works ............................................................................................ 30
236(P)/18 8052 ...................... CYPRUS: Note .................................................................................................. 30
741(P)/18 167, 176 ............... TUNISIA: Platform; Restricted area.................................................................. 24
830(T)/18 2234 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
915(P)/18 5506 ...................... TURKEY, İstanbul Boğazi: Lights; Radar beacons; Legend; Safe vertical 29
clearances ...........................................................................................................
1027(P)/18 8034 ...................... MALTA: Restricted area .................................................................................... 24
1676(P)/18 8213 ...................... ITALY, East Coast: Light ................................................................................... 27
2084(P)/18 8274 ...................... ITALY, West Coast: Note ................................................................................... 26
2384(P)/18 8091 ...................... ISRAEL, Mediterranean Sea Coast: Pilot boarding places................................ 30
2683(T)/18 2166 ...................... FRANCE, South Coast: Buoyage; Restricted areas........................................... 25
3086(P)/18 8161 ...................... MALTA: Legends............................................................................................... 24
3440(T)/18 2242 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
3459(P)/18 8121 ...................... TURKEY, Marmara Denizi: Note...................................................................... 29
4297(P)/18 8240 ...................... ITALY, Sicilia: Light-beacon ............................................................................. 24
4393(P)/18 8121 ...................... TURKEY, Marmara Denizi: Works ................................................................... 29
4429(P)/18 8235 ...................... ITALY, West Coast: Light .................................................................................. 26
4430(P)/18 8091 ...................... ISRAEL, Mediterranean Sea Coast: Routeing measures ................................... 30
4536(T)/18 1159, 1198............ TURKEY, İstanbul Boğazi: Buoy ...................................................................... 29
4539(T)/18 1055, 1644 ........... TURKEY, West Coast: Buoy ............................................................................. 29, 30
4669(T)/18 2242 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
4811(P)/18 8241 ...................... FRANCE, South Coast: Legend ........................................................................ 25
4852(T)/18 1580 ...................... CROATIA: Buoy................................................................................................ 27
4997(T)/18 1158, 3930............ TURKEY, Black Sea Coast: Buoy ..................................................................... 29, 31
5134(P)/18 8017, 8234 ........... GREECE, Aegean Sea Coast: Note ................................................................... 28
5141(P)/18 8017 ...................... GREECE, Aegean Sea Coast: Note ................................................................... 28
5605(P)/18 8225 ...................... ITALY, West Coast: Note ................................................................................... 26
5625(T)/18 140 ........................ ITALY, East Coast: Restricted area .................................................................... 27
6126(T)/18 2203 ...................... UKRAINE: Works ............................................................................................. 31
65(P)/19 8225 ...................... ITALY, West Coast: Light-beacon...................................................................... 26
376(T)/19 2216, 2242 ........... RUSSIA, Black Sea Coast: Light-beacon.......................................................... 31
713(T)/19 2284 ...................... ROMANIA: Buoy.............................................................................................. 31
1195(P)/19 5506, 5507, 8121 TURKEY, Marmara Denizi: Pilotage................................................................. 29
1218(P)/19 8235 ...................... ITALY, West Coast: Depths; Buoy; Submarine pipelines; Reclamation area; 26
Light; Works; Restricted area.............................................................................
1231(P)/19 8034, 8161 ........... MALTA: Buoy; Automatic Identification System ............................................. 24
1250(P)/19 5507 ...................... TURKEY, Çanakkale Boğazi: Routeing measures ............................................ 29
1464(T)/19 954 ........................ ITALY, West Coast: Works; Submarine pipeline ............................................... 26

1A.12
Wk08/21

8. MEDITERRANEAN AND BLACK SEAS - continued
1568(T)/19 1591, 8091 ...........
1649(P)/19 8017 ......................
1659(T)/19 3318 ......................
1665(P)/19 8121 ......................
1694(P)/19 8121 ......................
1845(P)/19 8240 ......................
1846(P)/19 8240 ......................
1853(T)/19 2216, 2242 ...........
1887(T)/19 2282, 2284 ...........
2144(P)/19 8091 ......................
2199(P)/19 8017 ......................
2203(P)/19 3313, 3317 ...........
2432(P)/19 8017 ......................
2717(P)/19 8017 ......................
3088(T)/19 1569, 2122 ...........
3125(P)/19 497 ........................
3596(P)/19 8009 ......................
3604(P)/19 1683 ......................
3881(P)/19 8092 ......................
4085(P)/19 8239 ......................
4102(P)/19 8009 ......................
4366(P)/19 1445 ......................
4672(P)/19 8044 ......................
4674(P)/19 8161 ......................
4697(T)/19 1417 ......................
4719(P)/19 8161 ......................
5310(T)/19 1426 ......................
5442(P)/19 8240 ......................
5447(P)/19 8226 ......................
5463(P)/19 8061 ......................
5467(T)/19 1710 ......................
5794(P)/19 8017 ......................
5822(P)/19 8121 ......................
6018(P)/19 8092 ......................
6117(P)/19 8257 ......................
6311(T)/19 252 ........................
6397(P)/19 2214, 2216, 2217,
2232, 2233, 2234,
2242 ......................
6406(T)/19 2284 ......................
6519(T)/19 9 ............................
513(P)/20 8210 ......................
611(T)/20 1996, 2719 ...........
626(T)/20 3403 ......................
679(T)/20 36 ..........................
900(P)/20 8277 ......................
1147(T)/20 1585 ......................
1189(T)/20 183, 2634 .............
1294(P)/20 8240 ......................
1352(T)/20 964 ........................
1409(T)/20 580 ........................
1526(T)/20 966, 973 ...............
IA
ISRAEL, Mediterranean Sea Coast: Buoy......................................................... 30
GREECE, Aegean Sea Coast: Wreck................................................................. 28
RUSSIA, Black Sea Coast: Buoy....................................................................... 31
TURKEY, Marmara Denizi: Note...................................................................... 29
TURKEY, Marmara Denizi: Legends ................................................................ 29
ITALY, Sicilia: Restricted area........................................................................... 24
ITALY, Sicilia: Restricted area; Pontoon ........................................................... 24
RUSSIA, Black Sea Coast: Anchorage area ...................................................... 31
ROMANIA: Dredged area; Spoil ground .......................................................... 31
ISRAEL, Mediterranean Sea Coast: Automatic Identification System; Buoy... 30
GREECE, Aegean Sea Coast: Wrecks ............................................................... 28
GEORGIA: Depths ............................................................................................ 31
GREECE, Aegean Sea Coast: Maritime limits; Floating docks; Wreck; Buoy; 28
Legend................................................................................................................
GREECE, Aegean Sea Coast: Wrecks ............................................................... 28
TUNISIA: Foul .................................................................................................. 24
TURKEY, Marmara Denizi: Traffic separation scheme .................................... 29
FRANCE, South Coast: Restricted area; Legend .............................................. 25
GREECE, Aegean Sea Coast: Dredging area; Works ........................................ 28
MOROCCO, North Coast: Works; Breakwater; Lights..................................... 20
ITALY, West Coast: Maritime limit; Unsurveyed area; Floating dock; Mooring 26
buoy....................................................................................................................
FRANCE, South Coast: Note............................................................................. 25
ITALY, East Coast: Dredged area ...................................................................... 27
GREECE, Aegean Sea Coast: Note ................................................................... 28
MALTA: Note .................................................................................................... 24
ITALY, South Coast: Measuring instruments..................................................... 27
MALTA: Legends............................................................................................... 24
SLOVENIA: Works ........................................................................................... 27
ITALY, Sicilia: Radar beacon............................................................................. 24
ITALY, West Coast: Lights................................................................................. 26
ISRAEL, Mediterranean Sea Coast: Channels; Pilot boarding place; Buoyage; 30
Anchor berths; Swinging circles ........................................................................
ALGERIA: Buoy ............................................................................................... 24
GREECE, Aegean Sea Coast: Wrecks; Legend ................................................. 28
TURKEY, Marmara Denizi: Buoy; Wreck ........................................................ 29
MOROCCO, North Coast: Dredged depths; Works; Depths; Alongside depths; 20
Light-beacons; Dredged areas............................................................................
SPAIN, Mediterranean Sea Coast: Anchorage areas; Channels; Pilot boarding 25
place ...................................................................................................................
ALGERIA: Obstruction; Buoy .......................................................................... 24
UKRAINE: General information ....................................................................... 31
ROMANIA: Buoyage ........................................................................................ 31
TUNISIA: Buoyage; Channel ............................................................................ 24
ITALY, East Coast: Restricted areas .................................................................. 27
CROATIA: Buoy................................................................................................ 27
TUNISIA: Wreck ............................................................................................... 24
MALTA: Wreck; Buoy....................................................................................... 24
GIBRALTAR: Legend ....................................................................................... 18
ISRAEL, Mediterranean Sea Coast: Buoy; Wreck ............................................ 30
ISRAEL, Mediterranean Sea Coast: Works; Submarine pipeline...................... 24, 30
ITALY, Sicilia: Restricted areas ......................................................................... 24
ITALY, Sicilia: Obstruction................................................................................ 24
MOROCCO, North Coast: Works; Buoy ........................................................... 24
ITALY, Sicilia: Works ........................................................................................ 24

1A.13
Wk08/21
 IA
8. MEDITERRANEAN AND BLACK SEAS - continued
1635(T)/20 2203 ...................... UKRAINE: Buoyage ......................................................................................... 31
1696(T)/20 1180....................... SPAIN, Mediterranean Sea Coast: Buoyage ...................................................... 25
1721(T)/20 1585 ...................... ISRAEL, Mediterranean Sea Coast: Buoy......................................................... 30
2139(P)/20 8052 ...................... CYPRUS: Harbour limit .................................................................................... 30
2210(T)/20 2282 ...................... ROMANIA: Wreck ............................................................................................ 31
2248(T)/20 954, 8274 ............. ITALY, West Coast: Port development; Works; Buoyage .................................. 26
2257(P)/20 8228 ...................... ITALY, East Coast: Buoyage.............................................................................. 27
2560(T)/20 966, 973 ............... ITALY, Sicilia: Works ........................................................................................ 24
2659(P)/20 1019 ...................... ITALY, West Coast: Depths................................................................................ 26
2820(T)/20 2205, 2243 ........... UKRAINE: Buoyage ......................................................................................... 31
2972(P)/20 2284 ...................... ROMANIA: Depth information......................................................................... 31
3069(P)/20 8017 ...................... GREECE, Aegean Sea Coast: Light................................................................... 28
3109(P)/20 8017 ...................... GREECE, Aegean Sea Coast: Legend ............................................................... 28
3147(P)/20 8061 ...................... ISRAEL, Mediterranean Sea Coast: Works ....................................................... 30
3265(T)/20 200, 1443 ............. ITALY, East Coast: Moored storage tanker; Restricted area.............................. 27
3314(T)/20 1591, 2634 ........... ISRAEL, Mediterranean Sea Coast: Restricted area.......................................... 30
3463(T)/20 167, 176, 1439, MEDITERRANEAN SEA: Light-vessel ........................................................... 24
2124 ......................
3527(T)/20 186, 188, 1590 .... ALBANIA: Buoy ............................................................................................... 27
3563(T)/20 1590 ...................... ALBANIA: Depths ............................................................................................ 27
4110(T)/20 1417 ...................... ITALY, South Coast: Works ............................................................................... 27
4143(T)/20 3034, 3035 ........... SPAIN, Islas Baleares: Light-beacons; Works; Beacons; Buoyage ................... 25
4196(T)/20 580 ........................ MOROCCO, North Coast: Works; Dolphin; Buoyage ...................................... 24
4559(T)/20 8178 ...................... LEBANON: Berths; Wrecks .............................................................................. 30
4744(P)/20 1426, 1461 ........... SLOVENIA: Works ........................................................................................... 27
4805(T)/20 2284 ...................... ROMANIA: Works ............................................................................................ 31
5186(T)/20 3403 ...................... TUNISIA: Wrecks.............................................................................................. 24
5187(P)/20 355, 8225 ............. ITALY, West Coast: Depths; Foul ...................................................................... 26
5235(T)/20 2242 ...................... RUSSIA, Black Sea Coast: Works ..................................................................... 31
5237(T)/20 3318 ...................... RUSSIA, Black Sea Coast: Works; Light-beacons ............................................ 31
5326(P)/20 812 ........................ ALGERIA: Depths; Lights; Works .................................................................... 24
5448(P)/20 1636 ...................... GREECE, Aegean Sea Coast: Depths; Obstructions; Buoyage ......................... 29
5506(T)/20 144, 1448 ............. SPAIN, Mediterranean Sea Coast: Buoy............................................................ 18
5622(P)/20 2214, 2230, 2232 ROMANIA: Submarine pipeline ....................................................................... 31
5926(P)/20 1443 ...................... ITALY, East Coast: Works; Piers; Breakwaters ................................................. 27
6140(P)/20 1208, 8265 ........... ITALY, Sardegna: Traffic separation schemes; Anchorage areas....................... 25
6152(P)/20 354 ........................ ITALY, West Coast: Depths................................................................................ 26
6180(P)/20 1563 ...................... LEBANON: Jetty; Works................................................................................... 30
384(T)/21 3313 ...................... GEORGIA: Marine farm.................................................................................... 31
451(T)/21 473, 1700 ............. SPAIN, Mediterranean Sea Coast: Marine farm; Buoyage................................ 25
747(P)/21 966, 8240 ............. ITALY, Sicilia: Anchor berths ............................................................................ 24
9. AFRICA, WEST COAST AND SOUTH ATLANTIC
3064(T)/13 3101 ...................... IVORY COAST: Wreck ..................................................................................... 34
4735(P)/14 607 ........................ SENEGAL: Depths ............................................................................................ 20
4221(P)/15 8060 ...................... SENEGAL: Wreck ............................................................................................. 20
4498(T)/15 1664 ...................... SENEGAL: Wreck ............................................................................................. 20
4753(P)/15 8060 ...................... SENEGAL: Note................................................................................................ 20
1084(P)/16 8060 ...................... SENEGAL: Pilot boarding place ....................................................................... 20
4227(P)/16 8060 ...................... SENEGAL: Automatic Identification Systems.................................................. 20
4457(P)/16 8192 ...................... GUINEA: Light.................................................................................................. 20
5148(P)/16 8147 ...................... CONGO: Restricted area; Note.......................................................................... 34
875(P)/17 8192 ...................... GUINEA: Buoy; Radar beacon; Leading line ................................................... 20
3033(P)/17 8147 ...................... CONGO: Note.................................................................................................... 34
5782(P)/17 8192 ...................... GUINEA: Dredged depths ................................................................................. 20
1277(T)/18 601, 1147.............. GUINEA: Barge................................................................................................. 20
3504(T)/18 1699 ...................... MAURITANIA: Buoyage .................................................................................. 20

1A.14
Wk08/21

9. AFRICA, WEST COAST AND SOUTH ATLANTIC - continued
5016(T)/18 306, 307 ...............
6173(P)/18 8035 ......................
231(T)/19 1322 ......................
2511(P)/19 8035 ......................
3718(T)/19 1661, 1699 ...........
4298(T)/19 3859, 4175, 4176
5265(T)/19 1661, 3134 ...........
5317(T)/19 1661, 1690, 1699,
3134 ......................
5780(P)/19 3103, 8035 ...........
5787(P)/19 3103, 8035 ...........
6179(P)/19 1661, 1690, 1699
1389(T)/20 4137, 4138 ...........
2045(T)/20 1000, 1001 ...........
2262(P)/20 1661, 1690, 1699
2294(T)/20 1383 ......................
2885(T)/20 1000, 1001 ...........
3080(T)/20 659 ........................
4392(P)/20 856, 860, 861,
3132, 3133, 8251
4993(P)/20 8251 ......................
5473(P)/20 3103, 8035 ...........
173(P)/21 1562 ......................
877(P)/21 3103 ......................
10. AFRICA, SOUTH AND EAST COASTS, AND MADAGASCAR
1102(P)/15 8005 ......................
3022(P)/15 8005 ......................
5638(P)/17 8038 ......................
5863(P)/17 8038 ......................
209(T)/18 4153, 4155 ...........
576(T)/18 1236, 4142, 8038
1073(P)/18 8027 ......................
1103(P)/18 8027 ......................
2060(T)/18 643, 4170, 8005 ..
4924(P)/18 663, 3310, 3361 ..
210(T)/19 643, 8005 .............
403(T)/19 4142 ......................
1875(T)/19 2078, 4177 ...........
2589(T)/19 1846, 8025 ...........
2590(T)/19 4158, 8021 ...........
2591(T)/19 4162 ......................
2592(T)/19 4174, 8019 ...........
6161(P)/19 663 ........................
6566(T)/19 1236, 4142 ...........
42(P)/20 668 ........................
632(P)/20 8027 ......................
939(P)/20 8027 ......................
1714(P)/20 3530 ......................
3553(T)/20 1236, 1922, 4142,
4145, 4146, 4150,
4151, 4152, 4153,
4154, 4155 ...........
3835(P)/20 8027 ......................
3992(P)/20 8021 ......................
Wk08/21
IA
ANGOLA: Buoy ................................................................................................ 34
IVORY COAST: Legend ................................................................................... 34
GABON: Buoyage ............................................................................................. 34
IVORY COAST: Wreck; Obstructions; Anchor berth ....................................... 34
MAURITANIA: Wreck...................................................................................... 20
NAMIBIA: Scientific instruments ..................................................................... 34
MAURITANIA: Wreck...................................................................................... 20
MAURITANIA: Wreck; Restricted area............................................................ 20
IVORY COAST: Works; Buoyage; Light .......................................................... 34
IVORY COAST: Works; RoRo; Buoyage; Automatic Identification System; 34
Wreck .................................................................................................................
MAURITANIA: Works; Spoil grounds.............................................................. 20
NAMIBIA: Radar beacon .................................................................................. 34
SENEGAL: Depths ............................................................................................ 20
MAURITANIA: Depths; Wrecks; Obstructions; Dredged area......................... 20
GHANA: Fog signal; Superbuoy ....................................................................... 34
SENEGAL: Works ............................................................................................. 20
ANGOLA: Buoy ................................................................................................ 34
MOROCCO, West Coast: Buoyage; Lights; Radar beacon ............................... 18, 20
MOROCCO, West Coast: Works ....................................................................... 20
IVORY COAST: Works ..................................................................................... 34
GUINEA: Depths; Maintained channel ............................................................. 20
IVORY COAST: Works; Bridge ........................................................................ 34
SOUTH AFRICA, East Coast: Restricted area; Dredged area .......................... 35
SOUTH AFRICA, East Coast: Buoy ................................................................. 35
SOUTH AFRICA, West Coast: Restricted area; Submarine pipeline; Buoyage; 35
Depths ................................................................................................................
SOUTH AFRICA, West Coast: Note ................................................................. 35
SOUTH AFRICA, South Coast: Buoy............................................................... 35
SOUTH AFRICA, South Coast: Wreck ............................................................. 35
KENYA: Note .................................................................................................... 36
KENYA: Storage tanker; Legend....................................................................... 36
SOUTH AFRICA, East Coast: Buoy ................................................................. 35
TANZANIA: Depths; Lights; Buoyage; Beacons; Leading line; Submarine 36
pipelines; Jetty; Rocks........................................................................................
SOUTH AFRICA, East Coast: Depths............................................................... 35
SOUTH AFRICA, West Coast: Depth ............................................................... 35
SOUTH AFRICA, West Coast: Current meters ................................................. 34
SOUTH AFRICA, West Coast: Depths; Dredged depths .................................. 35
SOUTH AFRICA, South Coast: Depth.............................................................. 35
SOUTH AFRICA, South Coast: Depths ............................................................ 35
SOUTH AFRICA, East Coast: Depths............................................................... 35
TANZANIA: Buoyage; Light-beacons; Works.................................................. 36
SOUTH AFRICA, West Coast: Rocks; Depths.................................................. 35
KENYA: Works; Buoyage; Leading lights; Pilot boarding place ...................... 36
KENYA: Legend ................................................................................................ 36
KENYA: Buoyage.............................................................................................. 36
SOMALIA: Platform; Buoyage ......................................................................... 32
SOUTH AFRICA, West Coast: Obstructions; Buoyage .................................... 35
KENYA: Submarine cable ................................................................................. 36
SOUTH AFRICA, South Coast: Buoyage; Lights ............................................. 35
1A.15
 IA
10. AFRICA, SOUTH AND EAST COASTS, AND MADAGASCAR - continued
5303(P)/20 1310, 1812 ........... TANZANIA: Rocks; Buoyage; Reported anchorage; Depths ........................... 36
5760(P)/20 8027 ...................... KENYA: Restricted areas................................................................................... 36
160(T)/21 1236, 4142 ........... SOUTH AFRICA, West Coast: Shellfish bed; Buoyage.................................... 35
176(T)/21 4157, 4160 ........... SOUTH AFRICA, South Coast: Buoyage ......................................................... 35
276(T)/21 4150 ...................... SOUTH AFRICA, South Coast: Buoy; Radar beacon....................................... 35
11. RED SEA, ARABIA, IRAQ AND IRAN
2035(T)/13 2884 ...................... IRAN: Wreck; Buoy........................................................................................... 40
3234(T)/13 1229 ...................... IRAQ: Wreck ..................................................................................................... 40
5236(T)/14 2523, 2883, 2886, QATAR: Buoyage .............................................................................................. 40
2887, 3950 ...........
4761(P)/15 8029 ...................... SAUDI ARABIA, Red Sea Coast: Note ............................................................ 32
5640(T)/15 3738, 3761, 3786, BAHRAIN: Buoy............................................................................................... 40
3788, 3790 ...........
500(P)/16 8106 ...................... UNITED ARAB EMIRATES: Light.................................................................. 40
1012(P)/16 8106 ...................... UNITED ARAB EMIRATES: Vertical clearance.............................................. 40
1182(T)/16 333, 2374 ............. EGYPT, Red Sea Coast: Platform; Light ........................................................... 32
4281(P)/16 63 .......................... SAUDI ARABIA, Red Sea Coast: Harbour developments; Depths .................. 32
4492(P)/16 11, 1268, 2882, IRAN: Platforms; Submarine cables; Submarine pipelines ............................... 40
2884, 3774 ...........
5105(P)/16 16 ..........................
SAUDI ARABIA, Red Sea Coast: Depths; Wrecks; Submarine pipeline; 32
Rocks; Coral.......................................................................................................
6029(P)/16 8088 ...................... SAUDI ARABIA, East Coast: Platform ............................................................ 32
6310(P)/16 8106 ...................... UNITED ARAB EMIRATES: Buoy; Automatic Identification System; Radar 40
beacon ................................................................................................................
861(P)/17 2889, 3178, 3179 UNITED ARAB EMIRATES: Submarine cables; Works.................................. 40
1201(P)/17 8029 ...................... SAUDI ARABIA, Red Sea Coast: Note; Legend .............................................. 32
1731(P)/17 2889, 3178 ........... UNITED ARAB EMIRATES: Works; Submarine cable; Submarine pipelines 40
1755(P)/17 8106 ...................... UNITED ARAB EMIRATES: Pilot boarding place .......................................... 40
1870(P)/17 8106 ...................... UNITED ARAB EMIRATES: Note................................................................... 40
2226(P)/17 8106 ...................... UNITED ARAB EMIRATES: Anchorage area ................................................. 40
2363(P)/17 6, 12, 15, 143, 157, RED SEA: Routeing measures........................................................................... 32
158, 159, 164, 452,
453, 1925, 2375,
2658, 2659, 2964
2822(T)/17 2523, 3790 ........... QATAR: Buoy .................................................................................................... 40
3192(P)/17 8088 ...................... SAUDI ARABIA, East Coast: Foul ................................................................... 32
3559(P)/17 2837, 2889, 3178, UNITED ARAB EMIRATES: Submarine pipeline; Obstruction ...................... 40
3179, 3413 ...........
3851(P)/17 8191 ...................... UNITED ARAB EMIRATES: Landmark.......................................................... 40
4031(P)/17 1265, 3842, 3843, IRAQ: Channel; Depths; Wrecks ....................................................................... 40
3844, 3845, 3846
5287(T)/17 1235, 1265 ........... ARABIA: Buoyage ............................................................................................ 40
5518(P)/17 1228 ...................... IRAQ: Jetty; Dolphins; Mooring buoys; Floating dock; Dredged area ............. 40
77(P)/18 8191 ...................... UNITED ARAB EMIRATES: Harbour limit; Anchorage areas; Legends ........ 40
78(P)/18 8191 ...................... UNITED ARAB EMIRATES: Note................................................................... 40
1453(T)/18 1235, 1265, 3773 ARABIA, Shaţţ al'Arab: Buoyage ..................................................................... 40
1846(P)/18 8054 ...................... UNITED ARAB EMIRATES: Note................................................................... 40
2003(P)/18 8109 ...................... UNITED ARAB EMIRATES: Anchorage area ................................................. 40
2528(T)/18 2133, 2373 ........... EGYPT, Red Sea Coast: Buoy ........................................................................... 32
3055(P)/18 3752, 8253 ........... UNITED ARAB EMIRATES: Works ................................................................ 40
3266(P)/18 8116....................... QATAR: Note..................................................................................................... 40
3362(P)/18 8245 ...................... DJIBOUTI: Anchorage areas ............................................................................. 32
3774(P)/18 8245 ...................... DJIBOUTI: Note ................................................................................................ 32
4030(P)/18 3772, 3781 ........... QATAR: Depths; Buoyage ................................................................................. 40
4857(P)/18 8029 ...................... SAUDI ARABIA, Red Sea Coast: Depths; Wrecks; Obstructions; Beacons; 32
Buoyage; Anchorage areas; Works; Reclamation area.......................................

1A.16
Wk08/21

11. RED SEA, ARABIA, IRAQ AND IRAN - continued
5400(P)/18 2837, 2888, 3174,
3404 ......................
5748(P)/18 8191 ......................
5951(T)/18 2444, 3179, 3413
240(P)/19 2889, 3179, 3951
431(P)/19 8116.......................
994(P)/19 1229, 1235, 2847,
2884 ......................
1044(P)/19 8245 ......................
1646(P)/19 3737, 3738, 3759,
8043 ......................
1855(P)/19 3759, 8042, 8043
1937(T)/19 333, 2374 .............
1946(T)/19 3520, 3723 ...........
2009(P)/19 8043 ......................
2185(T)/19 2444, 3179, 3413
2208(T)/19 2523, 2837, 2847,
2886, 3772, 3950
2377(P)/19 8101 ......................
2750(P)/19 8109 ......................
3045(P)/19 8253 ......................
3103(P)/19 2577 ......................
3126(P)/19 2837, 2889, 3178,
3179 ......................
3154(P)/19 3176, 3412 ...........
3202(P)/19 3812, 8087 ...........
3896(T)/19 1223, 2882, 2884,
3773 ......................
4426(P)/19 8043 ......................
5424(P)/19 8117.......................
5912(T)/19 15, 157 .................
5960(T)/19 2443, 2444, 2837,
2858, 2886, 2887,
2889, 3178, 3179
5976(P)/19 8101 ......................
6077(P)/19 3739, 8054 ...........
6162(T)/19 2523 ......................
6182(P)/19 8054 ......................
6524(T)/19 11...........................
6699(P)/19 3718 ......................
163(P)/20 2884 ......................
225(P)/20 8118.......................
791(P)/20 8054 ......................
1503(T)/20 2889, 3179, 3951
1568(P)/20 8101 ......................
1577(P)/20 8191 ......................
1578(P)/20 8117.......................
1587(P)/20 8117.......................
1822(T)/20 2854 ......................
2062(T)/20 3736 ......................
2084(P)/20 8117.......................
2367(P)/20 3176, 3739 ...........
2505(T)/20 2889, 3179, 3951
3064(P)/20 8116.......................
3127(P)/20 15, 16 ...................
Wk08/21
IA
UNITED ARAB EMIRATES: Harbour limits; Anchorage areas; Anchor 40
berths; Virtual aids to navigation; Lights; Buoyage; Pilot boarding places;
Quay; Berth; Marine farm; Landmark ...............................................................
UNITED ARAB EMIRATES: Harbour limit; Legends; Anchorage area.......... 40
UNITED ARAB EMIRATES: Obstruction ....................................................... 40
UNITED ARAB EMIRATES: Platforms........................................................... 40
QATAR: Anchorage areas .................................................................................. 40
IRAQ: Works; Buoyage; Channel...................................................................... 40
DJIBOUTI: Restricted areas; Legends............................................................... 32
BAHRAIN: Works ............................................................................................. 40
BAHRAIN: Works; Lights; Breakwater; Buoyage; Channel; Restricted area; 40
Submarine pipeline; Submarine cable; Radar beacon........................................
EGYPT, Red Sea Coast: Buoy ........................................................................... 32
UNITED ARAB EMIRATES: Buoy.................................................................. 40
BAHRAIN: Pilot boarding place ....................................................................... 40
UNITED ARAB EMIRATES: Obstruction ....................................................... 40
QATAR: Buoy .................................................................................................... 40
UNITED ARAB EMIRATES: Light; Buoyage; Light-beacon.......................... 40
UNITED ARAB EMIRATES: Works ................................................................ 40
UNITED ARAB EMIRATES: Buoy.................................................................. 40
SAUDI ARABIA, Red Sea Coast: Depths......................................................... 32
UNITED ARAB EMIRATES: Works; Offshore installations ........................... 40
UNITED ARAB EMIRATES: Restricted area .................................................. 40
SAUDI ARABIA, East Coast: Depths ............................................................... 32, 40
KUWAIT: Lights; Wreck ................................................................................... 40
BAHRAIN: Note................................................................................................ 40
QATAR: Buoyage .............................................................................................. 40
SAUDI ARABIA, Red Sea Coast: Light-beacon............................................... 32
UNITED ARAB EMIRATES: Works ................................................................ 40
UNITED ARAB EMIRATES: Legend; Dredged depths ................................... 40
UNITED ARAB EMIRATES: Light; Works; Buoyage; Breakwaters; Channel 40
QATAR: Buoy .................................................................................................... 40
UNITED ARAB EMIRATES: Restricted area .................................................. 40
IRAN: Buoy ....................................................................................................... 40
SAUDI ARABIA, East Coast: Works; Buoyage; Dredged area ........................ 40
KUWAIT: Works; Buoyage; Causeways ........................................................... 40
QATAR: Dredged areas; Buoyage; Channels .................................................... 40
UNITED ARAB EMIRATES: Dredged depths; Dredged areas; Coastline; 40
Berths .................................................................................................................
UNITED ARAB EMIRATES: Buoy.................................................................. 40
UNITED ARAB EMIRATES: Notes ................................................................. 40
UNITED ARAB EMIRATES: Platform ............................................................ 40
QATAR: Restricted areas; Legends.................................................................... 40
QATAR: Light .................................................................................................... 40
OMAN: Wreck ................................................................................................... 40
BAHRAIN: Buoyage ......................................................................................... 40
QATAR: Light-beacons...................................................................................... 40
UNITED ARAB EMIRATES: Anchorage area; Maritime limit........................ 40
UNITED ARAB EMIRATES: Buoyage ............................................................ 40
QATAR: Maritime limits.................................................................................... 40
SAUDI ARABIA, Red Sea Coast: General information ................................... 32
1A.17
 IA
11. RED SEA, ARABIA, IRAQ AND IRAN - continued
3211(T)/20 2523, 2837, 2847, BAHRAIN: Buoy............................................................................................... 40
2858, 2886, 3738,
3790, 8043 ...........
3623(P)/20 27, 2884 ............... IRAN: Channel; Buoyage; Dredged depths; Light-beacons; Dredged areas; 40
Dolphins; Reclamation area; Coastline; Swinging circle; Anchor berths ..........
3675(T)/20 2889, 3179 ........... UNITED ARAB EMIRATES: Buoy.................................................................. 40
3857(P)/20 8253 ...................... UNITED ARAB EMIRATES: Anchorage area ................................................. 40
4022(P)/20 3174, 3404 ........... UNITED ARAB EMIRATES: Breakwater; Works; Buoyage ........................... 40
4448(P)/20 12 .......................... SAUDI ARABIA, Red Sea Coast: Depths; Obstruction; Dredged areas; 32
Coastline; Beacons .............................................................................................
4469(T)/20 3812 ...................... SAUDI ARABIA, East Coast: Buoy.................................................................. 40
4518(T)/20 2889, 3179, 3780, UNITED ARAB EMIRATES: Works; Buoyage................................................ 40
3951 ......................
4569(P)/20 3736, 8042 ........... BAHRAIN: Floating barriers; Lights................................................................. 40
4645(P)/20 2132, 2133, 2373 EGYPT, Red Sea Coast: Works; Lights; Dredged area; Virtual aids to 32
navigation ...........................................................................................................
4808(P)/20 8118....................... QATAR: Anchorage areas .................................................................................. 40
4956(P)/20 3778, 3779, 3780 UNITED ARAB EMIRATES: Works; Restricted areas..................................... 40
5242(T)/20 1214, 3773 ........... KUWAIT: Light-beacon; Lights ........................................................................ 40
6028(P)/20 3174, 3175 ........... UNITED ARAB EMIRATES: Works; Restricted area; Outfall; Buoyage ........ 40
6237(P)/20 8191 ...................... UNITED ARAB EMIRATES: Wreck................................................................ 40
6265(P)/20 2837, 2847, 2883, BAHRAIN: Marine Reserve .............................................................................. 40
2886, 3738, 3788,
3790, 8043 ...........
60(P)/21 240 ........................ EGYPT, Suez Canal: Buoyage; Anchor berth.................................................... 24
121(T)/21 3777, 3812 ........... SAUDI ARABIA, East Coast: Wreck; Buoyage................................................ 40
312(T)/21 3734, 3736, 8042 BAHRAIN: Works ............................................................................................. 40
358(P)/21 263, 264, 265, 8245 DJIBOUTI: Pilot boarding place ....................................................................... 32
361(T)/21 3763, 3785 ........... OMAN: Works ................................................................................................... 32, 40
526(P)/21 8043 ...................... BAHRAIN: International boundary; Legends ................................................... 40
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA
4002(P)/12 569 ........................ INDIA, East Coast: Port developments ............................................................. 43
3337(P)/15 8032 ...................... PAKISTAN: Light.............................................................................................. 41
1939(P)/16 8166 ...................... BANGLADESH: Wreck; Buoy ......................................................................... 43
463(P)/17 33, 38 ................... PAKISTAN: Depths; Lights ............................................................................... 41
2877(T)/17 IN 2036 .................. INDIA, West Coast: Buoyage ............................................................................ 41
3221(T)/17 39, 1465, IN 202, INDIA, West Coast: Buoy.................................................................................. 41
IN 203, IN 2031 .....
5395(T)/17 39, 707, 4705 ...... PAKISTAN: Wreck ............................................................................................ 32, 41
894(P)/18 8032 ...................... PAKISTAN: Note............................................................................................... 41
2839(P)/18 IN 3010, IN 3041 ... INDIA, East Coast: Anchorage areas; Submarine pipelines; Restricted area .... 43
2951(T)/18 90 .......................... BANGLADESH: Obstruction............................................................................ 43
3911(P)/18 IN 2016, IN 2076 ... INDIA, West Coast: Works ................................................................................ 41
4348(P)/18 8166 ...................... BANGLADESH: Light; Radar beacons ............................................................ 43
4921(T)/18 90 .......................... BANGLADESH: Wreck .................................................................................... 43
5442(T)/18 1488, IN 207, INDIA, West Coast: Dredging areas .................................................................. 41
IN 253, IN 254 .......
5538(P)/18 90, 817 ................. BANGLADESH: Works; Buoyage; Anchorage area; Submarine pipeline........ 43
5548(P)/18 IN 206, IN 253 ....... INDIA, West Coast: Works ................................................................................ 41
5576(P)/18 920 ........................ INDIAN OCEAN, Chagos: Restricted areas; Anchorage areas; Depths ........... 38
6120(P)/18 3265, 3700 ........... SRI LANKA, South Coast: Depths; Rocks........................................................ 42
105(P)/19 319 ........................ INDIA, East Coast: Channel limit; Buoyage; Dredged depths; Berth; Floating 43
dock; Pilot boarding places ................................................................................
460(P)/19 IN 3001 .................. INDIA, East Coast: Works ................................................................................. 43
1066(T)/19 84, 90 ................... BANGLADESH: Wrecks; Buoy........................................................................ 43
1217(P)/19 IN 292 .................... INDIA, West Coast: Traffic separation scheme ................................................. 41
1600(T)/19 84, 90 ................... BANGLADESH: Wrecks................................................................................... 43

1A.18
Wk08/21

12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
1943(P)/19 8180 ......................
2070(P)/19 8180 ......................
2078(P)/19 IN 3012 ..................
2106(P)/19 IN 211, IN 255,
IN 292, IN 293,
IN 2016, IN 2076 ...
2421(P)/19 8166 ......................
2556(T)/19 732 ........................
2869(P)/19 IN 203, IN 2013,
IN 2031 ..................
2871(P)/19 IN 220, IN 259,
IN 2004, IN 2029,
IN 2045 ..................
3115(P)/19 IN 203, IN 2033,
IN 2083 ..................
3743(P)/19 8032 ......................
3861(T)/19 833 ........................
3897(T)/19 IN 2016, IN 2076 ...
3934(T)/19 IN 211, IN 255,
IN 2016, IN 2076 ...
3935(T)/19 IN 2002, IN 2359 ...
3986(T)/19 722 ........................
4184(T)/19 84, 90 ...................
4257(T)/19 90, 817 .................
4267(T)/19 1885 ......................
4326(P)/19 1488, IN 207,
IN 253, IN 254,
IN 292 ....................
4612(T)/19 84, 90 ...................
4977(T)/19 84, 8166 ...............
5223(T)/19 90 ..........................
5331(T)/19 84, 90 ...................
5332(T)/19 90 ..........................
5363(T)/19 830 ........................
5373(T)/19 3877, 3895, 4701,
4702 ......................
5624(T)/19 90, 732 .................
5860(P)/19 732 ........................
6537(P)/19 8166 ......................
6550(P)/19 84, 90, 8166 ........
304(P)/20 84, 90, 8166 ........
468(T)/20 90, 817 .................
579(P)/20 IN 254, IN 292 .......
1004(T)/20 90 ..........................
1168(P)/20 69, IN 262 .............
1380(T)/20 IN 223, IN 260,
IN 261 ....................
1802(P)/20 IN 211, IN 255,
IN 2016, IN 2076 ...
2164(P)/20 725, 727 ...............
2174(T)/20 IN 3010, IN 3041 ...
2332(T)/20 IN 214, IN 215,
IN 2022 ..................
Wk08/21
IA
PAKISTAN: Dredged depths; Quay; Channel; Leading line; Beacons; Dredged 41
area; Buoyage; Pier; Jetty; Anchorage area .......................................................
PAKISTAN: Note............................................................................................... 41
INDIA, East Coast: Works ................................................................................. 43
INDIA, West Coast: Works; Buoyage................................................................ 41
BANGLADESH: Harbour limit; Legend........................................................... 43
BANGLADESH: Wreck .................................................................................... 43
INDIA, West Coast: Works ................................................................................ 41
INDIA, West Coast: Works ................................................................................ 41
INDIA, West Coast: Works ................................................................................ 41
PAKISTAN: Buoyage; Channel; Dredged area; Dredged depths; Leading lines; 41
Lights; Pilot boarding place; Port developments ...............................................
BURMA: Buoy .................................................................................................. 43
INDIA, West Coast: Buoy.................................................................................. 41
INDIA, West Coast: Light-vessel....................................................................... 41
INDIA, West Coast: Buoy.................................................................................. 41
INDIAN OCEAN, Seychelles: Beacon.............................................................. 36
BANGLADESH: Wreck .................................................................................... 43
BANGLADESH: Wreck .................................................................................... 43
BURMA: Buoy .................................................................................................. 43
INDIA, West Coast: Works ................................................................................ 41
BANGLADESH: Wrecks................................................................................... 43
BANGLADESH: Works .................................................................................... 43
BANGLADESH: Obstruction............................................................................ 43
BANGLADESH: Wreck .................................................................................... 43
BANGLADESH: Wreck .................................................................................... 43
BURMA: Works................................................................................................. 45
INDIAN OCEAN, Comores: Volcanic activity ................................................. 36, 38
BANGLADESH: Buoyage ................................................................................ 43
BANGLADESH: Drying heights; Depths; Wrecks; Buoyage; Lights; Coastline 43
BANGLADESH: Anchor berths ........................................................................ 43
BANGLADESH: Submarine pipelines.............................................................. 43
BANGLADESH: Depths; Drying heights; Islets; Wrecks; Platform; Restricted 43
areas; Buoyage; Submarine pipeline; Jetties; Signal station; Lights; Leading
lights; Beacons; Landmarks; Tide gauge; Pontoons; Piers; Automatic
Identification Systems; Virtual aids to navigation .............................................
BANGLADESH: Wreck .................................................................................... 43
INDIA, West Coast: Depths ............................................................................... 41
BANGLADESH: Wreck .................................................................................... 43
INDIA, East Coast: Depths; Recommended anchorage; Buoyage .................... 42
INDIA, West Coast: Buoyage ............................................................................ 41
INDIA, West Coast: Bridge; Jetty...................................................................... 41
INDIAN OCEAN, Chagos: Rocks; Obstructions .............................................. 38
INDIA, East Coast: Buoyage ............................................................................. 43
INDIA, West Coast: Buoyage ............................................................................ 41
1A.19
 IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
2821(T)/20 2760, 4070, 4071, INDIAN OCEAN: Buoyage .............................................................................. 35, 42, 46
4073, 4707 ...........
3168(P)/20 IN 3037, IN 3038 ... INDIA, East Coast: Dredging area; Channel limits; Buoyage........................... 43
3175(T)/20 823, 826, 833 ...... BURMA: Wreck................................................................................................. 43
3503(T)/20 39, 58 ................... PAKISTAN: Quarantine anchorage ................................................................... 41
3630(T)/20 709, 4703, 4706, INDIA, East Coast: Buoyage ............................................................................. 42
4707 ......................
4221(T)/20 90, IN 31 ............... BANGLADESH: Dredging area........................................................................ 43
4277(P)/20 711, 3048.............. INDIAN OCEAN, Mauritius: Depths................................................................ 38
4292(P)/20 1470, IN 203 ......... INDIA, West Coast: Depths; Drying heights ..................................................... 41
4378(P)/20 IN 33 ...................... INDIAN OCEAN, Nicobar Islands: Depths; Obstructions; Lights ................... 42
4682(T)/20 707, IN 22, IN 211, INDIA, West Coast: Works; Buoyage................................................................ 41, 42
IN 255, IN 292,
IN 293, IN 2016,
IN 2076 ..................
4980(P)/20 IN 203 .................... INDIA, West Coast: Buoy; Depths .................................................................... 41
5051(T)/20 2741, 2756 ........... INDIAN OCEAN, Comores: Light.................................................................... 36
5052(P)/20 6, 143, 151, 153, INDIAN OCEAN: Works; Submarine cables .................................................... 24, 25, 26,
157, 158, 159, 167, 32, 34, 35,
171, 240, 264, 265, 36, 38
327, 333, 355, 356,
452, 453, 616, 644,
646, 666, 671, 674,
716, 717, 721, 722,
740, 742, 964,
1180, 1196, 1704,
1705, 1913, 1925,
1926, 1998, 2116,
2122, 2123, 2124,
2133, 2373, 2374,
2375, 2573, 2574,
2578, 2926, 2930,
2949, 2964, 2968,
3300, 3310, 3361,
3795, 3797, 3877,
3878, 4146, 4148,
4150, 4151, 4152,
4156, 4157, 4169,
4171, 4177, 4178,
4179 ......................
5101(T)/20 817, 4706, IN 31 .. BURMA: Offshore installations......................................................................... 42, 43
5447(T)/20 39, 40, 58 ............ PAKISTAN: Wrecks........................................................................................... 41
5740(T)/20 IN 22, IN 207, INDIA, West Coast: Works ................................................................................ 41, 42
IN 210, IN 211,
IN 212, IN 253,
IN 254, IN 255,
IN 256, IN 292,
IN 293 ....................
5742(T)/20 IN 254, IN 292, INDIA, West Coast: Works ................................................................................ 41
IN 2039 ..................
5786(T)/20 IN 22, IN 211, INDIA, West Coast: Works ................................................................................ 41, 42
IN 255, IN 292,
IN 293, IN 2015,
IN 2016, IN 2076 ...
6303(P)/20 823, 826, 830, 833 BURMA: Submarine cable; Works.................................................................... 43, 45
52(T)/21 317, 830, 1398, INDIA, East Coast: Buoyage ............................................................................. 42, 43, 45
2069, 4706, 4707,
IN 31, IN 32, IN 33,
IN 472, IN 473,
IN 3001, IN 3004 ...

1A.20
Wk08/21
 IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
220(P)/21 709, 813, 1013, SRI LANKA, West Coast: Submarine cable...................................................... 42
3323, 3700, 4703,
4706, 4707, IN 32,
IN 263 ....................
283(T)/21 317, 318, 319, 320, INDIA, East Coast: Obstructions ....................................................................... 42, 43
2069, 4706, IN 31,
IN 32, IN 33, IN 308,
IN 352 ....................
569(T)/21 39, 707, 709, 1465, INDIA, West Coast: Obstructions; Scientific instruments................................. 41, 42
IN 22, IN 32, IN 214,
IN 221, IN 253,
IN 258, IN 259,
IN 261, IN 263,
IN 272, IN 292,
IN 293 ....................
603(T)/21 IN 22, IN 32, IN 220, INDIA, West Coast: Measuring instruments...................................................... 41, 42
IN 259 ....................
605(T)/21 317, 319, 320, 514, INDIAN OCEAN: Buoyage .............................................................................. 36, 38, 41,
569, 707, 709, 716, 42, 43
717, 721, 740, 742,
1398, 1470, 2069,
IN 22, IN 31, IN 33,
IN 205, IN 206,
IN 211, IN 212,
IN 213, IN 215,
IN 216, IN 219,
IN 221, IN 223,
IN 253, IN 257,
IN 258, IN 259,
IN 260, IN 261,
IN 262, IN 263,
IN 272, IN 273,
IN 292, IN 293,
IN 308, IN 351,
IN 352, IN 473,
IN 2008, IN 3002,
IN 3035 ..................
712(T)/21 707, 709, 4703, INDIA, West Coast: Data buoys ........................................................................ 32, 41, 42
4705, 4706, 4707,
IN 22, IN 273, IN 292
874(P)/21 12, 15, 159, 164, INDIAN OCEAN: Submarine cables ................................................................ 32, 40, 41,
263, 264, 333, 818, 42, 43, 45,
830, 2375, 2441, 46
2442, 2760, 2970,
3784, 3904, 3943,
4705, 4706, IN 273,
IN 293, IN 2036 .....
879(T)/21 2069, IN 32 ........... INDIA, East Coast: Scientific instruments ........................................................ 42, 43
13. MALACCA STRAIT, SINGAPORE STRAIT AND SUMATERA
1030(T)/16 1140, 3946............ MALAYSIA, Peninsular Malaysia, West Coast: Obstruction............................ 45
2679(T)/16 3946, 8233 ........... MALACCA STRAIT: Wreck; Buoyage ............................................................ 45
2152(T)/17 3831, 3833, 4041 SINGAPORE STRAIT: Buoy............................................................................ 45
4448(P)/17 8232, 8233 ........... MALAYSIA, Peninsular Malaysia, West Coast: Maintained channel............... 45
1401(P)/18 1312, 2422, 2435, INDONESIA, Sumatera: Submarine cables ...................................................... 45, 46, 47,
2436, 2470, 2868, 48
2870, 3947 ...........
4349(P)/18 8233 ...................... MALACCA STRAIT: Anchorage areas............................................................. 45
4527(P)/18 8233 ...................... MALACCA STRAIT: Note ............................................................................... 45
4673(P)/18 2873, 3729, 3947 INDONESIA, Sumatera: Submarine cable ........................................................ 45, 46

1A.21
Wk08/21

13. MALACCA STRAIT, SINGAPORE STRAIT AND SUMATERA - continued
4930(P)/18 8284 ......................
461(P)/19 8232, 8233 ...........
637(T)/19 3471 ......................
1082(P)/19 8175 ......................
1335(T)/19 3949 ......................
1939(P)/19 8176 ......................
2617(P)/19 8177 ......................
3628(P)/19 8232 ......................
4676(T)/19 2152, 2155 ...........
4755(T)/19 4044 ......................
5772(P)/19 8175 ......................
6060(P)/19 1146, 3946, 3947.
6429(P)/19 8107 ......................
6556(P)/19 8107 ......................
1225(P)/20 8177 ......................
1226(P)/20 8176 ......................
1282(P)/20 8175 ......................
1558(P)/20 8175 ......................
1893(T)/20 4030, 4031, 4033,
4038, 4040, 8175
2024(P)/20 3940, 3946, 3947
2031(P)/20 3833, 4039, 4040
2218(P)/20 3833, 4038, 4039,
4040, 8175 ...........
2221(P)/20 3833, 4038, 4039,
4040 ......................
2529(T)/20 3948 ......................
2629(P)/20 8175, 8176 ...........
2741(T)/20 2403, 3833, 3902,
3948 ......................
2752(P)/20 8285 ......................
3077(P)/20 8284 ......................
3146(P)/20 8175 ......................
3164(T)/20 3833, 4039, 4040,
4041 ......................
3438(P)/20 8176 ......................
3927(P)/20 8232, 8233 ...........
4003(P)/20 8175, 8176 ...........
4198(T)/20 3902, 3947 ...........
4423(P)/20 8175, 8176 ...........
4424(P)/20 1312, 2403, 2869,
3831 ......................
4492(P)/20 3833, 4038, 4040
5406(P)/20 4032, 4034 ...........
5851(P)/20 8175 ......................
5958(T)/20 4030, 4031, 4033,
4038, 4040 ...........
5973(P)/20 8285 ......................
5992(P)/20 8176 ......................
6179(P)/20 2917 ......................
165(T)/21 3831, 3833, 3937,
4041 ......................
226(P)/21 3937 ......................
490(P)/21 8176 ......................
820(T)/21 2403, 3833, 3947,
4038 ......................
IA
MALAYSIA, Peninsular Malaysia, West Coast: Pilot boarding place .............. 45
MALAYSIA, Peninsular Malaysia, West Coast: Dredged depth....................... 45
INDONESIA, Sumatera: Buoy .......................................................................... 46
SINGAPORE: Maritime limit............................................................................ 45
INDONESIA, Sumatera: Wreck ........................................................................ 46
SINGAPORE: Light........................................................................................... 45
SINGAPORE: Light........................................................................................... 45
MALAYSIA, Peninsular Malaysia, West Coast: Note....................................... 45
MALAYSIA, Peninsular Malaysia, West Coast: Buoyage ................................ 45
SINGAPORE: Submarine cable; Works; Buoyage............................................ 45
SINGAPORE: Buoy........................................................................................... 45
MALAYSIA, Peninsular Malaysia, West Coast: Depths ................................... 45
MALAYSIA, Peninsular Malaysia, West Coast: Note....................................... 45
MALAYSIA, Peninsular Malaysia, West Coast: Bridge.................................... 45
SINGAPORE: Dredged depths .......................................................................... 45
SINGAPORE: Dredged depths .......................................................................... 45
SINGAPORE: Dredged areas; Dredged depths; Jetty ....................................... 45
SINGAPORE: Maritime limits; Buoy ............................................................... 45
SINGAPORE: Dredging area; Fairway; Works................................................. 45
MALACCA STRAIT: Submarine cable ............................................................ 45
SINGAPORE STRAIT: Anchorage areas.......................................................... 45
SINGAPORE: Works ......................................................................................... 45
SINGAPORE: Submarine cables ....................................................................... 45
INDONESIA, Sumatera: Wreck ........................................................................ 46
SINGAPORE: Dredged depths .......................................................................... 45
INDONESIA, Sumatera: Wreck ........................................................................ 45, 46
SINGAPORE: Automatic Identification System ............................................... 45
MALAYSIA, Peninsular Malaysia, West Coast: Anchorage area ..................... 45
SINGAPORE: Dredged depths .......................................................................... 45
SINGAPORE STRAIT: Wrecks ........................................................................ 45
SINGAPORE: Vertical clearance....................................................................... 45
MALACCA STRAIT: Berths; Dredged depths; Dredging areas; Pontoon; 45
Depths ................................................................................................................
SINGAPORE: Dredged depths; Wreck ............................................................. 45
MALAYSIA, Peninsular Malaysia, West Coast: Works .................................... 45
SINGAPORE: Dredged depths; Berths ............................................................. 45
INDONESIA, Sumatera: Light-beacon ............................................................. 45, 46, 47
SINGAPORE: Depths ........................................................................................ 45
SINGAPORE: Buoyage ..................................................................................... 45
SINGAPORE: Dredged depth............................................................................ 45
SINGAPORE: Dredging area ............................................................................ 45
SINGAPORE: Radio reporting points ............................................................... 45
SINGAPORE: Dredged depths .......................................................................... 45
INDONESIA, Sumatera: Fairways; Anchorage areas ....................................... 45
INDONESIA, Sumatera: Wreck ........................................................................ 45
INDONESIA, Sumatera: Light-beacons; Buoyage; Depths .............................. 45
SINGAPORE: Automatic Identification System ............................................... 45
MALACCA STRAIT: Buoy .............................................................................. 45
1A.22
Wk08/21

14. CHINA SEA WITH ITS WEST SHORE AND CHINA
2855(T)/06 1251 ......................
5172(T)/10 341, 937, 1555,
1962, 3026, 4127
3997(T)/12 341, 3026 .............
5137(T)/13 2409 ......................
5218(T)/14 67, 2414, 3965 ....
650(T)/15 1286, 1287 ...........
5355(T)/15 1059 ......................
6200(T)/15 1962, 1968 ...........
6242(T)/15 3026 ......................
6450(T)/15 1304 ......................
6597(P)/15 1250, 1255, 1263,
1294 ......................
877(P)/16 1254, 1256, 1289,
3480 ......................
1407(T)/16 2103, 3879, 3967
3206(T)/16 3883, 3987 ...........
3891(P)/16 8153 ......................
3897(T)/16 1555, 3488, 3892
4494(T)/16 1968, 3489 ...........
4630(T)/16 2103 ......................
5455(P)/16 8153 ......................
5686(T)/16 3359 ......................
5927(P)/16 2103 ......................
491(T)/17 1046, 3727, 3965,
3966 ......................
2228(P)/17 8258 ......................
2983(P)/17 8073 ......................
3865(T)/17 1144, 1303, 1306.
4123(P)/17 2641, 2642 ...........
580(T)/18 2422, 3445 ...........
1180(T)/18 3874 ......................
1219(P)/18 3875, 3888 ...........
1971(P)/18 8259 ......................
2134(P)/18 3449 ......................
2358(P)/18 1036, 8258 ...........
2765(P)/18 8084 ......................
3056(T)/18 3875 ......................
3200(P)/18 8084 ......................
3255(P)/18 8259 ......................
3477(P)/18 8053 ......................
3897(T)/18 3882 ......................
4337(T)/18 1249, 1255, 3697
4386(P)/18 1100, 1261, 3986,
8260 ......................
4935(P)/18 8062 ......................
5017(T)/18 1760 ......................
5121(P)/18 8062 ......................
5260(T)/18 2422, 3446, 3482
5372(P)/18 3884 ......................
5631(P)/18 1965, 3875, 3888,
3889 ......................
75(T)/19 1965 ......................
506(T)/19 3882 ......................
660(P)/19 8219 ......................
Wk08/21
IA
CHINA, Yellow Sea Coast: Restricted area ....................................................... 52
CHINA, South Coast: Obstruction..................................................................... 47, 50
CHINA, South Coast: Light-beacons................................................................. 47, 50
TAIWAN: Buoyage ............................................................................................ 50
THAILAND, Gulf of Thailand Coast: Platforms............................................... 47
CHINA, Bo Hai: Restricted area........................................................................ 52
VIETNAM: Dredged area.................................................................................. 47
CHINA, South Coast: Buoy............................................................................... 50
CHINA, South Coast: Wreck ............................................................................. 50
CHINA, East Coast: Wreck................................................................................ 50
CHINA, Bo Hai: Recommended route .............................................................. 52
CHINA, Yellow Sea Coast: Precautionary area ................................................. 52
GULF OF THAILAND: Platform...................................................................... 47
VIETNAM: Buoyage ......................................................................................... 47
CHINA, Yellow Sea Coast: Note ....................................................................... 52
CHINA, South Coast: Buoy............................................................................... 47
TAIWAN STRAIT: Buoy................................................................................... 48, 50
GULF OF THAILAND: Buoy........................................................................... 47
CHINA, Yellow Sea Coast: Buoyage; Radar beacons ....................................... 52
CHINA, South Coast: Buoyage; Light-beacons ................................................ 47
GULF OF THAILAND: Depths ........................................................................ 47
THAILAND, Gulf of Thailand Coast: Restricted areas..................................... 47
VIETNAM: Wreck............................................................................................. 47
TAIWAN: Note .................................................................................................. 50
CHINA, East Coast: Works; Breakwater ........................................................... 50
CHINA, Bo Hai: Works ..................................................................................... 52
MALAYSIA, Peninsular Malaysia, East Coast: Wreck ..................................... 47
VIETNAM: Obstruction .................................................................................... 47
VIETNAM: Harbour limit ................................................................................. 47
VIETNAM: Note ............................................................................................... 47
CHINA, East Coast: Fairway; Works................................................................. 50
VIETNAM: Works; Buoyage............................................................................. 47
TAIWAN: Foul................................................................................................... 50
VIETNAM: Wreck............................................................................................. 47
TAIWAN: Note .................................................................................................. 50
VIETNAM: Note ............................................................................................... 47
TAIWAN: Lights; Legend.................................................................................. 50
VIETNAM: Wreck............................................................................................. 47
CHINA, Yellow Sea Coast: Buoy ...................................................................... 52
VIETNAM: Works ............................................................................................. 47
TAIWAN: Foul................................................................................................... 50
TAIWAN: Buoy.................................................................................................. 50
TAIWAN: Note .................................................................................................. 50
MALAYSIA, Peninsular Malaysia, East Coast: Wreck ..................................... 47
VIETNAM: Channel; Reclamation area; Lights; Depths; Buoyage; Port 47
development .......................................................................................................
VIETNAM: Dredged areas; Depths; Anchor berths; Buoyage; Pilot boarding 47
place; Overhead cable; Swept area; Restricted area; Jetties; Harbour limit;
Reclamation areas; Channels .............................................................................
VIETNAM: Wreck............................................................................................. 47
VIETNAM: Wreck............................................................................................. 47
CHINA, East Coast: Legend .............................................................................. 50
1A.23

14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
830(T)/19 2403, 2422, 2869,
3831 ......................
835(P)/19 3879 ......................
1028(P)/19 1379 ......................
1536(T)/19 4117, 4126............
1656(T)/19 2412 ......................
1948(P)/19 341, 343, 4123,
4129 ......................
1951(P)/19 3026 ......................
2135(P)/19 4128 ......................
2178(T)/19 1736 ......................
2627(P)/19 8259 ......................
2660(T)/19 3875, 3888 ...........
2690(T)/19 1965, 3875 ...........
3109(T)/19 1199, 2412, 3480.
3365(P)/19 8217 ......................
3366(P)/19 8259 ......................
3567(T)/19 3882 ......................
3633(P)/19 8073 ......................
3987(P)/19 1130.......................
4141(T)/19 3232 ......................
4155(T)/19 3889 ......................
4195(T)/19 3874 ......................
4212(P)/19 8217 ......................
4270(T)/19 2376 ......................
4294(P)/19 8258 ......................
4562(T)/19 2426, 3985 ...........
4699(P)/19 8084 ......................
4737(P)/19 1304 ......................
5019(T)/19 3989, 3990 ...........
5101(T)/19 1760, 1968, 2409,
2412, 3489 ...........
5171(T)/19 341, 3026, 4129 ..
5304(T)/19 1716, 1761, 2401
5381(T)/19 343 ........................
5385(T)/19 2657 ......................
5571(T)/19 1221 ......................
5627(T)/19 1716, 1723, 2401
5728(T)/19 3889 ......................
6032(P)/19 8062 ......................
6039(P)/19 8219 ......................
6157(T)/19 1505, 1506, 8152
6223(T)/19 3989 ......................
6301(T)/19 3882 ......................
6488(T)/19 1505, 1506 ...........
77(T)/20 2409, 3231 ...........
152(T)/20 2403 ......................
218(T)/20 3882 ......................
337(T)/20 3989, 3990 ...........
344(P)/20 8258, 8259, 8260
361(T)/20 1059, 1100............
393(T)/20 3875, 3881 ...........
IA
MALAYSIA, Peninsular Malaysia, East Coast: Buoy; Wreck .......................... 45, 47
VIETNAM: Buoyage ......................................................................................... 47
MALAYSIA, Peninsular Malaysia, East Coast: Breakwater; Lights; Quay; 47
Depths; Maintained channels .............................................................................
CHINA, South Coast: Works; Channel; Buoyage.............................................. 47
EASTERN CHINA SEA: Buoy ......................................................................... 53
CHINA, South Coast: Works; Buoyage; Automatic Identification Systems ..... 47, 50
CHINA, South Coast: Buoyage; Works; Depths; Automatic Identification 50
Systems; Anchorage area; Channels; Vertical clearances; Restricted areas.......
CHINA, South Coast: Fairway; Swinging circle; Depths.................................. 50
CHINA, East Coast: Works................................................................................ 50
VIETNAM: Legend; Maritime limit.................................................................. 47
VIETNAM: Wreck............................................................................................. 47
VIETNAM: Wreck............................................................................................. 47
CHINA, East Coast: Buoy ................................................................................. 50, 52, 53
CHINA, East Coast: Note .................................................................................. 50
VIETNAM: Note ............................................................................................... 47
VIETNAM: Wreck............................................................................................. 47
TAIWAN: Harbour limits; Legends ................................................................... 50
CHINA, East Coast: Bridge; Vertical clearance................................................. 50
TAIWAN: Works ................................................................................................ 50
VIETNAM: Wrecks ........................................................................................... 47
VIETNAM: Wrecks; Buoyage ........................................................................... 47
CHINA, East Coast: Note .................................................................................. 50
TAIWAN: Breakwater........................................................................................ 50
VIETNAM: Note ............................................................................................... 47
GULF OF THAILAND: Wreck ......................................................................... 47
TAIWAN: Depths; Scientific instruments; Foul; Works .................................... 50
CHINA, East Coast: Submarine pipeline........................................................... 50
VIETNAM: Buoy............................................................................................... 47
TAIWAN: Obstruction ....................................................................................... 48, 50, 53
CHINA, South Coast: Works; Buoyage; Reclamation area; Automatic 47, 50
Identification Systems; Depths ..........................................................................
CHINA, South Coast: Works ............................................................................. 50
CHINA, South Coast: Works ............................................................................. 47
CHINA, Bo Hai: Depth...................................................................................... 52
CHINA, Bo Hai: Dredging area......................................................................... 52
CHINA, South Coast: Works ............................................................................. 50
VIETNAM: Buoy............................................................................................... 47
TAIWAN: Legends............................................................................................. 50
CHINA, East Coast: Note .................................................................................. 50
CHINA, Yellow Sea Coast: Buoyage; Virtual aid to navigation........................ 52
VIETNAM: Buoy............................................................................................... 47
VIETNAM: Wreck; Buoy .................................................................................. 47
CHINA, Yellow Sea Coast: Works; Channel; Restricted area ........................... 52
TAIWAN: Spoil ground; Works ......................................................................... 50
MALAYSIA, Peninsular Malaysia, East Coast: Maritime limit ........................ 45
VIETNAM: Buoy............................................................................................... 47
VIETNAM: Wreck............................................................................................. 47
VIETNAM: Buoyage; Beacons; Depths; Light; Automatic Identification 47
Systems; Virtual aids to navigation; Wrecks; Overhead cables; Vertical
clearances; Harbour limits..................................................................................
VIETNAM: Wreck............................................................................................. 47
VIETNAM: Wreck............................................................................................. 47
1A.24
Wk08/21

14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
629(P)/20 1304 ......................
668(T)/20 1760, 2409 ...........
726(P)/20 1312, 2403, 2414,
2422, 2470, 2869,
3482, 3831 ...........
749(P)/20 1289 ......................
818(P)/20 1249 ......................
966(T)/20 1736 ......................
980(T)/20 1537, 1555 ...........
1096(T)/20 1537, 1555, 3892
1188(P)/20 1303, 1304 ...........
1209(P)/20 1130.......................
1277(T)/20 2619 ......................
1509(T)/20 1134.......................
1525(P)/20 1059, 1100............
1545(T)/20 4121, 4129 ...........
1608(P)/20 4124 ......................
1660(T)/20 1046, 3724, 3727
1662(P)/20 8259, 8260 ...........
1759(T)/20 3884 ......................
1827(T)/20 1199, 2412............
2025(P)/20 3231 ......................
2216(P)/20 1965, 3875, 3881,
3882 ......................
2225(P)/20 1604 ......................
2425(T)/20 1100, 1261, 2414,
3482, 3488, 3986,
3987 ......................
2620(T)/20 1505, 1506, 8152
2633(T)/20 1505, 1506, 8152
2636(T)/20 3348, 3351, 3892
2676(T)/20 3488, 3989, 3990
2817(P)/20 8053 ......................
2819(T)/20 1199, 1304, 1305,
1759 ......................
3028(T)/20 1059, 8259 ...........
3073(P)/20 8218 ......................
3680(P)/20 8215 ......................
3766(P)/20 2642 ......................
3867(T)/20 3447 ......................
3887(P)/20 8215 ......................
3902(T)/20 1760, 2409, 3231
3980(P)/20 8218 ......................
4138(T)/20 3884 ......................
4205(T)/20 2618 ......................
4220(P)/20 8215 ......................
4226(P)/20 8215 ......................
4361(P)/20 8215 ......................
4397(T)/20 4118, 4119............
4453(P)/20 8215 ......................
4470(P)/20 8218 ......................
4482(P)/20 8217, 8218 ...........
4506(P)/20 1761, 3231, 3658
4508(T)/20 1968, 3489 ...........
4646(T)/20 3378 ......................
4673(T)/20 3988 ......................
Wk08/21
IA
CHINA, East Coast: Pier.................................................................................... 50
TAIWAN: Buoyage; Restricted area; Wreck; Works ......................................... 50
MALAYSIA, Peninsular Malaysia, East Coast: Submarine cable..................... 45, 46, 47
CHINA, Yellow Sea Coast: Light ...................................................................... 52
CHINA, Bo Hai: Buoyage ................................................................................. 52
CHINA, South Coast: Bridge; Works ................................................................ 50
CHINA, South Coast: Submarine cables ........................................................... 47
CHINA, South Coast: Submarine cable............................................................. 47
CHINA, East Coast: Submarine cable ............................................................... 50
CHINA, East Coast: Works................................................................................ 50
TAIWAN: Works ................................................................................................ 50
CHINA, East Coast: Works................................................................................ 50
VIETNAM: Works; Jetty ................................................................................... 47
CHINA, South Coast: Dredging area................................................................. 47
CHINA, South Coast: Depths; Reclamation area .............................................. 50
THAILAND, Gulf of Thailand Coast: Buoyage ................................................ 47
VIETNAM: Radar beacon ................................................................................. 47
VIETNAM: Buoyage ......................................................................................... 47
CHINA, East Coast: Buoy ................................................................................. 50, 53
TAIWAN: Depths ............................................................................................... 50
VIETNAM: Channels; Buoyage; Depths; Drying heights; Port developments; 47
Bridges; Works; Harbour limits; Swinging circle; Anchorage areas; Overhead
cables; Light-beacon; Vertical clearances ..........................................................
CHINA, East Coast: Vertical clearance.............................................................. 50
VIETNAM: Submarine pipeline ........................................................................ 47
CHINA, Yellow Sea Coast: Pier ........................................................................ 52
CHINA, Yellow Sea Coast: Works..................................................................... 52
CHINA, South Coast: Virtual aids to navigation; Buoyage............................... 47
CHINA: Works................................................................................................... 47
TAIWAN: Works ................................................................................................ 50
CHINA, East Coast: Submarine pipeline........................................................... 50
VIETNAM: Works ............................................................................................. 47
CHINA, East Coast: Pilot boarding places ........................................................ 50
CHINA, East Coast: Anchorage areas ............................................................... 50
CHINA, Bo Hai: Depths; Berths; Coastline ...................................................... 52
MALAYSIA, Peninsular Malaysia, East Coast: Anchorage area ...................... 47
CHINA, East Coast: Pilot boarding places ........................................................ 50
TAIWAN: Works; Submarine cables; Reported anchorages.............................. 50
CHINA, East Coast: Pilot boarding places ........................................................ 50
VIETNAM: Wreck............................................................................................. 47
TAIWAN: Buoyage ............................................................................................ 50
CHINA, East Coast: Radio reporting lines; Legends......................................... 50
CHINA, East Coast: Fairways ........................................................................... 50
CHINA, East Coast: Restricted areas................................................................. 50
CHINA, South Coast: Dredging area; Works .................................................... 47, 50
CHINA, East Coast: Anchorage area ................................................................. 50
CHINA, East Coast: Maritime limit; Pilot boarding place ................................ 50
CHINA, East Coast: Pilot boarding place.......................................................... 50
TAIWAN: Works; Buoyage................................................................................ 50
TAIWAN STRAIT: Wreck ................................................................................. 48, 50
CHINA, Bo Hai: Works ..................................................................................... 52
VIETNAM: Buoy............................................................................................... 47
1A.25

14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
4711(P)/20 2419 ......................
4811(T)/20 1603 ......................
4813(P)/20 1250, 2645 ...........
4863(T)/20 3351, 3363 ...........
4890(P)/20 1603, 1604 ...........
4921(T)/20 1965 ......................
4986(P)/20 1305 ......................
5042(T)/20 3363 ......................
5048(P)/20 8218 ......................
5054(P)/20 8218 ......................
5109(P)/20 1036, 8258 ...........
5184(T)/20 1536, 1537 ...........
5204(T)/20 2376, 3230, 3232,
8053 ......................
5243(T)/20 3445 ......................
5455(P)/20 8152, 8153 ...........
5556(T)/20 2645 ......................
5589(P)/20 8053 ......................
5637(P)/20 967, 1338, 3483,
3489, 4411, 4414,
4464, 4507, 4508,
4509 ......................
5755(T)/20 3351, 3363 ...........
5764(P)/20 8260 ......................
5978(T)/20 2376, 3230 ...........
6096(T)/20 2618 ......................
6104(T)/20 3989 ......................
6229(T)/20 3992, 3999 ...........
6251(P)/20 1252 ......................
6269(T)/20 3988 ......................
6310(T)/20 3232 ......................
6350(T)/20 2618, 3231 ...........
155(T)/21 343, 348, 4123,
4124 ......................
157(T)/21 4128 ......................
158(T)/21 4123 ......................
170(T)/21 2409, 3232 ...........
171(T)/21 1304 ......................
213(T)/21 3881, 3882 ...........
342(P)/21 3883 ......................
356(P)/21 341, 343, 3026 ....
380(P)/21 8053 ......................
452(P)/21 2431 ......................
509(P)/21 1761, 2401, 2413,
2419 ......................
589(P)/21 8127 ......................
595(T)/21 2376, 3230 ...........
596(T)/21 2412, 3235, 3236
614(T)/21 341, 937, 3026,
4129 ......................
736(P)/21 1760, 2409, 3231
750(T)/21 1100.......................
751(T)/21 1761, 1968, 3231
819(T)/21 1374, 3446 ...........
831(T)/21 1506 ......................
IA
CHINA, East Coast: Radio reporting line.......................................................... 50
CHINA, East Coast: Anchorage area ................................................................. 50
CHINA, Bo Hai: Depths .................................................................................... 52
CHINA, South Coast: Light-vessel; Automatic Identification System; Radar 47
beacon; Virtual aid to navigation .......................................................................
CHINA, East Coast: Buoyage; Virtual aids to navigation ................................. 50
VIETNAM: Buoy............................................................................................... 47
CHINA, East Coast: Anchorage areas; Pilot boarding places............................ 50
CHINA, South Coast: Buoyage; Virtual aids to navigation............................... 47
CHINA, East Coast: Anchorage areas; Pilot boarding places; Legend ............. 50
CHINA, East Coast: Anchorage areas ............................................................... 50
VIETNAM: Works; Bridge; Buoyage................................................................ 47
CHINA, South Coast: Works ............................................................................. 47
TAIWAN: Works ................................................................................................ 50
MALAYSIA, Peninsular Malaysia, East Coast: Buoy....................................... 47
CHINA, Yellow Sea Coast: Radio reporting lines; Legend ............................... 52
CHINA, Bo Hai: Works ..................................................................................... 52
TAIWAN: Lights ................................................................................................ 50
SOUTH CHINA SEA: Fish havens ................................................................... 47, 48, 57,
59
CHINA, South Coast: Buoyage ......................................................................... 47
VIETNAM: Light............................................................................................... 47
TAIWAN: Works ................................................................................................ 50
TAIWAN: Depths ............................................................................................... 50
VIETNAM: Wreck............................................................................................. 47
CHINA, South Coast: Buoyage ......................................................................... 47
CHINA, Bo Hai: Piers........................................................................................ 52
VIETNAM: Wreck............................................................................................. 47
TAIWAN: Buoy.................................................................................................. 50
TAIWAN: Beacon; Obstruction ......................................................................... 50
CHINA, South Coast: Dredged area .................................................................. 47, 50
CHINA, South Coast: Works ............................................................................. 50
CHINA, South Coast: Works; Buoyage ............................................................. 50
TAIWAN: Works ................................................................................................ 50
CHINA, East Coast: Works................................................................................ 50
VIETNAM: Buoy............................................................................................... 47
VIETNAM: Restricted area; Anchorage area .................................................... 47
CHINA, South Coast: General information ....................................................... 47, 50
TAIWAN: Anchorage area; Buoyage; Breakwater; Maritime limit................... 50
CHINA, East Coast: Radio reporting lines; Pilot boarding places; Vessel traffic 50
service ................................................................................................................
CHINA, South Coast: Radio reporting lines; Vessel traffic services ................. 50
CHINA, East Coast: Radio reporting points ...................................................... 50
TAIWAN: Virtual aid to navigation ................................................................... 50
TAIWAN: Restricted area .................................................................................. 50, 53
CHINA, South Coast: Restricted area; Scientific instrument ............................ 47, 50
TAIWAN: Buoyage; Anchorage areas; Works ................................................... 50
VIETNAM: Wreck............................................................................................. 47
TAIWAN: Obstructions...................................................................................... 50
MALAYSIA, Peninsular Malaysia, East Coast: Buoy....................................... 47
CHINA, Yellow Sea Coast: Dredging area ........................................................ 52

1A.26
Wk08/21
 IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
839(P)/21 2618 ...................... TAIWAN: Depths; Rocks; Tidal streams ........................................................... 50
884(P)/21 1761, 2401, 2419 CHINA, East Coast: Wind farm......................................................................... 50
15. JAPAN
2962(T)/07 JP 1087................... JAPAN, Honshū: Depths.................................................................................... 53
3852(T)/07 JP 87....................... JAPAN, Honshū: Depths.................................................................................... 53
2050(T)/09 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
2051(T)/09 JP 80....................... JAPAN, Honshū: Depth ..................................................................................... 53
2667(T)/09 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
3043(T)/09 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
3781(T)/09 2024, JP 226.......... JAPAN, Nansei Shotō: Depth; Rock.................................................................. 53
4060(T)/09 JP 107..................... JAPAN, Seto Naikai: Obstruction ...................................................................... 54
4209(T)/09 JP 226..................... JAPAN, Nansei Shotō: Depths........................................................................... 53
4523(T)/09 JP 179, JP 187 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
5182(T)/09 JP 1062, JP 1067 .... JAPAN, Honshū: Depths.................................................................................... 53
5469(T)/09 JP 213, JP 1222 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
6128(T)/09 JP 213, JP 1222 ...... JAPAN, Kyūshū: Depth ..................................................................................... 53
803(T)/10 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
2781(T)/10 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 1228...................
3116(T)/10 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
3611(T)/10 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 1228...................
3873(T)/10 JP 1101................... JAPAN, Seto Naikai: Depths ............................................................................. 54
5507(T)/10 JP 213..................... JAPAN, Kyūshū: Rock....................................................................................... 53
6140(T)/10 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
526(T)/11 JP 153..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
785(T)/11 JP 137A, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
1866(T)/11 JP 104, JP 132 ........ JAPAN, Seto Naikai: Depth ............................................................................... 54
2285(T)/11 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
3253(T)/11 JP 198, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
4930(T)/11 JP 131..................... JAPAN, Seto Naikai: Wreck .............................................................................. 54
4931(T)/11 JP 106, JP 131 ........ JAPAN, Seto Naikai: Wreck .............................................................................. 54
5883(T)/11 JP 137A.................. JAPAN, Seto Naikai: Depth ............................................................................... 54
538(T)/12 JP 131..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
640(T)/12 JP 106, JP 137A, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 153.....................
1861(T)/12 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Depths; Drying patch ...................................................... 54
2143(T)/12 JP 1106................... JAPAN, Seto Naikai: Drying patch.................................................................... 54
3857(T)/12 JP 132..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
5197(T)/12 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
5697(T)/12 JP 151, JP 1102 ...... JAPAN, Seto Naikai: Depths ............................................................................. 53, 54
58(T)/13 JP 87....................... JAPAN, Honshū: Depths.................................................................................... 53
981(T)/13 JP 54, JP 1098 ........ JAPAN, Honshū: Obstruction ............................................................................ 55
1029(T)/13 JP 187..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
1909(T)/13 JP 137A.................. JAPAN, Seto Naikai: Rock ................................................................................ 54
2230(T)/13 JP 141..................... JAPAN, Seto Naikai: Rock ................................................................................ 54
2368(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2692(T)/13 JP 151, JP 1102 ...... JAPAN, Shikoku: Depths ................................................................................... 53, 54
2831(T)/13 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
2832(T)/13 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
3137(T)/13 JP 106, JP 150A, JAPAN, Seto Naikai: Wreck .............................................................................. 54
JP 150C ..................
3833(T)/13 JP 151, JP 1102 ...... JAPAN, Shikoku: Depths ................................................................................... 53, 54
3834(T)/13 JP 198, JP 1228 ...... JAPAN, Kyūshū: Depth ..................................................................................... 53
3835(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
4132(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53

1A.27
Wk08/21
 IA
15. JAPAN - continued
4133(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
4134(T)/13 JP 1222................... JAPAN, Nansei Shotō: Depths........................................................................... 53
5219(T)/13 JP 137A, JP 153 ..... JAPAN, Seto Naikai: Depth ............................................................................... 54
196(T)/14 996, 1648, JP 77, JAPAN, Seto Naikai: Wreck .............................................................................. 53, 54
JP 150C ..................
2751(T)/14 JP 179..................... JAPAN, Honshū: Depths.................................................................................... 53
2916(T)/14 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Depth ............................................................................... 54
3693(T)/14 JP 1169................... JAPAN, Honshū: Depth ..................................................................................... 55
4183(T)/14 JP 1102................... JAPAN, Seto Naikai: Depths ............................................................................. 54
4687(T)/14 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
4805(T)/14 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
4963(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
5209(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depth ..................................................................................... 53
5210(T)/14 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
5470(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
5725(T)/14 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
5727(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
33(T)/15 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
968(T)/15 JP 80....................... JAPAN, Honshū: Depth ..................................................................................... 53
1444(T)/15 JP 151, JP 1102 ...... JAPAN, Seto Naikai: Depths ............................................................................. 53, 54
1698(T)/15 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
2493(T)/15 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
3163(T)/15 JP 108..................... JAPAN, Shikoku: Depth .................................................................................... 53
3298(T)/15 JP 54....................... JAPAN, Honshū: Depth ..................................................................................... 55
3552(T)/15 JP 179, JP 187, JAPAN, Kyūshū: Obstruction ............................................................................ 53
JP 1228...................
3553(T)/15 JP 179, JP 198 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
3684(T)/15 JP 1051................... JAPAN, Honshū: Depth ..................................................................................... 53
3685(T)/15 JP 1053................... JAPAN, Honshū: Depth ..................................................................................... 53
3806(T)/15 JP 93, JP 1051 ........ JAPAN, Honshū: Depth ..................................................................................... 53
3929(T)/15 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
3930(T)/15 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
4168(T)/15 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
4410(T)/15 JP 214B .................. JAPAN, Kyūshū: Obstruction ............................................................................ 53
4924(T)/15 JP 1112A ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
1540(T)/16 JP 145..................... JAPAN, Honshū: Depth ..................................................................................... 55
1638(T)/16 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1773(T)/16 JP 1102................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2485(T)/16 JP 142..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2705(T)/16 JP 93, JP 1051 ........ JAPAN, Honshū: Depths.................................................................................... 53
3085(T)/16 JP 1098................... JAPAN, Honshū: Depths.................................................................................... 55
3157(T)/16 JP 141, JP 142 ........ JAPAN, Seto Naikai: Depths ............................................................................. 54
3160(T)/16 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
3282(T)/16 JP 131, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
4045(T)/16 JP 1192................... JAPAN, Honshū: Obstruction ............................................................................ 55
5126(T)/16 JP 187, JP 213 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
5264(T)/16 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
6268(T)/16 JP 179, JP 187 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
431(T)/17 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
435(T)/17 JP 201, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
782(T)/17 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Depths ............................................................................. 54
784(T)/17 JP 187..................... JAPAN, Kyūshū: Wreck..................................................................................... 53
899(T)/17 JP 79....................... JAPAN, Honshū: Obstruction ............................................................................ 55
1155(T)/17 JP 107..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1395(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
1396(T)/17 JP 107..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1509(T)/17 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53

1A.28
Wk08/21
 IA
15. JAPAN - continued
1626(T)/17 JP 107..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1627(T)/17 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1907(T)/17 JP 93....................... JAPAN, Honshū: Depths.................................................................................... 53
2047(T)/17 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2048(T)/17 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2162(T)/17 JP 79....................... JAPAN, Honshū: Islets....................................................................................... 55
2444(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
3351(T)/17 JP 137B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
3465(T)/17 JP 201, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
3957(T)/17 JP 1051, JP 1052 .... JAPAN, Honshū: Depths.................................................................................... 53
3958(T)/17 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 213.....................
4209(T)/17 JP 127, JP 1101 ...... JAPAN, Seto Naikai: Depths ............................................................................. 54
4214(T)/17 JP 187, JP 213, JAPAN, Kyūshū: Depth ..................................................................................... 53
JP 1222...................
4358(T)/17 JP 187, JP 213 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
4482(T)/17 JP 179, JP 187, JAPAN, Kyūshū: Wreck..................................................................................... 53
JP 198, JP 213 ........
4847(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
4953(T)/17 JP 1052................... JAPAN, Honshū: Depths.................................................................................... 53
5216(T)/17 JP 70, JP 1051, JAPAN, Honshū: Depths.................................................................................... 53
JP 1053...................
5218(T)/17 JP 187, JP 213 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
5220(T)/17 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
5941(T)/17 JP 134B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
6023(T)/17 JP 54....................... JAPAN, Honshū: Depths.................................................................................... 55
144(T)/18 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
362(T)/18 JP 1036................... JAPAN, Hokkaidō: Depths ................................................................................ 55
768(T)/18 JP 63....................... JAPAN, Honshū: Obstructions........................................................................... 55
856(T)/18 JP 1062................... JAPAN, Honshū: Depths.................................................................................... 53
1083(T)/18 JP 79....................... JAPAN, Honshū: Obstructions........................................................................... 55
1507(T)/18 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Obstructions .................................................................... 54
1609(T)/18 JP 1051, JP 1052, JAPAN, Honshū: Depths.................................................................................... 53
JP 1053, JP 1064 ....
1613(T)/18 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
1614(T)/18 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
1615(T)/18 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
1694(T)/18 JP 1103................... JAPAN, Seto Naikai: Depths ............................................................................. 54
3153(T)/18 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
3420(T)/18 JP 1086................... JAPAN, Honshū: Depths.................................................................................... 53
4747(T)/18 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
5095(T)/18 JP 70, JP 1051, JAPAN, Honshū: Depths.................................................................................... 53
JP 1052, JP 1053,
JP 1064...................
5221(T)/18 JP 137B, JP 153, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 1121...................
5367(T)/18 JP 137B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
5368(T)/18 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
5484(T)/18 JP 1112A ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
5485(T)/18 JP 1112A, JP 1112B JAPAN, Seto Naikai: Depths ............................................................................. 54
5486(T)/18 JP 1206................... JAPAN, Nansei Shotō: Depths........................................................................... 53
5699(T)/18 JP 149..................... JAPAN, Honshū: Fish trap ................................................................................. 55
5701(T)/18 JP 153, JP 1108 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54
559(T)/19 JP 104, JP 153, JAPAN, Seto Naikai: Depth ............................................................................... 54
JP 1108...................
859(T)/19 JP 139..................... JAPAN, Honshū: Depth ..................................................................................... 55
1012(T)/19 JP 1055A................ JAPAN, Honshū: Depths.................................................................................... 53

1A.29
Wk08/21

15. JAPAN - continued
1355(T)/19 JP 226.....................
1867(T)/19 JP 65.......................
2267(T)/19 JP 1033A................
2273(T)/19 JP 1107...................
2410(T)/19 JP 1206...................
2649(T)/19 JP 112.....................
2796(T)/19 JP 112.....................
2891(T)/19 JP 150C ..................
3066(T)/19 JP 94.......................
3255(T)/19 JP 1155A ................
3327(T)/19 JP 107.....................
3328(T)/19 JP 87, JP 1097 ........
4033(T)/19 JP 1033A................
4399(T)/19 JP 1120...................
5880(T)/19 JP 226.....................
6045(T)/19 JP 150A..................
6048(T)/19 JP 150A..................
6114(T)/19 JP 1192...................
6136(T)/19 JP 31.......................
6287(T)/19 JP 1088...................
6615(T)/19 JP 1056...................
38(T)/20 JP 123.....................
318(T)/20 JP 70, JP 1051,
JP 1052...................
602(T)/20 JP 66.......................
1125(T)/20 1648, JP 108,
JP 1220...................
1246(T)/20 JP 127.....................
1649(T)/20 JP 135, JP 1262,
JP 1263...................
1786(T)/20 JP 190, JP 1227 ......
1849(T)/20 JP 1197...................
2014(T)/20 JP 90, JP 1061,
JP 1065...................
2204(T)/20 JP 1030, JP 1034,
JP 1036...................
2208(T)/20 JP 123, JP 1103,
JP 1146...................
2209(T)/20 JP 134B ..................
2277(T)/20 JP 1055A................
2595(T)/20 JP 1065...................
2596(T)/20 JP 67.......................
2699(T)/20 JP 1155B ................
2940(T)/20 JP 1109...................
2941(T)/20 JP 1112A ................
3209(T)/20 JP 214A, JP 214B...
3290(T)/20 JP 142, JP 1112A....
3402(T)/20 JP 141, JP 142 ........
3603(T)/20 JP 1065...................
3742(T)/20 JP 1172...................
3744(T)/20 JP 1056...................
3944(T)/20 JP 65.......................
3945(T)/20 JP 63.......................
3947(T)/20 JP 94.......................
3949(T)/20 JP 142, JP 1112A....
4077(T)/20 JP 1141...................
IA
JAPAN, Nansei Shotō: Depth ............................................................................ 53
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Hokkaidō: Depth .................................................................................. 55
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Nansei Shotō: Depths........................................................................... 53
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Seto Naikai: Depth ............................................................................... 54
JAPAN, Honshū: Wreck..................................................................................... 53, 55
JAPAN, Hokkaidō: Depths ................................................................................ 55
JAPAN, Seto Naikai: Works............................................................................... 54
JAPAN, Nansei Shotō: Depths........................................................................... 53
JAPAN: Depths .................................................................................................. 54
JAPAN: Depths .................................................................................................. 54
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Hokkaidō: Depths ................................................................................ 55
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Seto Naikai: Obstruction ...................................................................... 54
JAPAN, Honshū: Obstruction ............................................................................ 53
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Shikoku: Buoy...................................................................................... 53
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Seto Naikai: Works; Vertical clearance ................................................ 54
JAPAN, Kyūshū: Drying heights ....................................................................... 53
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Honshū: Light-beacon.......................................................................... 53
JAPAN, Hokkaidō: Obstruction......................................................................... 55
JAPAN, Seto Naikai: Restricted area ................................................................. 54
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Honshū: Works..................................................................................... 53
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Seto Naikai: Depth ............................................................................... 54
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Kyūshū: Works..................................................................................... 53
JAPAN, Seto Naikai: Obstructions .................................................................... 54
JAPAN, Seto Naikai: Vertical clearance ............................................................ 54
JAPAN, Honshū: Depth ..................................................................................... 53
JAPAN, Honshū: Works..................................................................................... 55
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Honshū: Works..................................................................................... 55
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Seto Naikai: Obstructions .................................................................... 54
JAPAN, Seto Naikai: Depths ............................................................................. 54
1A.30
Wk08/21

15. JAPAN - continued
4183(T)/20 JP 1033A, JP 1033B,
JP 1036...................
4185(T)/20 JP 150A, JP 1103,
JP 1141...................
4308(T)/20 JP 139, JP 1169 ......
4436(T)/20 JP 1102, JP 1108 ....
4529(T)/20 JP 1195...................
4530(T)/20 JP 1061, JP 1086 ....
4631(T)/20 JP 106, JP 150A,
JP 1103...................
4718(T)/20 JP 67, JP 1061,
JP 1062...................
4719(T)/20 JP 127, JP 128 ........
4823(T)/20 JP 67.......................
4825(T)/20 JP 127, JP 1101 ......
4913(T)/20 JP 1162A ................
4914(T)/20 JP 1112A ................
4917(T)/20 JP 135, JP 1262,
JP 1263...................
5073(T)/20 JP 65.......................
5074(T)/20 JP 90, JP 1062,
JP 1081, JP 1085 ....
5076(T)/20 JP 127.....................
5077(T)/20 JP 127, JP 129 ........
5079(T)/20 JP 190, JP 1227 ......
5263(T)/20 JP 1088...................
5264(T)/20 JP 1055A................
5421(T)/20 JP 31.......................
5422(T)/20 JP 148.....................
5423(T)/20 JP 1049...................
5424(T)/20 JP 1086...................
5426(T)/20 JP 134B ..................
5427(T)/20 JP 142, JP 1112B....
5530(T)/20 JP 1162A ................
5531(T)/20 JP 1180...................
5533(T)/20 JP 66.......................
5534(T)/20 JP 107.....................
5536(T)/20 JP 151, JP 1102 ......
5537(P)/20 JP 187, JP 213,
JP 1222...................
5666(T)/20 JP 149.....................
5667(T)/20 JP 66.......................
5668(P)/20 JP 153.....................
5669(T)/20 JP 129.....................
5750(T)/20 JP 1103, JP 1141 ....
5874(T)/20 JP 1100...................
5877(P)/20 JP 131, JP 150A .....
6000(T)/20 JP 1100...................
6001(T)/20 JP 91.......................
6003(T)/20 JP 1107...................
6004(P)/20 JP 153.....................
6005(T)/20 JP 135, JP 1262 ......
6007(T)/20 JP 214A, JP 214B...
6117(T)/20 JP 1155A ................
6119(T)/20 JP 65.......................
6121(T)/20 JP 106.....................
Wk08/21
IA
JAPAN, Hokkaidō: Scientific instruments......................................................... 55
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Honshū: Buoy ...................................................................................... 55
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Honshū: Buoy ...................................................................................... 55
JAPAN, Honshū: Obstruction ............................................................................ 53
JAPAN, Seto Naikai: Obstruction ...................................................................... 54
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Honshū: Depth ..................................................................................... 53
JAPAN, Seto Naikai: Works; Dredging area...................................................... 54
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Seto Naikai: Depth ............................................................................... 54
JAPAN, Seto Naikai: Works; Dredged area ....................................................... 54
JAPAN, Honshū: Depth ..................................................................................... 55
JAPAN, Honshū: Obstruction ............................................................................ 53
JAPAN, Seto Naikai: Works; Dredging area...................................................... 54
JAPAN, Seto Naikai: Works............................................................................... 54
JAPAN, Kyūshū: Depths.................................................................................... 53
JAPAN, Honshū: Depth ..................................................................................... 53
JAPAN, Honshū: Depth ..................................................................................... 53
JAPAN, Hokkaidō: Works.................................................................................. 55
JAPAN, Honshū: Works..................................................................................... 55
JAPAN, Honshū: Obstruction ............................................................................ 53
JAPAN, Honshū: Depth ..................................................................................... 53
JAPAN, Seto Naikai: Depth ............................................................................... 54
JAPAN, Seto Naikai: Depths; Obstructions ....................................................... 54
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Shikoku: Depths ................................................................................... 53, 54
JAPAN, Kyūshū: Bridge .................................................................................... 53
JAPAN, Honshū: Works..................................................................................... 55
JAPAN, Honshū: Obstruction ............................................................................ 53
JAPAN, Seto Naikai: Submarine power cable ................................................... 54
JAPAN, Seto Naikai: Works............................................................................... 54
JAPAN, Seto Naikai: Works............................................................................... 54
JAPAN, Honshū: Works..................................................................................... 55
JAPAN, Seto Naikai: Jetty ................................................................................. 54
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Seto Naikai: Submarine power cable ................................................... 54
JAPAN, Seto Naikai: Works; Dredged area ....................................................... 54
JAPAN, Kyūshū: Works..................................................................................... 53
JAPAN, Honshū: Submarine pipeline ................................................................ 55
JAPAN, Honshū: Dredging area; Works; Submarine pipeline........................... 55
JAPAN, Seto Naikai: Rock ................................................................................ 54
1A.31

15. JAPAN - continued
6122(T)/20 JP 106, JP 137A,
JP 153.....................
6123(T)/20 JP 1227...................
6124(T)/20 JP 226.....................
6263(T)/20 JP 126, JP 1106 ......
6336(T)/20 JP 148, JP 1192 ......
6337(T)/20 JP 139.....................
127(T)/21 JP 10, JP 1195 ........
130(T)/21 JP 1150...................
256(T)/21 JP 1033A, JP 1036 .
258(P)/21 JP 142, JP 1102,
JP 1108...................
259(T)/21 JP 127, JP 128 ........
369(T)/21 JP 1180...................
370(T)/21 JP 1155B ................
371(T)/21 JP 1086...................
372(T)/21 JP 101A..................
373(T)/21 JP 134B ..................
374(T)/21 JP 134B ..................
375(T)/21 JP 1265...................
518(T)/21 JP 66.......................
519(T)/21 JP 1127A ................
633(T)/21 JP 67.......................
634(P)/21 1648, JP 77, JP 108
759(P)/21 JP 213.....................
847(T)/21 JP 1155A ................
848(T)/21 JP 148.....................
16. KOREA AND THE PACIFIC COASTS OF RUSSIA
2427(T)/13 1802, 1803 ...........
1933(T)/14 1230 ......................
2746(T)/14 3340 ......................
3546(T)/16 2432 ......................
955(T)/17 4512 ......................
1076(T)/18 3041 ......................
3252(T)/18 3041 ......................
4188(T)/18 3044 ......................
4192(T)/18 3044 ......................
4193(T)/18 3044 ......................
6031(T)/18 4511, 4512............
212(T)/19 2128 ......................
867(T)/19 3039 ......................
1027(T)/19 1259 ......................
2344(T)/19 4511, 4512............
2345(T)/19 3044 ......................
5630(T)/19 1271 ......................
5764(T)/19 1259 ......................
5767(T)/19 1065 ......................
6063(T)/19 3044 ......................
748(P)/20 127, 1065, 1259,
3480, 3666 ...........
3006(P)/20 127 ........................
3323(T)/20 896, 898, 3480,
3666 ......................
5085(T)/20 127, 3365 .............
5359(T)/20 1258 ......................
IA
JAPAN, Seto Naikai: Rocks............................................................................... 54
JAPAN, Kyūshū: Depths.................................................................................... 53
JAPAN, Nansei Shotō: Light-beacon; Buoy ...................................................... 53
JAPAN, Seto Naikai: Works; Dredging area...................................................... 54
JAPAN, Honshū: Works..................................................................................... 55
JAPAN, Honshū: Light ...................................................................................... 55
JAPAN, Honshū: Fish trap ................................................................................. 55
JAPAN, Seto Naikai: Obstructions; Depths ....................................................... 54
JAPAN, Hokkaidō: Works; Dredged area .......................................................... 55
JAPAN, Seto Naikai: Overhead cable................................................................ 54
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Honshū: Obstruction ............................................................................ 55
JAPAN, Honshū: Obstruction ............................................................................ 55
JAPAN, Honshū: Depths.................................................................................... 53
JAPAN, Seto Naikai: Works............................................................................... 54
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Seto Naikai: Depths ............................................................................. 54
JAPAN, Seto Naikai: Dredging areas................................................................. 54
JAPAN, Honshū: Obstruction ............................................................................ 53
JAPAN, Seto Naikai: Depth ............................................................................... 54
JAPAN, Honshū: Works..................................................................................... 53
JAPAN, Shikoku: Superbuoy; Buoy .................................................................. 53
JAPAN, Kyūshū: Submarine cable .................................................................... 53
JAPAN, Honshū: Depths.................................................................................... 55
JAPAN, Honshū: Dredging area; Works ............................................................ 55
RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 55
RUSSIA, Pacific Ocean Coast: Wreck............................................................... 56
RUSSIA, Pacific Ocean Coast: Restricted area ................................................. 56
RUSSIA, Pacific Ocean Coast: Mooring buoy .................................................. 56
RUSSIA, Pacific Ocean Coast: Obstructions; Area to be avoided .................... 56
RUSSIA, Pacific Ocean Coast: Works............................................................... 56
RUSSIA, Pacific Ocean Coast: Buoyage........................................................... 56
RUSSIA, Pacific Ocean Coast: Restricted areas................................................ 56
RUSSIA, Pacific Ocean Coast: Wrecks ............................................................. 56
RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 56
RUSSIA, Pacific Ocean Coast: Measuring instruments .................................... 55, 56
RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 56
RUSSIA, Pacific Ocean Coast: Floating dock................................................... 56
KOREA, South Coast: Buoy.............................................................................. 52
RUSSIA, Pacific Ocean Coast: Measuring instruments .................................... 55, 56
RUSSIA, Pacific Ocean Coast: Works............................................................... 56
KOREA, West Coast: Buoyage.......................................................................... 52
KOREA, South Coast: Buoy.............................................................................. 52
KOREA, South Coast: Buoy.............................................................................. 52
RUSSIA, Pacific Ocean Coast: Buoyage........................................................... 56
KOREA, West Coast: Submarine cable ............................................................. 52, 53
KOREA, South Coast: Quarantine anchorage ................................................... 53
KOREA, East Coast: Automatic Identification System; Buoyage..................... 52
KOREA, South Coast: Buoy; Automatic Identification System........................ 52, 53
KOREA, West Coast: Dredging areas; Works ................................................... 52
1A.32
Wk08/21

16. KOREA AND THE PACIFIC COASTS OF RUSSIA - continued
6144(T)/20 127, 2347, 3391,
3480 ......................
449(P)/21 898 ........................
649(T)/21 127, 3480, 3666 ..
742(T)/21 127, 3666 .............
830(T)/21 1256, 1258 ...........
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA
2773(T)/15 1748 ......................
1103(T)/16 2134 ......................
4195(P)/16 1420, 2786, 3751
5926(P)/16 8068 ......................
1256(T)/17 2109 ......................
3651(P)/17 1293 ......................
4085(T)/17 2056, 2797, 2862,
3729 ......................
4408(P)/17 8068 ......................
4899(T)/17 3931, 3932 ...........
5479(P)/17 8068 ......................
5784(P)/17 8068 ......................
5867(P)/17 8068 ......................
711(T)/18 921 ........................
2954(P)/18 1338, 1844, 2109,
3483 ......................
3280(P)/18 3747, 3749 ...........
3510(T)/18 3626 ......................
4195(T)/18 945, 2796, 2876 ..
4332(P)/18 3931, 3932 ...........
5212(P)/18 8068 ......................
5227(T)/18 2638, 2893, 2894
5672(T)/18 975, 977, 978 ......
905(P)/19 8068 ......................
1489(T)/19 2470, 2797, 2862
1567(T)/19 1338, 2111, 2112.
2217(P)/19 1844, 2134 ...........
2861(T)/19 1338, 2109, 3483,
3838 ......................
3427(T)/19 3482, 3483 ...........
3465(P)/19 983 ........................
6173(T)/19 1844, 2134 ...........
6188(T)/19 1066, 1312, 2470,
2872, 3757, 3758
6398(T)/19 1822 ......................
950(T)/20 2137, 2873 ...........
1276(T)/20 1338, 2109 ...........
1542(P)/20 2471, 2893 ...........
1543(T)/20 2099 ......................
1992(T)/20 2473, 2791, 2916,
4721, Aus 310 .......
2044(T)/20 162 ........................
2630(P)/20 8068 ......................
2770(P)/20 909, 918 ...............
2779(T)/20 1338, 2109 ...........
3521(T)/20 3482, 3483 ...........
3590(P)/20 3484, 3809, 3811,
4416, 4417, 4473
3926(P)/20 2876, 3726 ...........
3997(P)/20 3809, 3811............
Wk08/21
IA
KOREA, South Coast: Buoy.............................................................................. 52, 53
KOREA, East Coast: Works; Obstructions; Depth ............................................ 52
KOREA, East Coast: Buoyage........................................................................... 52, 53
KOREA, South Coast: Buoyage ........................................................................ 52, 53
KOREA, West Coast: Buoy ............................................................................... 52
MALAYSIA, Sarawak: Works........................................................................... 48
BRUNEI: Beacon; Buoy .................................................................................... 48
INDONESIA, Molucca Sea: Submarine cables................................................. 58
PHILIPPINE ISLANDS, Luzon: Buoy; Wreck ................................................. 48
BRUNEI: Buoy .................................................................................................. 48
INDONESIA, Molucca Sea: Submarine cables................................................. 59
INDONESIA, Java Sea: Buoy ........................................................................... 46, 60
PHILIPPINE ISLANDS, Luzon: Buoyage ........................................................ 48
PHILIPPINE ISLANDS, Luzon: Buoy.............................................................. 48
PHILIPPINE ISLANDS, Luzon: Anchor berths................................................ 48
PHILIPPINE ISLANDS, Luzon: Restricted area .............................................. 48
PHILIPPINE ISLANDS, Luzon: Note .............................................................. 48
INDONESIA, Jawa: Light-beacon..................................................................... 60
BRUNEI: Works; Submarine cable.................................................................... 48
INDONESIA, Papua: Works; Dredging area; Platforms; Submarine pipeline .. 58
MALAYSIA, Sabah: Works............................................................................... 48
INDONESIA, Java Sea: Buoy ........................................................................... 60
PHILIPPINE ISLANDS, Luzon: Fish haven..................................................... 48
PHILIPPINE ISLANDS, Luzon: Coastline; Legends; Wreck ........................... 48
INDONESIA, Sulawesi: General information................................................... 58, 59
INDONESIA, Jawa: Buoy ................................................................................. 60
PHILIPPINE ISLANDS, Luzon: Note .............................................................. 48
INDONESIA, Java Sea: Buoy ........................................................................... 46, 60
MALAYSIA, Sabah: Buoy ................................................................................ 48
BRUNEI: Works; Lights; Channel; Piles; Restricted areas ............................... 48
BRUNEI: Scientific instruments........................................................................ 48
MALAYSIA, Sarawak: Offshore installations................................................... 47, 48
PHILIPPINE ISLANDS, Luzon: Buoyage ........................................................ 48
BRUNEI: Buoy; Light-beacons ......................................................................... 48
INDONESIA, Kalimantan: Wreck..................................................................... 46, 60
MALAYSIA, Sarawak: Buoy ............................................................................ 48
INDONESIA, Java Sea: Wreck.......................................................................... 46
BRUNEI: Jetty; Works....................................................................................... 48
INDONESIA, Kalimantan: Works; Offshore installation; Pipe......................... 59
INDONESIA, Kalimantan: Obstruction ............................................................ 59
INDONESIA, Banda Sea: Scientific instruments .............................................. 60, 63
MALAYSIA, Sarawak: Buoy ............................................................................ 48
PHILIPPINE ISLANDS, Luzon: Lights; Landmark ......................................... 48
INDONESIA, Jawa: Works; Spoil ground......................................................... 46, 60
BRUNEI: Extraction area; Buoyage .................................................................. 48
MALAYSIA, Sarawak: Offshore installations................................................... 47, 48
PHILIPPINE ISLANDS, Bohol: Submarine cables .......................................... 48, 58
INDONESIA, Jawa: Submarine power cable .................................................... 60
PHILIPPINE ISLANDS, Sulu Sea: Reef........................................................... 48, 58
1A.33
 IA
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA - continued
4576(T)/20 2134 ...................... BRUNEI: Barge; Lights ..................................................................................... 48
5111(P)/20 2797, 2862, 3729 INDONESIA, Jawa: Submarine pipeline; Works; Platform .............................. 46, 60
5550(P)/20 3484, 3489, 4413, PHILIPPINE ISLANDS, Luzon: Submarine cables .......................................... 48, 58
4414, 4416, 4484,
4485, 4487, 4488,
4489 ......................
5567(P)/20 2471, 2893 ........... INDONESIA, Kalimantan: Works ..................................................................... 59
5611(P)/20 1822, 1823 ........... MALAYSIA, Sarawak: Piers; Bridge ................................................................ 48
5676(T)/20 2471, 2893 ........... INDONESIA, Kalimantan: Submarine pipeline; Works.................................... 59
5974(P)/20 945, 1066, 2470, INDONESIA, Java Sea: Submarine cables........................................................ 46, 59, 60
2471, 2794, 2795,
2796, 2876, 3029,
3731 ......................
6035(T)/20 3558 ...................... PHILIPPINE ISLANDS, Luzon: Wreck............................................................ 48
6064(P)/20 3426, 3484, 3809, PHILIPPINE ISLANDS, Sulu Sea: Submarine cable........................................ 48, 58
3811, 4416, 4471,
4473 ......................
6142(T)/20 1338, 2109 ........... BRUNEI: Scientific instruments........................................................................ 48
6158(P)/20 3484, 3489, 3809, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
4413, 4414, 4416,
4417, 4477, 4478,
4484, 4489 ...........
6183(T)/20 1844 ...................... BRUNEI: Anchorage area.................................................................................. 48
285(P)/21 3484, 3489, 3558, PHILIPPINE ISLANDS, Luzon: Submarine cables .......................................... 48, 58
3809, 4413, 4414,
4416, 4417, 4477,
4478, 4479, 4484,
4485, 4486, 4489,
4490 ......................
315(T)/21 1949 ...................... MALAYSIA, Sarawak: Buoyage ....................................................................... 48
496(P)/21 3729 ...................... INDONESIA, Jawa: Port development; Recommended track; Anchorage 46
areas; Depth........................................................................................................
498(P)/21 921 ........................ INDONESIA, Jawa: Depths; Alongside depths; Jetty; Dolphins; Obstruction; 60
Wrecks; Light-beacons; Buoyage ......................................................................
676(P)/21 945, 975, 3731 .... INDONESIA, Jawa: Works; Submarine pipelines; Platforms ........................... 60
833(P)/21 3484, 3489, 4413, PHILIPPINE ISLANDS, Luzon: Submarine cables .......................................... 48, 58
4416, 4417, 4485,
4486, 4487 ...........
18. AUSTRALIA AND PAPUA NEW GUINEA
3900(T)/11 Aus 252 .................. AUSTRALIA, Queensland: Depths................................................................... 66
5328(P)/15 Aus 318, Aus 319... AUSTRALIA, Western Australia: Depths ......................................................... 63
929(T)/16 Aus 170, Aus 766... AUSTRALIA, Tasmania: Scientific instruments............................................... 65
1776(T)/16 Aus 252, Aus 824... AUSTRALIA, Queensland: Wreck.................................................................... 66
3414(T)/16 Aus 242 .................. AUSTRALIA, Queensland: Depth .................................................................... 66
3415(T)/16 Aus 136 .................. AUSTRALIA, South Australia: Works .............................................................. 65
3938(T)/16 Aus 813 .................. AUSTRALIA, New South Wales: Obstructions ................................................ 66
3946(T)/16 Aus 327, Aus 328... AUSTRALIA, Western Australia: Scientific instruments.................................. 63
5541(P)/16 Aus 320, Aus 323... AUSTRALIA, Western Australia: Depths ......................................................... 63
1609(T)/17 Aus 4 ...................... AUSTRALIA, Queensland: Buoy ..................................................................... 63
3038(P)/17 Aus 778 .................. AUSTRALIA, South Australia: Depths............................................................. 65
3039(T)/17 Aus 781 .................. AUSTRALIA, South Australia: Works .............................................................. 65
3041(T)/17 Aus 485, Aus 780... AUSTRALIA, South Australia: Restricted area; Hulk ...................................... 65
3534(P)/17 Aus 821, Aus 824, AUSTRALIA, Queensland: Depths................................................................... 66
Aus 825 ..................
4467(P)/17 Aus 270 .................. AUSTRALIA, Queensland: Depths................................................................... 66
4470(T)/17 Aus 242 .................. AUSTRALIA, Queensland: Restricted area ...................................................... 66
4738(T)/17 Aus 110 .................. AUSTRALIA, Western Australia: Scientific instrument ................................... 64

1A.34
Wk08/21

18. AUSTRALIA AND PAPUA NEW GUINEA - continued
5441(P)/17 Aus 270, Aus 280,
Aus 281, Aus 833,
Aus 834 ..................
5635(T)/17 Aus 200, Aus 808...
5857(P)/17 Aus 377 ..................
1358(T)/18 Aus 153, Aus 157...
1601(T)/18 Aus 236 ..................
1802(T)/18 Aus 242 ..................
2708(T)/18 Aus 235, Aus 236,
Aus 814, Aus 815...
3004(T)/18 Aus 235, Aus 236...
3217(T)/18 Aus 172 ..................
3488(T)/18 Aus 235 ..................
3494(T)/18 Aus 236 ..................
4215(T)/18 Aus 130, Aus 137...
4219(T)/18 Aus 236 ..................
4510(T)/18 Aus 795, Aus 796...
4723(T)/18 4622 ......................
6175(T)/18 Aus 171, Aus 173,
Aus 795, Aus 796...
343(T)/19 Aus 236 ..................
771(T)/19 Aus 163 ..................
1191(P)/19 Aus 367, Aus 822...
1223(T)/19 Aus 171, Aus 796...
1517(T)/19 Aus 238 ..................
1519(T)/19 Aus 236 ..................
2363(P)/19 PNG 646 ................
2533(T)/19 Aus 26, Aus 28.......
2534(T)/19 Aus 4 ......................
2626(T)/19 PNG 643 ................
2783(T)/19 Aus 236 ..................
3009(T)/19 Aus 303 ..................
3035(T)/19 Aus 238 ..................
3038(T)/19 Aus 777 ..................
3040(T)/19 Aus 238 ..................
3258(P)/19 Aus 821, Aus 824...
3490(P)/19 Aus 115 ..................
3499(T)/19 Aus 4 ......................
3507(T)/19 Aus 53 ....................
3790(T)/19 Aus 249, Aus 250...
4072(T)/19 Aus 4, Aus 301.......
4075(T)/19 Aus 831 ..................
4078(T)/19 Aus 347 ..................
4080(T)/19 Aus 140, Aus 348,
Aus 349 ..................
4812(T)/19 Aus 237, Aus 238...
4833(T)/19 Aus 235, Aus 236...
4888(P)/19 Aus 32 ....................
5106(T)/19 2472, 4721, Aus 312
5154(T)/19 Aus 151, Aus 152...
5893(T)/19 Aus 59 ....................
6087(T)/19 Aus 117 ..................
6152(P)/19 Aus 262, Aus 263...
6448(T)/19 Aus 153 ..................
47(P)/20 Aus 255 ..................
59(T)/20 Aus 55 ....................
63(T)/20 Aus 110 ..................
IA
AUSTRALIA, Queensland: Depths................................................................... 66
AUSTRALIA, New South Wales: Scientific instruments.................................. 65, 66
AUSTRALIA, Queensland: Reefs ..................................................................... 66
AUSTRALIA, Victoria: Buoyage; Virtual aids to navigation ........................... 65
AUSTRALIA, Queensland: Depths................................................................... 66
AUSTRALIA, Queensland: Wreck.................................................................... 66
AUSTRALIA, Queensland: Scientific instruments; Buoyage........................... 66
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Tasmania: Wreck ....................................................................... 65
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Queensland: Scientific instrument............................................. 66
AUSTRALIA, South Australia: Works .............................................................. 65
AUSTRALIA, Queensland: Depths................................................................... 66
AUSTRALIA, Tasmania: Buoy ......................................................................... 65
PAPUA NEW GUINEA: Fish traps ................................................................... 67
AUSTRALIA, Tasmania: Scientific instruments............................................... 65
AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
AUSTRALIA, Tasmania: Works........................................................................ 65
AUSTRALIA, Queensland: Depths................................................................... 66
AUSTRALIA, Tasmania: Scientific instruments............................................... 65
AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
AUSTRALIA, Queensland: Scientific instrument; Buoy.................................. 66
PAPUA NEW GUINEA: Depths ....................................................................... 67
AUSTRALIA, Northern Territory: Scientific instruments ................................ 63
AUSTRALIA, Queensland: Works.................................................................... 63
PAPUA NEW GUINEA: Buoy .......................................................................... 67
AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
AUSTRALIA, Queensland: Buoy; Jetty............................................................ 66
AUSTRALIA, South Australia: Works .............................................................. 65
AUSTRALIA, Queensland: Works; Buoyage.................................................... 66
AUSTRALIA, Queensland: Depths................................................................... 66
AUSTRALIA, Western Australia: Depths ......................................................... 64
AUSTRALIA, Queensland: Scientific instruments ........................................... 63
AUSTRALIA, Western Australia: Scientific instruments.................................. 63
AUSTRALIA, Queensland: Restricted area ...................................................... 66
AUSTRALIA, Queensland: Tidal gauge; Buoy................................................. 63
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, South Australia: Wreck.............................................................. 65
AUSTRALIA, Victoria: Scientific instruments ................................................. 65
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Western Australia: Depths; Drying height................................. 63
AUSTRALIA, Western Australia: Tanker mooring buoy; Radar beacon .......... 58, 60, 63
AUSTRALIA, Victoria: Depths......................................................................... 65
AUSTRALIA, Western Australia: Buoy ............................................................ 63
AUSTRALIA, Western Australia: Obstruction; Buoy ....................................... 64
AUSTRALIA, Queensland: Works.................................................................... 66
AUSTRALIA, Victoria: Works .......................................................................... 65
AUSTRALIA, Queensland: Depth .................................................................... 66
AUSTRALIA, Western Australia: Measuring instrument ................................. 63
AUSTRALIA, Western Australia: Works; Buoyage .......................................... 64

1A.35
Wk08/21

18. AUSTRALIA AND PAPUA NEW GUINEA - continued
67(T)/20 Aus 57, Aus 327,
Aus 742 ..................
73(P)/20 Aus 332 ..................
730(T)/20 Aus 357, Aus 487,
Aus 802 ..................
732(T)/20 Aus 153 ..................
1201(T)/20 Aus 357, Aus 487...
1719(T)/20 Aus 754 ..................
1726(T)/20 Aus 140, Aus 349...
1733(T)/20 4723, Aus 328 .......
1734(T)/20 Aus 256, Aus 827...
1982(T)/20 Aus 819 ..................
1987(T)/20 Aus 200, Aus 202...
1988(T)/20 Aus 839 ..................
2003(T)/20 Aus 293, Aus 299...
2224(P)/20 PNG 554, PNG 680
2227(P)/20 PNG 512 ................
2263(T)/20 4601, 4644,
Aus 357, Aus 487,
Aus 802 ..................
2288(P)/20 Aus 130, Aus 137,
Aus 138, Aus 781...
2498(P)/20 Aus 53 ....................
2504(T)/20 Aus 238 ..................
2506(T)/20 Aus 237 ..................
2711(T)/20 Aus 327, Aus 328...
2719(T)/20 Aus 349 ..................
2722(T)/20 Aus 238 ..................
2723(T)/20 4723, 4725,
Aus 328, Aus 329...
2899(T)/20 Aus 154 ..................
3213(T)/20 Aus 143, Aus 155...
3215(T)/20 Aus 172 ..................
3374(T)/20 Aus 57 ....................
3384(T)/20 Aus 309, Aus 316,
Aus 722 ..................
3387(T)/20 Aus 143, Aus 158...
3428(T)/20 Aus 826, Aus 827...
3564(T)/20 Aus 328 ..................
3575(P)/20 PNG 621 ................
3606(T)/20 Aus 112 ..................
3609(T)/20 4601, 4602, 4643,
Aus 806, Aus 807,
Aus 808, Aus 809,
Aus 810 ..................
4010(T)/20 Aus 154 ..................
4013(T)/20 Aus 195 ..................
4016(T)/20 Aus 814 ..................
4246(T)/20 Aus 113 ..................
4261(T)/20 Aus 25 ....................
4271(T)/20 Aus 200, Aus 808,
Aus 809 ..................
4543(T)/20 Aus 137 ..................
4545(T)/20 Aus 798 ..................
4701(T)/20 Aus 143, Aus 157...
4704(T)/20 Aus 485, Aus 780,
Aus 781 ..................
4707(T)/20 Aus 163 ..................
IA
AUSTRALIA, Western Australia: Obstruction.................................................. 63
AUSTRALIA, Western Australia: Depths ......................................................... 64
AUSTRALIA, Victoria: Buoyage ...................................................................... 65
AUSTRALIA, Victoria: Scientific instrument; Buoy ........................................ 65
AUSTRALIA, Victoria: Buoy............................................................................ 65
AUSTRALIA, Western Australia: Scientific instruments.................................. 64
AUSTRALIA, Victoria: Scientific instruments ................................................. 65
AUSTRALIA, Western Australia: Works .......................................................... 63
AUSTRALIA, Queensland: Works; Light-beacon; Buoyage ............................ 66
AUSTRALIA, Queensland: Buoyage ................................................................ 66
AUSTRALIA, New South Wales: Light-beacon; Obstructions......................... 65
AUSTRALIA, Queensland: Scientific instruments ........................................... 66
AUSTRALIA, Queensland: Works.................................................................... 66
PAPUA NEW GUINEA: Depths ....................................................................... 67
PAPUA NEW GUINEA: Depths ....................................................................... 67
AUSTRALIA, Victoria: Scientific instruments ................................................. 65, 71
AUSTRALIA, South Australia: Works; Light-beacons; Automatic 65
Identification Systems; Virtual aids to navigation .............................................
AUSTRALIA, Western Australia: Anchor berths .............................................. 63
AUSTRALIA, Queensland: Vertical clearance; Lights ..................................... 66
AUSTRALIA, Queensland: Works.................................................................... 66
AUSTRALIA, Western Australia: Buoy ............................................................ 63
AUSTRALIA, Victoria: Buoyage ...................................................................... 65
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Western Australia: Moored storage tanker ................................ 63, 64
AUSTRALIA, Victoria: Works .......................................................................... 65
AUSTRALIA, Western Australia: Platform....................................................... 65
AUSTRALIA, Tasmania: Works........................................................................ 65
AUSTRALIA, Western Australia: Buoy ............................................................ 63
AUSTRALIA, Northern Territory: Obstruction................................................. 63
AUSTRALIA, Victoria: Buoy............................................................................ 65
AUSTRALIA, Queensland: Obstruction ........................................................... 66
AUSTRALIA, Western Australia: Buoyage ...................................................... 63
PAPUA NEW GUINEA: Depths ....................................................................... 66
AUSTRALIA, Western Australia: Buoyage ...................................................... 64
AUSTRALIA, New South Wales: Obstructions ................................................ 65, 66, 71
AUSTRALIA, Victoria: Works .......................................................................... 65
AUSTRALIA, New South Wales: Restricted area............................................. 65
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Western Australia: Works .......................................................... 64
AUSTRALIA, Northern Territory: Buoy........................................................... 63
AUSTRALIA, New South Wales: Scientific instruments.................................. 65, 66
AUSTRALIA, South Australia: Works; Berths; Lights ..................................... 65
AUSTRALIA, Tasmania: Depths ...................................................................... 65
AUSTRALIA, Victoria: Area to be avoided; Buoyage...................................... 65
AUSTRALIA, South Australia: Tidal gauges .................................................... 65
AUSTRALIA, Tasmania: Works........................................................................ 65
1A.36
Wk08/21

18. AUSTRALIA AND PAPUA NEW GUINEA - continued
4900(T)/20 Aus 117, Aus 754,
Aus 755 ..................
5174(T)/20 Aus 249, Aus 823...
5177(T)/20 Aus 814 ..................
5179(P)/20 Aus 245 ..................
5474(T)/20 Aus 249 ..................
5476(T)/20 Aus 813, Aus 814...
5497(T)/20 Aus 251, Aus 255,
Aus 821, Aus 824,
Aus 825, Aus 826...
5501(T)/20 Aus 26, Aus 28.......
5545(T)/20 4620, 4621, 4622,
PNG 386, PNG 521,
PNG 522, PNG 523
5705(T)/20 Aus 24, Aus 25,
Aus 26 ....................
5706(T)/20 Aus 777 ..................
5707(T)/20 4635, Aus 490,
Aus 816, Aus 818...
5709(P)/20 Aus 834 ..................
5710(T)/20 Aus 754 ..................
5711(T)/20 Aus 236 ..................
5727(T)/20 Aus 137 ..................
5911(T)/20 Aus 309, Aus 316,
Aus 722 ..................
5912(T)/20 Aus 238 ..................
5913(T)/20 Aus 328, Aus 329...
5914(T)/20 Aus 357, Aus 802...
5920(T)/20 Aus 320, Aus 323...
6204(T)/20 Aus 143, Aus 144,
Aus 158, Aus 788...
6205(T)/20 Aus 256 ..................
6208(T)/20 Aus 796 ..................
6210(T)/20 Aus 24, Aus 25,
Aus 26, Aus 28.......
6212(T)/20 Aus 32 ....................
6230(T)/20 Aus 237, Aus 238...
6232(T)/20 Aus 806, Aus 807...
80(T)/21 Aus 814 ..................
85(T)/21 Aus 171, Aus 173,
Aus 795, Aus 796...
87(T)/21 Aus 57, Aus 327,
Aus 742 ..................
89(T)/21 Aus 207, Aus 809,
Aus 810 ..................
94(T)/21 Aus 154 ..................
457(T)/21 Aus 235, Aus 236...
459(T)/21 Aus 143, Aus 155...
460(T)/21 Aus 144, Aus 158...
469(T)/21 Aus 301 ..................
475(T)/21 Aus 252, Aus 824...
476(T)/21 Aus 57, Aus 60.......
481(T)/21 Aus 143, Aus 155,
Aus 157, Aus 158...
707(T)/21 Aus 144, Aus 158...
710(T)/21 Aus 245 ..................
717(T)/21 Aus 840, Aus 841...
718(T)/21 Aus 81 ....................
Wk08/21
IA
AUSTRALIA, Western Australia: Works .......................................................... 64
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Queensland: Buoyage ................................................................ 66
AUSTRALIA, Queensland: Light-beacons; Light; Buoy.................................. 66
AUSTRALIA, Queensland: Scientific instrument; Buoy.................................. 66
AUSTRALIA, New South Wales: Works .......................................................... 66
AUSTRALIA, Queensland: Works; Scientific instruments; Buoyage .............. 66
AUSTRALIA, Northern Territory: Scientific instrument .................................. 63
PAPUA NEW GUINEA: Fish traps ................................................................... 66, 67
AUSTRALIA, Northern Territory: Works; Buoyage; Restricted area............... 63
AUSTRALIA, South Australia: Works; Pipe; Lights ........................................ 65
AUSTRALIA, Queensland: Buoy; Virtual aids to navigation; Restricted area . 66
AUSTRALIA, Queensland: Depth .................................................................... 66
AUSTRALIA, Western Australia: Scientific instrument ................................... 64
AUSTRALIA, Queensland: Buoyage ................................................................ 66
AUSTRALIA, South Australia: Works; Berths; Submarine pipelines............... 65
AUSTRALIA, Northern Territory: Buoyage ..................................................... 63
AUSTRALIA, Queensland: Works; Buoyage; Lights; Piles ............................. 66
AUSTRALIA, Western Australia: Buoyage ...................................................... 63
AUSTRALIA, Victoria: Scientific instruments ................................................. 65
AUSTRALIA, Western Australia: Scientific instruments; Buoyage ................. 63
AUSTRALIA, Victoria: Depth; Virtual aid to navigation ................................. 65
AUSTRALIA, Queensland: Wreck.................................................................... 66
AUSTRALIA, Tasmania: Wreck ....................................................................... 65
AUSTRALIA, Northern Territory: Works; Light-beacons; Restricted area ...... 63
AUSTRALIA, Western Australia: Depths ......................................................... 63
AUSTRALIA, Queensland: Dredging area; Buoyage; Works........................... 66
AUSTRALIA, New South Wales: Scientific instruments.................................. 65
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Tasmania: Scientific instruments............................................... 65
AUSTRALIA, Western Australia: Scientific instrument ................................... 63
AUSTRALIA, New South Wales: Scientific instruments.................................. 66
AUSTRALIA, Victoria: Works; Buoyage.......................................................... 65
AUSTRALIA, Queensland: Light; Buoy........................................................... 66
AUSTRALIA, Victoria: Scientific instruments ................................................. 65
AUSTRALIA, Victoria: Buoy............................................................................ 65
AUSTRALIA, Queensland: Buoy ..................................................................... 63
AUSTRALIA, Queensland: Buoy ..................................................................... 66
AUSTRALIA, Western Australia: Works .......................................................... 63
AUSTRALIA, Victoria: Buoyage ...................................................................... 65
AUSTRALIA, Victoria: Depth; Virtual aid to navigation ................................. 65
AUSTRALIA, Queensland: Works.................................................................... 66
PAPUA NEW GUINEA: Depths ....................................................................... 66
AUSTRALIA, Western Australia: Scientific instruments.................................. 64
1A.37

18. AUSTRALIA AND PAPUA NEW GUINEA - continued
719(T)/21 Aus 200, Aus 202...
720(T)/21 Aus 245 ..................
725(T)/21 Aus 236 ..................
19. NEW ZEALAND
4775(P)/17 NZ 6612 .................
3607(P)/20 NZ 5612 .................
3989(T)/20 NZ 5214, NZ 5215.
20. PACIFIC OCEAN
3021(T)/12 4621, 4623, 4634
679(T)/14 1494, 1570, 1576
681(T)/14 2462, 2463 ...........
249(T)/17 1436 ......................
4785(T)/17 1494 ......................
935(P)/18 SLB 301, SLB 302.
2427(T)/18 2462, 2463 ...........
4792(T)/18 378 ........................
5448(T)/18 1107.......................
1735(P)/19 1494 ......................
5029(P)/19 1107.......................
6384(T)/19 761, 4051, 4052,
4060, 4061, 4062,
4506, 4604, 4605,
4606, 4607, 4615,
4617, 4618, 4619,
4623, 4624, 4625,
4626, 4629, 4632,
4653, 4802, 4808,
4811.......................
448(T)/20 1103.......................
1534(P)/20 SLB 102 .................
1730(P)/20 4622, 4623, 4634,
4635, 4643,
Aus 235, Aus 809,
Aus 815, SLB 305..
2089(T)/20 3664 ......................
2356(T)/20 763, 4506, 4507,
4604, 4622 ...........
3066(T)/20 729 ........................
5433(P)/20 2983 ......................
5982(T)/20 1660, 1670 ...........
156(T)/21 1107.......................
21. ALEUTIAN ISLANDS, ALASKA AND WEST COAST OF NORTH AMERICA INCLUDING MEXICO
4541(T)/20 4945, 4947, 4951,
4954, 4955 ...........
6080(T)/20 3754, 4801, 4810,
4920, 4975 ...........
706(T)/21 588, 591 ...............
22. WEST COASTS OF CENTRAL AND SOUTH AMERICA
3467(T)/15 3084 ......................
6453(T)/15 656 ........................
720(P)/17 1938 ......................
2263(T)/18 1938 ......................
2630(P)/19 1938 ......................
3018(P)/19 8211.......................
4504(T)/19 3089 ......................
IA
AUSTRALIA, New South Wales: Works .......................................................... 65
AUSTRALIA, Queensland: Buoyage ................................................................ 66
AUSTRALIA, Queensland: Light; Buoy........................................................... 66
NEW ZEALAND, South Island: Depths ........................................................... 72
NEW ZEALAND, North Island: Works; Barge; Depth; Light-beacons; Light . 71
NEW ZEALAND, North Island: Buoyage ........................................................ 71
SOUTH PACIFIC OCEAN: Fish havens........................................................... 66, 68
SOUTH PACIFIC OCEAN, Vanuatu: Buoyage ................................................ 68
SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Scientific instruments ........ 68
SOUTH PACIFIC OCEAN, Polynésie Française: Marine farms; Buoyage...... 73
SOUTH PACIFIC OCEAN, Vanuatu: Buoy...................................................... 68
SOUTH PACIFIC OCEAN, Solomon Islands: Depths ..................................... 68
SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Wreck................................. 68
SOUTH PACIFIC OCEAN, Fiji Islands: Beacons ............................................ 70
SOUTH PACIFIC OCEAN, Polynésie Française: Wreck ................................. 73
SOUTH PACIFIC OCEAN, Vanuatu: Works; Buoyage .................................... 68
SOUTH PACIFIC OCEAN, Polynésie Française: Outfall; Restricted areas..... 73
NORTH PACIFIC OCEAN: Data buoys ........................................................... 57, 63, 68,
70, 73, 74,
88, 89
SOUTH PACIFIC OCEAN, Polynésie Française: Buoy ................................... 73
SOUTH PACIFIC OCEAN, Solomon Islands: Depths ..................................... 68
SOUTH PACIFIC OCEAN: Submarine cable................................................... 65, 66, 67,
68
SOUTH PACIFIC OCEAN, Archipel des Tuamotu: Obstructions.................... 73
NORTH PACIFIC OCEAN: Buoyage ............................................................... 57, 59, 67,
68
SOUTH PACIFIC OCEAN, Kiribati: Buoy ...................................................... 70
SOUTH PACIFIC OCEAN, Tuvalu: Depths; Drying heights ........................... 70
SOUTH PACIFIC OCEAN, Fiji Islands: Floating dock.................................... 70
SOUTH PACIFIC OCEAN, Polynésie Française: Light-beacon ...................... 73
CANADA, British Columbia: Restricted areas; Virtual aids to navigation....... 90
CANADA, British Columbia: Restricted area ................................................... 89, 90, 91,
92
UNITED STATES OF AMERICA, West Coast: Disused submarine cable; Foul 89
PERU: Precautionary area.................................................................................. 98
MEXICO, Pacific Ocean Coast: Light; Buoy .................................................... 89
MEXICO, Pacific Ocean Coast: Works ............................................................. 89
MEXICO, Pacific Ocean Coast: Buoy; Radar beacon....................................... 89
MEXICO, Pacific Ocean Coast: Wreck ............................................................. 89
COLOMBIA, Pacific Ocean Coast: Note .......................................................... 88
PERU: Buoyage ................................................................................................. 98
1A.38
Wk08/21
 IA
22. WEST COASTS OF CENTRAL AND SOUTH AMERICA - continued
1303(T)/20 3087 ...................... PERU: Buoy....................................................................................................... 98
1792(T)/20 3090 ...................... PERU: Buoy....................................................................................................... 98
3860(T)/20 1853 ...................... PERU: Buoy....................................................................................................... 98
4768(P)/20 8007, CP 5............. PANAMA, Pacific Ocean Coast: Buoyage; Lights............................................ 88
5391(P)/20 1946 ...................... EL SALVADOR: Depths; Obstructions; Pilot boarding place; Anchorage area; 89
Buoyage; Lights .................................................................................................
5743(P)/20 8090 ...................... PERU: Danger areas .......................................................................................... 98
6272(T)/20 2319 ...................... COLOMBIA, Pacific Ocean Coast: Wreck ....................................................... 98
545(P)/21 1853, 8090 ........... PERU: Anchorage areas ..................................................................................... 98
730(T)/21 1940 ...................... MEXICO, Pacific Ocean Coast: Buoy............................................................... 89
23. ANTARCTICA
4399(P)/14 1776 ...................... ANTARCTICA: Coastline; Rocks; Depths........................................................ 97
24. EAST COAST OF SOUTH AMERICA AND THE FALKLAND ISLANDS
1309(T)/13 529, 3971 ............. BRAZIL, South Coast: Mooring buoys ............................................................. 95
469(T)/16 587 ........................ BRAZIL, South Coast: Alongside depths .......................................................... 95
884(T)/16 2506 ...................... SOUTH ATLANTIC OCEAN, Falkland Islands: Light-beacon; Leading line . 96
1015(T)/17 545 ........................ BRAZIL, East Coast: Works; Buoyage.............................................................. 95
5463(P)/17 566 ........................ BRAZIL, South Coast: Automatic Identification Systems ................................ 95
5978(P)/17 8076 ...................... URUGUAY: Anchorage areas............................................................................ 95
606(P)/18 3703 ...................... URUGUAY: Restricted areas ............................................................................. 95
1244(T)/18 579, 589 ............... BRAZIL, South Coast: Buoyage........................................................................ 95
1268(T)/18 3561 ...................... URUGUAY: Depths ........................................................................................... 95
1316(P)/18 8076 ...................... URUGUAY: Maintained channel....................................................................... 95
2509(T)/18 566 ........................ BRAZIL, South Coast: Obstruction................................................................... 95
3315(T)/18 566 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
3655(P)/18 329, 330, 331, 520, BRAZIL, North Coast: Lights; Radar beacon; Automatic Identification 95
2204, 3959 ........... Systems; Buoyage; Virtual aids to navigation....................................................
3679(P)/18 541 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
4726(P)/18 8076 ...................... URUGUAY: Restricted areas; Depths; Rocks; Pilot boarding place ................. 95
4956(P)/18 566 ........................ BRAZIL, South Coast: Obstructions ................................................................. 95
393(T)/19 2001, 8076 ........... URUGUAY: Works; Buoyage; Restricted area.................................................. 95
458(P)/19 8076 ...................... URUGUAY: Radar beacon................................................................................. 95
961(T)/19 545 ........................ BRAZIL, East Coast: Buoy................................................................................ 95
1144(P)/19 29 .......................... BRAZIL, South Coast: Obstructions ................................................................. 95
2025(T)/19 2189 ...................... BRAZIL, East Coast: Wreck.............................................................................. 95
2578(P)/19 566 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
2582(P)/19 495 ........................ BRAZIL, East Coast: Obstructions.................................................................... 95
3411(T)/19 529, 3972, 3973 .. BRAZIL, East Coast: Buoyage .......................................................................... 95
4952(T)/19 2012, 3984 ........... BRAZIL, South Coast: Buoy ............................................................................. 95
5044(P)/19 8094 ...................... ARGENTINA: Note........................................................................................... 96
5230(P)/19 8076 ...................... URUGUAY: Virtual aid to navigation................................................................ 95
5269(P)/19 8076 ...................... URUGUAY: Light-beacon; Automatic Identification System ........................... 95
5570(P)/19 432, 433 ............... BRAZIL, South Coast: Depths .......................................................................... 95
72(P)/20 2189 ...................... BRAZIL, East Coast: Depths ............................................................................. 95
990(P)/20 2189 ...................... BRAZIL, East Coast: Depths ............................................................................. 95
998(P)/20 555 ........................ BRAZIL, South Coast: Beacon.......................................................................... 95
1215(T)/20 1323, 1751, 3561 ARGENTINA: Dredging area; Buoyage ........................................................... 95
1232(P)/20 540, 545 ............... BRAZIL, East Coast: Virtual aids to navigation................................................ 95
1767(P)/20 331 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
1835(P)/20 432 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
2795(P)/20 550 ........................ BRAZIL, South Coast: Depths .......................................................................... 95
3079(T)/20 540, 545 ............... BRAZIL, East Coast: Buoy................................................................................ 95
3097(P)/20 2189 ...................... BRAZIL, East Coast: Depths ............................................................................. 95
3246(P)/20 1328 ...................... ARGENTINA: Channel limit ............................................................................ 95
3789(T)/20 555 ........................ BRAZIL, South Coast: Buoy ............................................................................. 95

1A.39
Wk08/21
 IA
24. EAST COAST OF SOUTH AMERICA AND THE FALKLAND ISLANDS - continued
3965(T)/20 2001 ...................... URUGUAY: Wreck ............................................................................................ 95
4021(T)/20 2001 ...................... URUGUAY: Mooring buoys.............................................................................. 95
4053(P)/20 29 .......................... BRAZIL, South Coast: Obstruction................................................................... 95
4219(T)/20 431 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
5105(T)/20 1327 ...................... ARGENTINA: Restricted area .......................................................................... 95
5160(P)/20 547 ........................ BRAZIL, South Coast: Depths .......................................................................... 95
5230(P)/20 8076 ...................... URUGUAY: Anchorage areas; Legends ............................................................ 95
5328(P)/20 551, 3972 ............. BRAZIL, East Coast: Spoil ground ................................................................... 95
5654(P)/20 29, 191, 3980 ...... BRAZIL, South Coast: Anchorage areas; Spoil ground .................................... 95
214(P)/21 579 ........................ BRAZIL, South Coast: Buoyage........................................................................ 95
228(T)/21 495 ........................ BRAZIL, East Coast: Obstruction ..................................................................... 95
360(P)/21 541 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
651(P)/21 566 ........................ BRAZIL, South Coast: Depths .......................................................................... 95
726(P)/21 556, 3064, 3324 .. ARGENTINA: Submarine cable........................................................................ 95, 96
887(T)/21 529, 530 ............... BRAZIL, South Coast: Buoy ............................................................................. 95
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO
1527(T)/15 1278, 2262 ........... COLOMBIA, Caribbean Sea Coast: Obstruction .............................................. 88
1607(P)/16 8065 ...................... VENEZUELA: Radar beacon ............................................................................ 87
2140(P)/16 8065 ...................... VENEZUELA: Depths; Wrecks; Buoyage; Lights............................................ 87
2586(T)/16 376, 1307 ............. MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
2769(T)/16 2434 ...................... COLOMBIA, Caribbean Sea Coast: Buoyage................................................... 88
3726(P)/16 8065 ...................... VENEZUELA: Radar beacon ............................................................................ 87
4197(P)/16 8211....................... COLOMBIA, Caribbean Sea Coast: Beacons ................................................... 88
4258(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4292(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4293(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4666(T)/16 2866, 3910 ........... WEST INDIES, Bahamas: Lights...................................................................... 83
5900(P)/16 8211....................... COLOMBIA, Caribbean Sea Coast: Anchorage area; Legend; Buoyage.......... 88
6160(P)/16 8242 ...................... WEST INDIES, Jamaica: Notes......................................................................... 86
6211(P)/16 465, 466, 3907, HAITI: Depths; Coastline; Lights; Wrecks; Obstructions ................................. 86
3935 ......................
6342(P)/16 8211....................... COLOMBIA, Caribbean Sea Coast: Anchorage areas; Legends....................... 88
6507(P)/16 8195 ...................... MEXICO, Gulf of Mexico: Foul........................................................................ 85
528(P)/17 8242 ...................... WEST INDIES, Jamaica: Automatic Identification System.............................. 86
1215(P)/17 8211....................... COLOMBIA, Caribbean Sea Coast: Note ......................................................... 88
1497(T)/17 1629 ...................... CARIBBEAN SEA: Buoy ................................................................................. 87
3276(T)/17 2766 ...................... SURINAME: Obstruction; Light ....................................................................... 87
3747(P)/17 8211....................... COLOMBIA, Caribbean Sea Coast: Note ......................................................... 88
5136(P)/17 8065 ...................... VENEZUELA: Legend...................................................................................... 87
1763(T)/18 794 ........................ WEST INDIES, Windward Islands: Buoy ......................................................... 87
2080(T)/18 2006, 2019, 2020 WEST INDIES, Virgin Islands: Buoyage; Wrecks; Obstructions ..................... 86
2527(P)/18 8250 ...................... WEST INDIES, Bahamas: Legend; Pilot boarding places ................................ 83
2835(P)/18 8242 ...................... WEST INDIES, Jamaica: Channel limits; Buoyage; Light-beacons; Dredged 86
depth; Works.......................................................................................................
4628(T)/18 3768 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
4917(T)/18 474 ........................ WEST INDIES, Trinidad and Tobago: Wreck ................................................... 87
5026(P)/18 8211....................... COLOMBIA, Caribbean Sea Coast: Light; Obstruction ................................... 88
5199(P)/18 8211....................... COLOMBIA, Caribbean Sea Coast: Radar beacon ........................................... 88
5341(P)/18 3768 ...................... MEXICO, Gulf of Mexico: Wreck; Restricted area........................................... 83
5983(T)/18 1307, 2626 ........... MEXICO, Gulf of Campeche: Platform ............................................................ 83
5994(P)/18 8211....................... COLOMBIA, Caribbean Sea Coast: Restricted areas; Submarine pipeline; 88
Buoy ...................................................................................................................
659(P)/19 230, 2191 ............. VENEZUELA: Superbuoy; Submarine pipeline ............................................... 87
949(T)/19 501, 517, 1044, WEST INDIES, Trinidad and Tobago: Platform; Light..................................... 87
1045 ......................
972(T)/19 475 ........................ WEST INDIES, Trinidad and Tobago: Platforms .............................................. 87

1A.40
Wk08/21

25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO - continued
1399(T)/19 257, 258, 454, 458,
459, 464, 8242 ....
1895(T)/19 483, 1044, 1045 ..
2703(P)/19 8211.......................
2745(T)/19 364, 365, 376, 3768
2924(T)/19 483 ........................
2997(P)/19 8211.......................
3392(T)/19 2753 ......................
3634(P)/19 2019, 2020 ...........
3977(T)/19 662 ........................
4086(T)/19 1629 ......................
4250(T)/19 3190 ......................
4277(P)/19 8211.......................
4909(T)/19 1966, 2191 ...........
5358(T)/19 2434 ......................
5444(P)/19 359, 1307, 2626 ..
5925(P)/19 517, 519, 527, 537,
572, 2687 .............
6185(P)/19 1400 ......................
6350(T)/19 1307, 2626 ...........
156(P)/20 1450 ......................
202(T)/20 483 ........................
203(T)/20 359 ........................
207(T)/20 2751, 8195 ...........
208(T)/20 375 ........................
411(T)/20 474 ........................
510(P)/20 8211.......................
630(P)/20 487, 489, 583, 584,
1025, 2016 ...........
969(P)/20 2005, 2006, 2016,
2019, 2020 ...........
1055(T)/20 2988 ......................
1079(P)/20 2005, 2019 ...........
1111(T)/20 2079 ......................
1178(T)/20 2751, 8195 ...........
1186(T)/20 474 ........................
1666(T)/20 2765 ......................
1794(P)/20 8242 ......................
1818(T)/20 2626 ......................
2058(P)/20 487, 489, 583, 584,
585 ........................
2211(T)/20 502 ........................
2321(P)/20 1629 ......................
2849(T)/20 8006, CP 1.............
2920(T)/20 368, 369, 491, 494,
593, 618, 804,
1025, 1042, 2079
3019(T)/20 2765 ......................
3074(T)/20 2190 ......................
3238(T)/20 1628, 8065 ...........
3403(P)/20 365 ........................
4197(T)/20 618, 804 ...............
4268(P)/20 583, 1025, 2016,
2600 ......................
4952(T)/20 618 ........................
4958(T)/20 2626 ......................
5057(P)/20 8195 ......................
Wk08/21
IA
WEST INDIES, Jamaica: Anchorage areas; Anchor berths; Berths; Moorings; 86
Piers; Reported anchorages ................................................................................
WEST INDIES, Trinidad and Tobago: Buoyage ............................................... 87
COLOMBIA, Caribbean Sea Coast: Restricted areas; Legends ........................ 88
MEXICO, Gulf of Mexico: Obstructions........................................................... 83
WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
COLOMBIA, Caribbean Sea Coast: Legends ................................................... 88
MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
WEST INDIES, Virgin Islands: Depths ............................................................. 86
MEXICO, Caribbean Sea Coast: Fish havens.................................................... 85
VENEZUELA: Buoy ......................................................................................... 87
UNITED STATES OF AMERICA, Gulf of Mexico: Vertical clearance; Works 83
COLOMBIA, Caribbean Sea Coast: Marine Reserve........................................ 88
VENEZUELA: Buoy ......................................................................................... 87
COLOMBIA, Caribbean Sea Coast: Buoy ........................................................ 88
MEXICO, Gulf of Campeche: Works; Depths................................................... 83
GUYANA: Submarine cable .............................................................................. 87
PANAMA, Caribbean Sea Coast: Pier; Buoyage; Dolphin ............................... 88
MEXICO, Gulf of Campeche: Buoyage; Wreck................................................ 83
WEST INDIES, Turks and Caicos Islands: Depths; Drying heights; Coral ...... 86
WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
MEXICO, Gulf of Mexico: Buoyage................................................................. 83
MEXICO, Gulf of Mexico: Buoy ...................................................................... 83, 85
MEXICO, Gulf of Mexico: Buoyage................................................................. 83
WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
COLOMBIA, Caribbean Sea Coast: Coastline .................................................. 88
WEST INDIES, Leeward Islands: Lights .......................................................... 86
WEST INDIES, Virgin Islands: Depths ............................................................. 86
HONDURAS: Buoy........................................................................................... 85
WEST INDIES, Virgin Islands: Wrecks; Marine Reserves ............................... 86
WEST INDIES, Leeward Islands: Works .......................................................... 86
MEXICO, Gulf of Mexico: Platform ................................................................. 83, 85
WEST INDIES, Trinidad and Tobago: Buoyage ............................................... 87
SURINAME: Anchorage area............................................................................ 87
WEST INDIES, Jamaica: Buoy; Jetty................................................................ 86
MEXICO, Gulf of Campeche: Buoy.................................................................. 83
WEST INDIES, Leeward Islands: Marine Reserves; Restricted area ............... 86
WEST INDIES, Windward Islands: Buoy ......................................................... 87
VENEZUELA: Buoy ......................................................................................... 87
PANAMA, Panama Canal: Buoyage ................................................................. 88
WEST INDIES, Windward Islands: Restricted areas ........................................ 86, 87
SURINAME: Buoy ............................................................................................ 87
VENEZUELA: Buoy ......................................................................................... 87
VENEZUELA: Buoy ......................................................................................... 87
MEXICO, Gulf of Mexico: Works..................................................................... 83
WEST INDIES, Leeward Islands: Wreck .......................................................... 87
WEST INDIES, Leeward Islands: Depth........................................................... 86
WEST INDIES, Leeward Islands: Buoyage; Dredging area ............................. 87
MEXICO, Gulf of Campeche: Buoy.................................................................. 83
MEXICO, Gulf of Mexico: Restricted area; Wreck........................................... 85
1A.41

25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO - continued
5429(P)/20 8007 ......................
5440(P)/20 517, 572 ...............
5770(T)/20 481, 483 ...............
6036(T)/20 583, 1025, 2016,
2047, 2600 ...........
6275(T)/20 2626 ......................
172(T)/21 2267 ......................
219(T)/21 2751, 8195 ...........
234(P)/21 477 ........................
612(T)/21 2434, 8211............
761(T)/21 517, 2764, 4216 ..
794(P)/21 8006 ......................
26. EAST COAST OF NORTH AMERICA AND GREENLAND
5976(P)/15 8122 ......................
1565(P)/16 8122 ......................
2681(P)/16 2490, 2492, 4746
2682(P)/16 2864, 2865, 3691
5140(P)/16 8248 ......................
928(P)/17 8187 ......................
1397(T)/17 2483 ......................
1417(T)/17 2732 ......................
2032(P)/17 8201 ......................
2035(P)/17 8202 ......................
2071(P)/17 8202 ......................
3037(P)/17 8249 ......................
5582(P)/17 8201 ......................
1567(P)/18 8201 ......................
3430(P)/18 8188 ......................
3595(P)/18 8224 ......................
4422(P)/18 8188 ......................
5850(P)/18 8249 ......................
2413(P)/19 8248 ......................
3946(P)/19 8201 ......................
5690(P)/19 8122 ......................
5701(P)/19 8189 ......................
6022(P)/19 8248, 8249 ...........
444(P)/20 2755, 2860 ...........
995(P)/20 8187, 8188, 8189
2360(P)/20 8224 ......................
2733(T)/20 4750 ......................
3883(P)/20 2919 ......................
5565(P)/20 8187 ......................
5821(P)/20 8188 ......................
IA
PANAMA, Panama Canal: Maritime limit; Works............................................ 88
GUYANA: Submarine pipeline.......................................................................... 87
WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
WEST INDIES, Leeward Islands: Wreck .......................................................... 86
MEXICO, Gulf of Campeche: Wreck................................................................ 83
COLOMBIA, Caribbean Sea Coast: Leading lights .......................................... 88
MEXICO, Gulf of Mexico: Obstruction ............................................................ 83, 85
WEST INDIES, Trinidad and Tobago: Works; Submarine pipeline .................. 87
COLOMBIA, Caribbean Sea Coast: Anchorage area; Depths........................... 88
SURINAME: Platform; Restricted area............................................................. 87
PANAMA, Panama Canal: Light; Leading lights; Leading line........................ 88
UNITED STATES OF AMERICA, East Coast: Automatic Identification 81
System ................................................................................................................
UNITED STATES OF AMERICA, East Coast: Wreck ..................................... 81
UNITED STATES OF AMERICA, East Coast: Maritime limit ........................ 80, 81
UNITED STATES OF AMERICA, East Coast: Maritime limit ........................ 81
UNITED STATES OF AMERICA, East Coast: Channel limits ........................ 81
UNITED STATES OF AMERICA, East Coast: Obstructions; Wrecks ............. 81
UNITED STATES OF AMERICA, East Coast: Buoyage ................................. 81
UNITED STATES OF AMERICA, East Coast: Buoyage ................................. 81
UNITED STATES OF AMERICA, East Coast: Anchorage areas; Legends ..... 81
UNITED STATES OF AMERICA, East Coast: Anchorage areas; Legends ..... 81
UNITED STATES OF AMERICA, East Coast: Note........................................ 81
UNITED STATES OF AMERICA, East Coast: Note........................................ 81
UNITED STATES OF AMERICA, East Coast: Light; Light-beacon ............... 81
UNITED STATES OF AMERICA, East Coast: Obstruction............................. 81
UNITED STATES OF AMERICA, East Coast: Note........................................ 81
UNITED STATES OF AMERICA, East Coast: Light....................................... 81
UNITED STATES OF AMERICA, East Coast: Dredged depths ...................... 81
UNITED STATES OF AMERICA, East Coast: Dredged depths ...................... 81
UNITED STATES OF AMERICA, East Coast: Vertical clearance; Horizontal 81
clearance.............................................................................................................
UNITED STATES OF AMERICA, East Coast: Lights; Leading line ............... 81
UNITED STATES OF AMERICA, East Coast: Channel limits; Depth 81
information; Legends; Dredged depths..............................................................
UNITED STATES OF AMERICA, East Coast: Radar beacon.......................... 81
UNITED STATES OF AMERICA, East Coast: Channel limits; Depth 81
information; Dredged depth; Legends; Submarine cable...................................
UNITED STATES OF AMERICA, East Coast: Submarine cable..................... 81
UNITED STATES OF AMERICA, East Coast: Channel limits; Coastline; 81
Depth information; Depths; Dredged depths; Horizontal clearance; Legends;
Obstructions; Rocks; Submarine cables.............................................................
UNITED STATES OF AMERICA, East Coast: Legends; Restricted area ........ 81
CANADA: Works .............................................................................................. 80
UNITED STATES OF AMERICA, East Coast: Submarine cable..................... 81
UNITED STATES OF AMERICA, East Coast: Legend.................................... 81
UNITED STATES OF AMERICA, East Coast: Horizontal clearance; Vertical 81
clearances; Legend .............................................................................................
Source: UKHO
1A.42
Wk08/21
 II

GEOGRAPHICAL INDEX

(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.6

(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7 – 2.10
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.10 – 2.11
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . 2.12 – 2.15
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.15 – 2.16
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.17 – 2.19
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19 – 2.20
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.20
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.20 – 2.22
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.22 – 2.24
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24 – 2.25
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.25 – 2.26
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.26
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . 2.27 – 2.28
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.29 – 2.31
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.32
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.32 – 2.33
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34 – 2.44

2.1
Wk08/21
 II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
787 2.20 50 844 2.23 54
788(P)/21 2.35 18 845 2.23 54
789 2.26 66 846 2.24 54
790 2.24 52 847(T)/21 2.42 55
791 2.32 87 848(T)/21 2.43 55
792* 2.7 7 849 2.16 20
793* 2.15 82 850 2.21 52
794(P)/21 2.44 88 851(P)/21 2.34 3
795* 2.7 3 852 2.18 30
796 2.32 81 853 2.21 52
797* 2.7 3 854 2.21 47
798 2.19 42 855 2.10 10
799* 2.8 5 856 2.25 58
800* 2.8 1, 7, 8 857 2.11 10
801* 2.17 24 858 2.11 10
802 2.20 47 859 2.11 9, 10
803 2.33 81 860 2.18 31
804 2.12 9 861 2.26 65
805* 2.9 1 862 2.33 81
806 2.27 90 863 2.6 10
807(P)/21 2.36 17 864(T)/21 2.34 10
808* 2.9 2 865 2.18 25
809 2.17 24 866 2.21 50
810(P)/21 2.36 16, 17, 18 867 2.21 47
811* 2.32 86 868 2.25 52
812(P)/21 2.35 9 869 2.22 50
813* 2.9 2 870 2.31 88, 98
814 2.12 7, 9, 13 871 2.28 91
815* 2.20 42 872 2.20 45
816 2.6 26 873 2.22 50
817 2.6 10 874(P)/21 2.38 32, 40, 41, 42, 43, 45, 46
818* 2.13 9 875 2.25 53
819(T)/21 2.40 47 876(T)/21 2.35 11
820(T)/21 2.40 45 877(P)/21 2.37 34
821 2.24 52 878 2.22 50
822 2.32 83 879(T)/21 2.39 42, 43
823(T)/21 2.34 1 880 2.19 31
824* 2.13 9 881 2.26 46, 48
825 2.24 52, 53 882 2.19 34
826 2.29 98 883 2.19 32
827* 2.9 5 884(P)/21 2.42 50
828* 2.10 5 885 2.25 52
829 2.25 52 886 2.32 83
830(T)/21 2.43 52 887(T)/21 2.44 95
831(T)/21 2.40 52
832 2.20 41
833(P)/21 2.43 48, 58
834 2.13 6, 13
835 2.15 9
836 2.33 81
837 2.17 31
838* 2.10 7
839(P)/21 2.41 50
840 2.27 89
841 2.20 52
842 2.22 53
843 2.23 54

2.2
Wk08/21
 II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices

Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

12 874P 1607 800

15 874P 1652 823T
20 810P 1665 873
38 832 1698 805
106 792 1738 878
120 804 1759 787
127 825, 875 1761 884P
128 804, 835 1828 800
159 874P 1847 849
164 874P 1859 808
194 801 2013 797
246 852 2014 864T
247 852 2015 864T
263 874P 2018 864T
264 874P 2020 811
267 814 2040 864T
272 814 2069 879T
295 834 2085 876T
332 793 2106 857
333 874P, 883 2108 855
334 793 2117 863
343 867 2123 801
360 793 2182D 834
420 812P 2214 880
473 865 2230 880
483 791 2232 880
529 887T 2257 870
530 887T 2258 870
536 823T 2284 837
806 841 2288 864T
818 874P 2326 799
830 874P 2344 859
868 793 2375 874P
893 876T 2401 884P
894 855 2403 820T
913 821 2419 884P
1008 885 2441 874P
1012 815 2442 874P
1018 816 2450 823T
1044 791 2451 823T
1045 791 2470 881
1059 802 2476 799
1065 868 2522 807P, 810P
1104 810P 2532 817
1130 866 2540 827
1162 809 2563 862
1163 829 2566 838
1166 813 2591 858
1175 788P 2601 863
1183 800 2618 839P
1206 853 2638 856
1249 853 2663 810P
1255 853 2677 864T
1256 830T 2679 864T
1258 830T 2688 864T
1272 860 2760 874P
1307 886 2770 828
1312 881 2812 882
1315 793 2849 806
1374 819T 2860 862
1405 814 2861 862
1422 814 2870 881
1427 834 2872 881
1428 834 2919 803
1447 795 2920 796
1506 831T 2921 836
1543 792 2942 817, 857
1568 854 2944 863
1602 869 2970 874P

2.3
Wk08/21
 II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices

Notices Indian
Admiralty Chart No. Notices
Chart No.
2986 807P IN 273 874P
2997 810P IN 293 874P
3103 877P IN 2036 874P
3391 825 IN 2075 798
3446 819T
3480 825, 850
3484 833P Japanese
Notices
3489 833P Chart No.
3642 790
3721 881 JP 80 842
3754 871 JP 123 843, 844
3784 874P JP 148 848T
3833 820T JP 165 845
3854 822 JP 1107 844
3904 874P JP 1137 846
3928 821 JP 1146 843
3943 872, 874P JP 1155A 847T
3947 820T
4038 820T International
4103 810P Notices
4217 826 Chart No.
4230 826
4235 826 INT 103 810P
4237 826 INT 553 833P
4238 826 INT 554 833P
4240 826 INT 705 874P
4245 826 INT 706 874P
4246 826 INT 754 879T
4413 833P INT 811 870
4416 833P INT 1040 834
4417 833P INT 1044 814
4485 833P INT 1175 876T
4486 833P INT 1201 864T
4487 833P INT 1202 864T
4705 874P INT 1218 864T
4706 874P INT 1219 864T
4811 870 INT 1288 864T
4908 840 INT 1297 864T
4935 871 INT 1302 855
4936 871 INT 1303 857
4937 871 INT 1351 863
4938 871 INT 1353 817, 857
8006 794P INT 1365 859
8095 851P INT 1366 859
INT 1373 817
INT 1377 858
Australian INT 1400 814
Notices INT 1401 834
Chart No.
INT 1402 834
Aus 293 789 INT 1451 812P
Aus 343 861 INT 1452 818
Aus 346 861 INT 1455 824
Aus 347 861 INT 1478 804, 835
Aus 485 861 INT 1479 804
Aus 776 861 INT 1552 838
Aus 780 861 INT 1561 800
INT 1562 800
INT 1563 800
German INT 1655 808
Notices
Chart No. INT 1703 823T
INT 1704 823T
DE 42 859 INT 1736 805
DE 44 818 INT 1740 823T
DE 48 824 INT 1802 807P, 810P
INT 1803 810P
Indian INT 1840 807P
Notices INT 1848 788P
Chart No.
INT 1929 849
IN 32 879T INT 2873 877P

2.4
Wk08/21
 II

INDEX OF CHARTS AFFECTED

International
Admiralty Chart No. Notices Admiralty Chart No. Notices
Notices
Chart No.
INT 3167 865
INT 3660 852
INT 3794 852
INT 5254 821
INT 5360 825
INT 5364 790
INT 7002 874P
INT 7010 874P
INT 7014 874P
INT 7019 832
INT 7022 874P
INT 7115 874P
INT 7120 874P
INT 7124 874P
INT 7132 874P
INT 7135 874P, 883
INT 7142 874P
INT 7154 874P
INT 7233 874P
INT 7352 874P
INT 7366 798
INT 7374 815
INT 7433 874P

2.5
Wk08/21
 II
817 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

2532 3230/20 Effective from 18/02/2021

INT 1373 Insert magenta limit and chart number, DE26, as follows:

North: 54-56.50N East: 9-55.00E

South: - West: -
Delete magenta limit and chart number, 919, in position 54-59.89N 10-09.75E

2942 6213/20 Effective from 18/02/2021

INT 1353 Insert magenta limit and chart number, DE26, as follows:

North: - East: 9-55.00E

South: 54-44.70N West: -
Delete magenta limit and chart number, 919, in the following positions:

54-52.77N 10-09.57E
54-41.14N 10-09.57E

863 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

2117 471/21 Effective from 18/02/2021

Insert magenta limit and chart number, DE1671, as follows:

North: 54° 25´·70N. East: -

South: 54° 07´·80N. West: 11° 39´·50E.

2601 75/21 Effective from 18/02/2021

Insert magenta limit and chart number, DE1671, as follows:

North: 54° 25´·70N. East: 12° 25´·00E.

South: - West: 11° 39´·50E.

2944 75/21 Effective from 18/02/2021

INT 1351 Insert magenta limit and chart number, DE1671, as follows:

North: 54° 25´·70N. East: 12° 25´·00E.

South: 54° 07´·80N. West: 11° 39´·50E.

816 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

1018 New Edition Effective from 18/02/2021

14/05/2020 Delete chart reference, See Chart 966 Plan B, in position 37° 44´·33N., 015° 14´·35E.

2.6
Wk08/21
 II

792* ENGLAND - East Coast - Depths.

Source: Trinity House

Chart 106 [ previous update New Edition 10/12/2020 ] ETRS89 DATUM

Insert depth, 89, and extend 10m contour E to enclose (a) 52° 44´·55N., 1° 53´·50E.
Delete depth, 96, close NW of: (a) above

Chart 1543 [ previous update 539/21 ] ETRS89 DATUM

Insert depth, 107, and extend 15m contour NE to enclose (a) 52° 44´·93N., 1° 53´·28E.
Delete depth, 136, close SW of: (a) above

795* IRELAND - East Coast - Dredged depths.

Source: Dublin Port Company

Chart 1447 (Panel A, Port of Dublin) [ previous update 746/21 ] ETRS89 DATUM
Delete dredged depth, 4·6m, centred on: 53° 20´·849N., 6° 14´·634W.
53° 20´·829N., 6° 14´·319W.
53° 20´·795N., 6° 13´·838W.
53° 20´·833N., 6° 14´·963W.
53° 20´·814N., 6° 14´·829W.
53° 20´·789N., 6° 14´·517W.
53° 20´·783N., 6° 14´·435W.
dredged depth, 6·2m, centred on: 53° 20´·773N., 6° 14´·311W.
dredged depth, 6·5m, centred on: 53° 20´·766N., 6° 14´·218W.
53° 20´·756N., 6° 14´·070W.
53° 20´·739N., 6° 13´·856W.
53° 20´·671N., 6° 13´·820W.

797* ENGLAND - West Coast - Depths. Drying heights.

Source: Associated British Ports

Chart 2013 [ previous update 4451/20 ] ETRS89 DATUM

Insert depth, 06 54° 47´·79N., 3° 30´·23W.
drying height, 02, and extend 0m low water line SW to enclose (a) 54° 47´·98N., 3° 30´·02W.
Delete depth, 18, close S of: (a) above
Insert drying height, 02, enclosed by 0m low water line 54° 48´·86N., 3° 29´·88W.
depth, 02, and extend 2m contour NE to enclose 54° 49´·55N., 3° 29´·39W.

2.7
Wk08/21
 II

799* SCOTLAND - West Coast - Buoyage. Legend. Shellfish beds. Note.

Source: Northern Lighthouse Board

Chart 2326 [ previous update 4341/20 ] ETRS89 DATUM

Delete
JfFl(4)Y.12s
; (a) 56° 06´·27N., 5° 34´·35W.
(b) 56° 06´·20N., 5° 33´·37W.

JfFl.Y.6s
; (c) 56° 05´·73N., 5° 33´·37W.
(d) 56° 05´·55N., 5° 34´·35W.
legend, Shellfish Beds (see Note), centred on: 56° 05´·86N., 5° 33´·92W.
limit of shellfish beds area, pecked line, joining: (a) above
(b) above
(c) above
(d) above
note, SHELLFISH BEDS, centred on: 56° 04´·15N., 5° 33´·37W.

Chart 2476 ( Panel B, Loch Crinan) [ previous update 2103/18 ] ETRS89 DATUM
Delete
JfFl(4)Y.12s
; (a) 56° 06´·267N., 5° 34´·350W.
(b) 56° 06´·200N., 5° 33´·366W.

J;Ff l.Y.6s (c) 56° 05´·733N., 5° 33´·366W.

(d) 56° 05´·550N., 5° 34´·351W.
legend, Shellfish Beds (see Note), centred on: 56° 06´·032N., 5° 33´·842W.
limit of shellfish beds area, pecked line, joining: (a) above
(b) above
(c) above
(d) above
note, SHELLFISH BEDS, centred on: 56° 06´·303N., 5° 31´·996W.

800* ENGLAND - South East Coast - Buoy.

Source: Koen Stroomberg and Trinity House

Chart 1183 (INT 1561) [ previous update 733/21 ] ETRS89 DATUM

Insert
BdFl.R.5s 51° 24´·58N., 1° 26´·16E.

Chart 1607 (INT 1562) [ previous update 643/21 ] ETRS89 DATUM

Insert
BdFl.R.5s 51° 24´·58N., 1° 26´·12E.

Chart 1828 (INT 1563) [ previous update 6296/20 ] ETRS89 DATUM

Insert
BdFl.R.5s 51° 24´·58N., 1° 26´·12E.

2.8
Wk08/21
 II

805* ENGLAND - South Coast - Buoy.

Source: Dover Harbour Board

Chart 1698 (INT 1736) [ previous update 622/21 ] ETRS89 DATUM

Move
Ef, from: 51° 07´·348N., 1° 20´·641E.
to: 51° 07´·328N., 1° 20´·646E.

808* ENGLAND - Bristol Channel - Lights.

Source: Bristol Port Company

Chart 1859 (INT 1655) (Panel A, King Road) [ previous update 194/21 ] ETRS89 DATUM
Amend light to, F.R 51° 29´·993N., 2° 42´·320W.
light to, F.G 51° 29´·978N., 2° 42´·339W.

813* ENGLAND - West Coast - Drying heights.

Source: Stena Ports Limited

Chart 1166 (Panel D, Sharpness Docks) [ previous update New Edition 12/11/2020 ] ETRS89 DATUM
Insert drying height, 09 (a) 51° 43´·013N., 2° 29´·119W.
Delete drying height, 03, close N of: (a) above

Chart 1166 (Panel C, Sharpness to Hock Cliff) [ previous update New Edition 12/11/2020 ] ETRS89 DATUM
Replace drying height, 03, with drying height, 09 51° 43´·01N., 2° 29´·12W.

827* SCOTLAND - West Coast - Depths.

Source: UKHO

Chart 2540 (Panel B, Kyle Rhea) [ previous update New Edition 31/12/2020 ] ETRS89 DATUM
Insert depth, 73 (a) 57° 13´·507N., 5° 39´·552W.
Delete depth 82, close NW of: (a) above
Insert depth, 72, and extend 10m contour NW to enclose (b) 57° 13´·353N., 5° 39´·483W.
Delete depth, 91, close SE of: (b) above
Insert depth, 81, and extend 10m contour E to enclose 57° 13´·090N., 5° 39´·410W.

2.9
Wk08/21
 II
827* SCOTLAND - West Coast - Depths. (continued)

Chart 2540 [ previous update New Edition 31/12/2020 ] ETRS89 DATUM

Insert depth, 17, enclosed by 2m contour (a) 57° 16´·17N., 5° 35´·10W.
Delete depth, 49, close S of: (a) above
Insert depth, 73 (b) 57° 13´·51N., 5° 39´·55W.
Delete depth 82, close NW of: (b) above
Insert depth, 72 (c) 57° 13´·35N., 5° 39´·48W.
Delete depth, 91, close SE of: (c) above
Insert depth, 81, and extend 10m contour E to enclose 57° 13´·09N., 5° 39´·41W.
depth, 285, and extend 30m contour NW to enclose 57° 12´·78N., 5° 38´·13W.
depth, 77, enclosed by 10m contour (d) 57° 09´·87N., 5° 42´·53W.
Delete depth, 128, close E of: (d) above
Insert depth, 168, enclosed by 20m contour 57° 09´·87N., 5° 42´·93W.
depth, 26, enclosed by 30m contour (e) 57° 09´·73N., 5° 43´·56W.
Delete depth, 33, close S of: (e) above
Insert depth, 49, enclosed by 50m contour 57° 09´·91N., 5° 44´·10W.
depth, 193, and extend 20m contour NW to enclose (f) 57° 09´·59N., 5° 46´·29W.
Delete depth, 235, close SW of: (f) above
Insert depth, 187, enclosed by 20m contour (g) 57° 09´·10N., 5° 43´·37W.
Delete depth, 201, close S of: (g) above

828* SCOTLAND - West Coast - Beacon.

Source: Northern Lighthouse Board

Chart 2770 [ previous update 2669/20 ] ETRS89 DATUM

Delete
Kj¨ 57° 03´·18N., 7° 24´·44W.

838* ENGLAND - East Coast - Buoy.

Source: PD Ports

Chart 2566 (INT 1552) (Panel A, Tees Bay) [ previous update 4996/20 ] ETRS89 DATUM
Amend designation of buoy to, R.B.T Winker 54° 37´·60N., 1° 09´·27W.

855 DENMARK - East Coast - Buoy.

Source: Danish Chart Correction 51/726-727/20
Note: Former Notice 1138(T)/20 is cancelled.

Chart 894 [ previous update New Edition 14/05/2020 ] WGS84 DATUM

Delete
GU 56° 32´·90N., 10° 46´·56E.

Chart 2108 (INT 1302) [ previous update 749/21 ] WGS84 DATUM

Delete
GU 56° 32´·90N., 10° 46´·57E.

2.10
Wk08/21
 II

857 DENMARK - Islands - Buoyage.

Source: German Notice 51/30/20
Note: Former Notice 5924(P)/20 is cancelled.

Chart 2106 (INT 1303) [ previous update 721/21 ] WGS84 DATUM

Insert
J;Fl(5)Y.20s Recording Station 54° 39´·73N., 10° 58´·96E.

Chart 2942 (INT 1353) [ previous update 817/21 ] WGS84 DATUM

Insert
J;Fl(5)Y.20s Recording Station 54° 44´·40N., 11° 00´·53E.
54° 42´·81N., 10° 59´·12E.
54° 42´·73N., 11° 04´·70E.
54° 41´·14N., 11° 03´·22E.
54° 39´·73N., 10° 58´·96E.

858 DENMARK - Islands - Depths.

Source: Danish Chart Correction 51/732/20

Chart 2591 (INT 1377) (Panel B) [ previous update 4259/20 ] WGS84 DATUM
Delete depth, 153 55° 37´·06N., 9° 57´·12E.
depth, 136 55° 36´·95N., 9° 56´·51E.
depth, 19 55° 36´·84N., 9° 56´·37E.

859 GERMANY - Baltic Coast - Restricted areas. Buoyage.

Source: German Notice 51/34/20

Chart DE 42 (INT 1366) (Panel D, Kiel) [ previous update 6295/20 ] WGS84 DATUM
Insert limit of restricted area, entry prohibited, pecked line, joining: (a) 54° 22´·520N., 10° 09´·740E.
(b) 54° 22´·414N., 10° 09´·592E.
(c) 54° 22´·394N., 10° 09´·650E.
(d) 54° 22´·480N., 10° 09´·800E.
symbol, yellow, red and yellow spar buoy with X-shape
topmark (b) above
(c) above
Delete former limit of restricted area, Ç, joining: (a) above
(d) above

Chart 2344 (INT 1365) [ previous update New Chart 17/12/2020 ] WGS84 DATUM
Insert limit of restricted area, entry prohibited, pecked line, joining: (a) 54° 22´·520N., 10° 09´·740E.
(b) 54° 22´·414N., 10° 09´·592E.
(c) 54° 22´·394N., 10° 09´·650E.
(d) 54° 22´·480N., 10° 09´·800E.
symbol, yellow, red and yellow spar buoy with X-shape
topmark (b) above
(c) above
Delete former limit of restricted area, Ç, joining: (a) above
(d) above

2.11
Wk08/21
 II

804 NETHERLANDS - Buoyage.

Source: Netherlands Notice 4/31/21

Chart 120 (INT 1479) (Panel A, Continuation to Nauw van Bath) [ previous update New Edition 14/01/2021 ] WGS84
DATUM
Insert
DfFl.Y.5s SVV-Z (a) 51° 22´·35N., 4° 05´·93E.
Delete
JfFl.Y.5s SVV-Z, close W of: (a) above
Insert
GVQ(6)+LFl.15s
q Valkinisse
(b) 51° 22´·34N., 4° 06´·24E.
Delete
JfFl(3)Y.10s SVV-C, close W of: (b) above
Amend designation of buoy to, F 58 51° 22´·34N., 4° 06´·51E.

Chart 128 (INT 1478) (Panel A, Baalhoek to Antwerp) [ previous update 107/21 ] WGS84 DATUM
Insert
DfFl.Y.5s SVV-Z (a) 51° 22´·35N., 4° 05´·93E.
Delete
JfFl.Y.5s SvV Z, close W of: (a) above
Insert
GVQ(6)+LFl.15s
q Valkinisse
(b) 51° 22´·34N., 4° 06´·24E.
Delete
JfFl(3)Y.10s SvV C, close NE of: (b) above
Amend designation of buoy to, F 58 51° 22´·34N., 4° 06´·51E.

814 NORTH SEA - Norwegian Sector - Submarine cables.

Source: Norwegian Notice 23/63422/20

Chart 267 [ previous update 783/21 ] WGS84 DATUM

Insert submarine cable, É, joining: 56° 16´·06N., 3° 22´·45E.
56° 15´·33N., 3° 21´·21E.

Chart 272 [ previous update 6316/20 ] WGS84 DATUM

Insert submarine cable, É, joining: 56° 16´·06N., 3° 22´·45E.
56° 15´·33N., 3° 21´·21E.

Chart 1405 (INT 1400) [ previous update 520/21 ] WGS84 DATUM

Insert submarine cable, É, joining: 56° 19´·1N., 3° 21´·2E.
56° 16´·9N., 3° 22´·9E.
and
56° 16´·4N., 3° 23´·1E.
56° 15´·3N., 3° 21´·2E.
and
56° 16´·3N., 3° 23´·2E.
56° 15´·9N., 3° 23´·0E.
56° 13´·9N., 3° 25´·7E.

Chart 1422 (INT 1044) [ previous update 783/21 ] WGS84 DATUM

Insert submarine cable, É, joining: 56° 16´·0N., 3° 22´·3E.
56° 15´·3N., 3° 21´·2E.

2.12
Wk08/21
 II

818* GERMANY - North Sea Coast - Light-beacon. Floodlight. Beacon.

Source: WSA Cuxhaven 4/21

Chart DE 44 (INT 1452) [ previous update 681/21 ] WGS84 DATUM

Replace
ùl, Fl(5)Y.20s ODAS and symbol, floodlit structure with ùl
ODAS 53° 55´·60N., 8° 38´·97E.

824* GERMANY - North Sea Coast - NM Block. Landmark.

Source: HPA 1/21; HPA 21/12/20

Chart DE 48 (INT 1455) (Panel A, Lühesand to Teufelsbrück) [ previous update 98/21 ] WGS84 DATUM
Insert the accompanying block, centred on: 53° 33´·6N., 9° 47´·2E.
Delete
ÑTR and associated safe clearance height, 40m 53° 33´·36N., 9° 48´·97E.

834 NORTH SEA - Norwegian Sector - Submarine pipelines. Obstructions.

Source: Norwegian Notice 23/63352/20
Note: Former Notice 1671(P)/20 is cancelled.

Chart 295 [ previous update 6316/20 ] WGS84 DATUM

Insert submarine pipeline, È, joining: (a) 61° 33´·29N., 2° 15´·28E.
(b) 61° 32´·16N., 2° 14´·72E.
(c) 61° 29´·74N., 2° 13´·91E.
and
(d) 61° 30´·82N., 2° 07´·33E.
61° 30´·37N., 2° 08´·49E.
(e) 61° 29´·74N., 2° 08´·89E.
61° 27´·02N., 2° 09´·02E.

+ Obstn (a) above

(b) above
(c) above
(d) above
(e) above

2.13
Wk08/21
 II
834 NORTH SEA - Norwegian Sector - Submarine pipelines. Obstructions. (continued)

Chart 1427 (INT 1401) [ previous update 378/21 ] WGS84 DATUM

Insert submarine pipeline, È, joining: (a) 61° 33´·3N., 2° 15´·3E.
(b) 61° 32´·2N., 2° 14´·7E.
(c) 61° 29´·7N., 2° 13´·9E.
and
(d) 61° 30´·8N., 2° 07´·3E.
61° 30´·4N., 2° 08´·5E.
(e) 61° 29´·7N., 2° 08´·9E.
61° 27´·0N., 2° 09´·0E.

+ Obstn (a) above

(b) above
(c) above
(d) above
(e) above

Chart 1428 (INT 1402) [ previous update 640/21 ] WGS84 DATUM

Insert submarine pipeline, È, joining: (a) 61° 33´·3N., 2° 15´·3E.
(b) 61° 32´·2N., 2° 14´·7E.
(c) 61° 29´·7N., 2° 13´·9E.
and
(d) 61° 30´·8N., 2° 07´·3E.
61° 30´·4N., 2° 08´·5E.
(e) 61° 29´·7N., 2° 08´·9E.
61° 27´·0N., 2° 09´·0E.

+ Obstn (a) above

(b) above
(c) above
(d) above
(e) above

Chart 2182D (INT 1040) [ previous update 640/21 ] WGS84 DATUM

Insert submarine pipeline, È, joining: (a) 61° 33´·3N., 2° 15´·3E.
(b) 61° 32´·2N., 2° 14´·7E.
(c) 61° 29´·7N., 2° 13´·9E.
and
(d) 61° 30´·8N., 2° 07´·3E.
61° 30´·4N., 2° 08´·5E.
(e) 61° 29´·7N., 2° 08´·9E.
61° 27´·0N., 2° 09´·0E.

+ Obstn (a) above

(b) above
(c) above
(d) above
(e) above

2.14
Wk08/21
 II

835 BELGIUM - Jetty.

Source: Belgian Notice 26/341/20
Note: Former Notice 1382(T)/19 is cancelled.

Chart 128 (INT 1478) (Panel A, Baalhoek to Antwerp) [ previous update 804/21 ] WGS84 DATUM
Insert jetty, single firm line, joining: 51° 15´·94N., 4° 12´·89E.
51° 15´·98N., 4° 12´·78E.
51° 16´·12N., 4° 12´·90E.

793* NORTH ATLANTIC OCEAN - Bermuda - Automatic Identification Systems.

Virtual aid to navigation.
Source: Bermuda Maritime Operations Centre

Chart 332 [ previous update 3873/20 ] WGS84 DATUM

Insert Automatic Identification System, AIS, at GIBBS HILL light 32° 15´·173N., 64° 50´·086W.

Chart 334 [ previous update 329/21 ] WGS84 DATUM

Insert Automatic Identification System, AIS, at GIBBS HILL light 32° 15´·17N., 64° 50´·09W.
Automatic Identification System, AIS, at Chub Heads light-
beacon 32° 17´·31N., 64° 58´·73W.
Automatic Identification System, AIS, at Eastern Blue Cut
light-beacon 32° 24´·00N., 64° 52´·68W.
Automatic Identification System, AIS, at S. DAVID’S light 32° 21´·84N., 64° 39´·10W.
symbol, Virtual aid to navigation, V-AIS , at Deep Draught
Vessels pilot boarding place 32° 21´·80N., 64° 35´·51W.
Automatic Identification System, AIS, at Mills light-buoy 32° 23´·95N., 64° 36´·95W.
Automatic Identification System, AIS, at Kitchen light-beacon 32° 26´·05N., 64° 37´·68W.
Automatic Identification System, AIS, at North East light-
beacon 32° 28´·72N., 64° 40´·94W.
Automatic Identification System, AIS, at North Rock light-
beacon 32° 28´·51N., 64° 46´·15W.

2.15
Wk08/21
 II
793* NORTH ATLANTIC OCEAN - Bermuda - Automatic Identification Systems.
Virtual aid to navigation. (continued)

Chart 360 [ previous update 329/21 ] WGS84 DATUM

Insert Automatic Identification System, AIS, at Gibbs Hill light 32° 15´·2N., 64° 50´·1W.
Automatic Identification System, AIS, at Chub Heads light-
beacon 32° 17´·3N., 64° 58´·7W.
Automatic Identification System, AIS, at Eastern Blue Cut
light-beacon 32° 24´·0N., 64° 52´·7W.
Automatic Identification System, AIS, at light 32° 21´·8N., 64° 39´·1W.
symbol, Virtual aid to navigation, V-AIS , at Deep Draught
Vessels pilot boarding place 32° 21´·8N., 64° 35´·5W.
Automatic Identification System, AIS, at light-buoy 32° 23´·9N., 64° 37´·0W.
Automatic Identification System, AIS, at Kitchen light-beacon 32° 26´·0N., 64° 37´·7W.
Automatic Identification System, AIS, at North East light-
beacon 32° 28´·7N., 64° 40´·9W.
Automatic Identification System, AIS, at North Rock light-
beacon 32° 28´·5N., 64° 46´·2W.

Chart 868 [ previous update 329/21 ] WGS84 DATUM

Insert Automatic Identification System, AIS, at SAINT DAVID’S
light 32° 21´·84N., 64° 39´·10W.
Automatic Identification System, AIS, at Spit light-buoy 32° 22´·64N., 64° 38´·60W.
Automatic Identification System, AIS, at Mills light-buoy 32° 23´·95N., 64° 36´·94W.
Automatic Identification System, AIS, at Kitchen light-beacon 32° 26´·07N., 64° 37´·67W.

Chart 1315 [ previous update 329/21 ] WGS84 DATUM

Insert Automatic Identification System, AIS, at SAINT DAVID’S
light 32° 21´·841N., 64° 39´·104W.
Automatic Identification System, AIS, at Spit light-buoy 32° 22´·643N., 64° 38´·592W.
Automatic Identification System, AIS, at Mills light-buoy 32° 23´·954N., 64° 36´·935W.

849 NORTH ATLANTIC OCEAN - Islas Canarias - Obstructions. Buoyage.

Source: Spanish Notice 51/405/20
Note: Former Notice 316(T)/21 is cancelled.

Chart 1847 (INT 1929) [ previous update New Edition 29/10/2020 ] WGS84 DATUM
Insert
0"+ Obstn 28° 30´·060N., 16° 11´·380W.

BfF; l.Y.5s3M 28° 30´·050N., 16° 11´·357W.

JrQ(3)10s3M
W 28° 30´·010N., 16° 11´·250W.
Delete
JrQ(3)10s3M
W 28° 29´·993N., 16° 11´·067W.

0%+ Obstn (a) 28° 29´·960N., 16° 11´·250W.

BfFl.Y.5s3M,
; out of position
(a) above

2.16
Wk08/21
 II

801* MALTA - Buoyage. Submarine cable.

Source: UKHO
Note: Former Notice 3690(T)/17 is cancelled

Chart 194 [ previous update 6175/20 ] WGS84 DATUM

Amend light-buoy to, Fl.Y.3s 35° 51´·84N., 14° 40´·62E.
35° 50´·97N., 14° 40´·62E.

Chart 2123 [ previous update New Edition 07/01/2021 ] WGS84 DATUM

Insert submarine cable, É, joining: 35° 56´·0N., 14° 20´·6E.
35° 56´·0N., 14° 19´·5E.
35° 56´·1N., 14° 18´·7E.
35° 56´·6N., 14° 18´·2E.
35° 57´·2N., 14° 17´·9E.
36° 01´·0N., 14° 16´·7E.
Amend light-buoy to, Fl.Y.3s 35° 51´·8N., 14° 38´·6E.
35° 53´·6N., 14° 38´·6E.
35° 53´·6N., 14° 40´·6E.
35° 51´·8N., 14° 40´·6E.

809 TUNISIA - Wreck.

Source: Tunisan Notice 23/315/20

Chart 1162 (Panel C, Approaches to Sfax) [ previous update 454/20 ] WGS84 DATUM
Insert
´ 34° 26´·8N., 10° 36´·0E.

837 ROMANIA - Depths.

Source: ENC RO501022

Chart 2284 [ previous update 383/21 ] WGS84 DATUM

Insert depth, 55 (a) 44° 10´·38N., 28° 40´·26E.
Delete depth, 65, close N of: (a) above
Insert depth, 39, enclosed by 5m contour (b) 44° 10´·56N., 28° 39´·87E.
Delete depth, 58, close NW of: (b) above

2.17
Wk08/21
 II

852 TURKEY - South Coast - Buoyage.

Source: Turkish Notice 51/176/20

Chart 246 (INT 3660) [ previous update 577/21 ] WGS84 DATUM

Replace symbol, yellow can mooring light-buoy, Fl(4)Y.10s (4 buoys),
with symbol, yellow can mooring buoy, (4 buoys) 36° 52´·95N., 36° 03´·31E.

Chart 247 (INT 3794) [ previous update 577/21 ] WGS84 DATUM

Replace symbol, yellow can mooring light-buoy, Fl(4)Y.10s, with
symbol, yellow can mooring buoy 36° 52´·95N., 36° 03´·31E.
symbol, yellow can mooring light-buoy, Fl(4)Y.10s3M, with
symbol, yellow can mooring buoy 36° 53´·14N., 36° 03´·33E.
36° 53´·10N., 36° 03´·38E.
36° 53´·12N., 36° 03´·26E.

860 TURKEY - Black Sea Coast - Superbuoy. Automatic Identification System. Radar beacon.
Source: Turkish Notice 51/174/20

Chart 1272 (Panel A, Approaches to İğneada) [ previous update 5825/20 ] WGS84 DATUM
Insert
PfF; l.Y.4s ODAS (a) 41° 53´·42N., 28° 05´·46E.
Automatic Identification System, AIS, at light-buoy (a) above
radar beacon, Racon(U), at light-buoy (a) above

865 SPAIN - Mediterranean Sea Coast - Depths. Dredged area. Legend.

Source: ENC ES504722

Chart 473 (INT 3167) [ previous update 2472/20 ] WGS84 DATUM

Insert depth, 136 38° 19´·64N., 0° 29´·92W.
38° 19´·28N., 0° 29´·93W.
depth, 135 38° 19´·48N., 0° 29´·84W.
Delete limit of dredged area, pecked line, and associated legend, 14m
(2007), joining: 38° 19´·57N., 0° 30´·08W.
38° 19´·56N., 0° 30´·05W.
38° 19´·55N., 0° 30´·06W.
38° 19´·54N., 0° 30´·06W.
38° 19´·54N., 0° 30´·07W.
38° 19´·45N., 0° 29´·98W.
38° 19´·45N., 0° 29´·99W.
38° 19´·42N., 0° 29´·95W.
38° 19´·31N., 0° 29´·98W.
38° 19´·16N., 0° 30´·00W.
38° 19´·02N., 0° 29´·99W.
38° 19´·12N., 0° 29´·84W.
38° 19´·20N., 0° 29´·86W.
38° 19´·29N., 0° 29´·85W.
38° 19´·29N., 0° 29´·80W.
38° 19´·52N., 0° 29´·78W.

2.18
Wk08/21
 II

880 ROMANIA - Platforms.

Source: ENC RO2350BS

Chart 2214 [ previous update 544/21 ] WGS84 DATUM

Replace
¼{ with ¼ 44° 36´·1N., 29° 21´·6E.

Chart 2230 [ previous update 4639/20 ] WGS84 DATUM

Replace
¼{ with ¼ 44° 36´·0N., 29° 21´·5E.

Chart 2232 [ previous update 544/21 ] WGS84 DATUM

Replace
¼{ GLORIA, with ¼ 44° 36´·0N., 29° 21´·6E.

882 NIGERIA - Wreck.

Source: ENC NG525010

Chart 2812 [ previous update New Chart 24/12/2020 ] WGS84 DATUM

Insert
´ 6° 22´·340N., 3° 23´·538E.

883 EGYPT - Red Sea Coast - Depth.

Source: ENC EG5GOS2R

Chart 333 (INT 7135) [ previous update 1270/20 ] WGS84 DATUM

Insert depth, 7, enclosed by 10m contour 28° 07´·48N., 33° 17´·82E.

798 INDIA - West Coast - NM Blocks. Anchorage area. Buoy. Pilot boarding place.
Source: Indian Notice 23/227/20

Chart IN 2075 (INT 7366) (Tuticorin Harbour) [ previous update 811/18 ] WGS84 DATUM
Insert the accompanying block A, centred on: 8° 44´·8N., 78° 16´·4E.

ÂBelow 12m draft 8° 43´·70N., 78° 15´·00E.

Amend light-buoy to, Fl(5)Y.20s Fairway 8° 44´·18N., 78° 13´·74E.
Delete former limit of anchorage area, pecked line, and associated
legend, For vessels less than 100m, joining: 8° 45´·09N., 78° 14´·34E.
8° 45´·49N., 78° 14´·34E.
8° 45´·49N., 78° 15´·34E.
8° 45´·09N., 78° 15´·34E.

Chart IN 2075 (INT 7366) (Panel, Approaches to Tuticorin) [ previous update 811/18 ] WGS84 DATUM
Insert the accompanying block B, centred on: 8° 44´·7N., 78° 15´·3E.
the accompanying block C, centred on: 8° 40´·8N., 78° 20´·2E.

2.19
Wk08/21
 II

815* INDIAN OCEAN - Maldives - Depths.

Source: Benjamin Heaton

Chart 1012 (INT 7374) [ previous update New Edition 26/04/2018 ] WGS84 DATUM
Insert depth, 25,enclosed by 5m contour, Rep (2021) (a) 1° 49´·8N., 73° 22´·7E.
Delete depth, 40, close E of: (a) above

832 PAKISTAN - Depths.

Source: Pakistani Notice 51/177/20
Note: Former Notice 2697(T)/19 is cancelled.

Chart 38 (INT 7019) (Panel A, Gwādar) [ previous update 5366/20 ] WGS84 DATUM
Insert depth, 11, enclosed by 2m contour 25° 10´·80N., 62° 15´·97E.

Chart 38 (INT 7019) [ previous update 5366/20 ] WGS84 DATUM

Insert depth, 11, enclosed by 2m contour (a) 25° 10´·8N., 62° 16´·0E.
Delete depth, 25, close N of: (a) above

872 MALAYSIA - Peninsular Malaysia, West Coast - Buoy.

Source: Marine Department, Malaysia Notice 314/20

Chart 3943 [ previous update New Edition 26/03/2020 ] WGS84 DATUM

Delete
BdFl.R.4s 6° 23´·43N., 100° 04´·60E.

787 CHINA - East Coast - Virtual aid to navigation.

Source: Chinese Notice 50/1802/20

Chart 1759 [ previous update 565/21 ] CGCS 2000 DATUM

Delete symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS, out of position 29° 21´·0N., 122° 09´·5E.

802 VIETNAM - Depths.

Source: VMS-S Notice 6/21

Chart 1059 (Panel C, Song Thi Vai) [ previous update 679/21 ] WGS84 DATUM
Insert depth, 144 (a) 10° 35´·78N., 107° 01´·42E.
Delete depth, 156, close NW of: (a) above

841 CHINA - Yellow Sea Coast - NM Block.

Source: Chinese Notice 45/1604/20 and UKHO
Note: Certain Copies Only

Chart 806 [ previous update 592/21 ] CGCS 2000 DATUM

Insert the accompanying block, centred on: 35° 17´·1N., 119° 31´·9E.

2.20
Wk08/21
 II

850 YELLOW SEA - Depths.

Source: ENC KR1F0000

Chart 3480 [ previous update 825/21 ] WGS84 DATUM

Insert depth, 46, enclosed by 50m contour (a) 33° 58´·2N., 123° 04´·3E.
Delete depth, 56, close E of: (a) above

853 CHINA - Bo Hai - Virtual aid to navigation.

Source: Chinese Notice 50/1797/20

Chart 1206 [ previous update 5867/20 ] CGCS 2000 DATUM

Insert symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 38° 29´·07N., 121° 02´·45E.

Chart 1249 [ previous update 311/21 ] CGCS 2000 DATUM

Insert symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 38° 29´·1N., 121° 02´·5E.

Chart 1255 [ previous update 411/21 ] CGCS 2000 DATUM

Insert symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 38° 29´·1N., 121° 02´·5E.

854 CHINA - South Coast - Buoyage.

Source: Chinese Notice 50/1819/20

Chart 1568 [ previous update 551/21 ] CGCS 2000 DATUM

Move
CbFl(2)G.6s A5, from: 21° 48´·17N., 113° 13´·83E.
to: 21° 47´·85N., 113° 13´·88E.
Delete
CbFl(2)G.6s A3 21° 47´·64N., 113° 13´·93E.

866 CHINA - East Coast - Virtual aid to navigation.

Source: Chinese Notice 50/1801/20

Chart 1130 [ previous update 6093/20 ] CGCS 2000 DATUM

Delete symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 29° 56´·82N., 122° 12´·14E.

867 CHINA - South Coast - Radar beacon.

Source: Chinese Notice 50/1817/20

Chart 343 [ previous update 576/21 ] CGCS 2000 DATUM

Insert radar beacon, Racon(O), at light-buoy 22° 19´·07N., 113° 48´·16E.

2.21
Wk08/21
 II

869 CHINA - East Coast - Obstruction. Depths.

Source: Chinese Notice 52/1891/20

Chart 1602 [ previous update 610/21 ] CGCS 2000 DATUM

Insert
4)+ Obstn (a) 31° 06´·47N., 121° 57´·93E.
Delete depth, 53, close NW of: (a) above
Insert depth, 48, and extend 5m contour N to enclose 31° 04´·38N., 122° 02´·23E.
depth, 44, and extend 5m contour N to enclose 31° 04´·19N., 122° 02´·77E.

873 CHINA - East Coast - Light-beacon.

Source: Chinese Notice 50/1800/20

Chart 1665 [ previous update 3849/20 ] CGCS 2000 DATUM

Insert
TÜl Mo(C)Y.15s 30° 34´·54N., 121° 03´·20E.

878 CHINA - East Coast - Light-beacon. Buoy. Automatic Identification Systems.

Source: Chinese Notice 50/1805/20

Chart 1738 [ previous update 6149/20 ] CGCS 2000 DATUM

Insert
TÜMl o(C)Y.12s14m7M (a) 28° 56´·50N., 121° 58´·50E.
Automatic Identification System, AIS, at light (a) above
Delete
G;Mo(O)Y.12s
f L11 and associated Automatic Identification
System, AIS, close NW of: (a) above

842 JAPAN - Honshū - Submarine cable.

Source: Japanese Notice 6/87/21
Note: Former Notice 5425(P)/20 is cancelled.

Chart JP 80 [ previous update 3741/20 ] WGS84 DATUM

Insert submarine cable, É, joining: 34° 21´·8N., 139° 14´·6E.
34° 21´·7N., 139° 13´·2E.
34° 22´·6N., 139° 12´·3E.
34° 24´·5N., 139° 12´·3E.
34° 25´·2N., 139° 12´·5E.
34° 27´·4N., 139° 14´·5E.
34° 28´·7N., 139° 14´·6E.
34° 30´·9N., 139° 13´·9E.
34° 31´·2N., 139° 15´·1E.
34° 31´·9N., 139° 15´·6E.
34° 32´·0N., 139° 16´·2E.
34° 31´·9N., 139° 16´·4E.

2.22
Wk08/21
 II

843 JAPAN - Seto Naikai - Obstructions.

Source: Japanese Notice 6/89/21
Note: Former Notice 6120(T)/20 is cancelled.

Chart JP 123 [ previous update 5072/20 ] WGS84 DATUM

Insert
åObstn 34° 37´ 07·5"N., 135° 25´ 28·7"E.
34° 37´ 03·2"N., 135° 25´ 23·6"E.
34° 36´ 51"N., 135° 25´ 36"E.

Chart JP 1146 [ previous update 6330/20 ] WGS84 DATUM

Insert
åObstn 34° 37´ 07·5"N., 135° 25´ 28·7"E.
34° 37´ 03·2"N., 135° 25´ 23·6"E.
34° 36´ 51"N., 135° 25´ 36"E.

844 JAPAN - Seto Naikai - Spoil ground. Legend.

Source: Japanese Notice 6/90/21

Chart JP 123 [ previous update 843/21 ] WGS84 DATUM

Insert limit of spoil ground, pecked line, joining: (a) 34° 40´ 37·0"N., 135° 24´ 46·2"E.
(b) 34° 40´ 37·8"N., 135° 24´ 45·8"E.
(c) 34° 40´ 48·3"N., 135° 25´ 21·7"E.
(d) 34° 40´ 47·3"N., 135° 25´ 21·4"E.
legend, Spoil Ground, within: (a)-(d) above

Chart JP 1107 [ previous update 5749/20 ] WGS84 DATUM

Insert limit of spoil ground, pecked line, joining: (a) 34° 40´ 37·0"N., 135° 24´ 46·2"E.
(b) 34° 40´ 37·8"N., 135° 24´ 45·8"E.
(c) 34° 40´ 48·3"N., 135° 25´ 21·7"E.
(d) 34° 40´ 47·3"N., 135° 25´ 21·4"E.
legend, Spoil Ground, within: (a)-(d) above

845 JAPAN - Seto Naikai - Reclamation area. Legend.

Source: Japanese Notice 6/92/21

Chart JP 165 [ previous update 4496/19 ] WGS84 DATUM

Insert maritime limit, pecked line, joining: (a) 33° 59´ 27·2"N., 133° 32´ 25·8"E.
(b) 33° 59´ 22·9"N., 133° 32´ 32·2"E.
(c) 33° 59´ 20·0"N., 133° 32´ 29·4"E.
legend, Being reclaimed, within: (a)-(c) above

2.23
Wk08/21
 II

846 JAPAN - Seto Naikai - Buoyage.

Source: Japanese Notice 6/93/21

Chart JP 1137 [ previous update 6260/20 ] WGS84 DATUM

Insert
Gf(Y Lt) 34° 24´ 31"N., 133° 23´ 08"E.
34° 24´ 27"N., 133° 23´ 16"E.
34° 24´ 22"N., 133° 23´ 24"E.

790 KOREA - West Coast - Buoyage.

Source: Korean Notice 52/1148/20

Chart 3642 (INT 5364) [ previous update New Edition 17/12/2020 ] WGS84 DATUM
Amend light-buoy to, Fl.G.4s No 3 37° 25´·729N., 126° 35´·755E.
light-buoy to, Fl.G.4s No 5 37° 25´·573N., 126° 36´·028E.
Replace
G:Fl.R.4s
d with GmUQ
37° 25´·680N., 126° 35´·467E.

821 KOREA - West Coast - Depths.

Source: Korean Notice 1/13/21

Chart 913 (INT 5254) [ previous update New Edition 28/01/2021 ] WGS84 DATUM
Insert depth, 92, and extend 10m contour N to enclose (a) 35° 09´·78N., 125° 54´·54E.
Delete depth, 12, close W of: (a) above

Chart 3928 [ previous update 299/21 ] WGS84 DATUM

Insert depth, 92, enclosed by 10m contour (a) 35° 09´·78N., 125° 54´·54E.
Delete depth, 12, close N of: (a) above
Insert depth, 96, enclosed by 10m contour (b) 35° 09´·48N., 125° 53´·94E.
Delete depth, 136, close NW of: (b) above
Insert depth, 72, and extend 10m contour NE to enclose (c) 35° 09´·09N., 125° 53´·62E.
Delete depth, 101, close W of: (c) above
Insert depth, 55, and extend 10m contour W to enclose (d) 35° 09´·01N., 125° 54´·36E.
Delete depth, 197, close SW of: (d) above

825 KOREA - South Coast - Wreck.

Source: : Korean Notice 6/137/21

Chart 127 [ previous update 619/21 ] WGS84 DATUM

Insert
´PA 34° 33´·4N., 128° 04´·4E.

Chart 3391 (INT 5360) [ previous update 694/21 ] WGS84 DATUM

Insert
´PA 34° 33´·44N., 128° 04´·37E.

Chart 3480 [ previous update 619/21 ] WGS84 DATUM

Insert
´ 34° 33´·4N., 128° 04´·4E.

2.24
Wk08/21
 II

829 KOREA - South Coast - Buoyage.

Source: Korean Notice 51/1131/20

Chart 1163 [ previous update 292/21 ] WGS84 DATUM

Amend designation of buoy to, A 35° 04´·352N., 128° 46´·835E.
designation of buoy to, B 35° 04´·592N., 128° 47´·092E.

868 KOREA - South Coast - Light.

Source: Korean Notice 52/1141/20

Chart 1065 [ previous update 734/21 ] WGS84 DATUM

Amend range of light to, 6M 34° 58´·63N., 128° 45´·04E.

875 KOREA - South Coast - Light-beacon.

Source: Korean Notice 50/1107/20

Chart 127 [ previous update 825/21 ] WGS84 DATUM

Amend range of light-beacon to, 10M 34° 44´·5N., 128° 22´·5E.

885 KOREA - West Coast - Lights. Automatic Identification Systems.

Source: Korean Notices 52/1144/20 and 52/1149/20.

Chart 1008 [ previous update 34/21 ] WGS84 DATUM

Insert
¶Fl(3)G.7s16m8M (a) 35° 55´·92N., 126° 31´·58E.

¶Fl.R.5s16m7M (b) 35° 56´·01N., 126° 31´·70E.

Automatic Identification System, AIS, at light (a) above
Delete Automatic Identification System, AIS, at light 35° 56´·01N., 126° 31´·65E.

¶Fl.R.5s14m8M, close E of: (b) above

856 INDONESIA - Sulawesi - Buoyage. Light-beacon.

Source: Indonesian Notices 52/642/20, 52/644/20, ENCs ID500176, ID4173R1 and Indonesian Lights List

Chart 2638 (Panel F, Makassar) [ previous update 5641/20 ] WGS84 DATUM

Insert
GrW Q(3) 5° 06´·32S., 119° 24´·41E.
Move
CbFl.G.5s
] No. 9, from:
5° 07´·15S., 119° 23´·47E.
to: (a) 5° 07´·22S., 119° 23´·30E.
Delete
CbFl.G.3s
] , close E of:
(a) above

Chart 2638 (Panel C, Teluk Parepare) [ previous update 5641/20 ] WGS84 DATUM
Insert
Tj Fl.R.4s5m9M 4° 00´·66S., 119° 37´·00E.

2.25
Wk08/21
 II

881 INDONESIA - Kalimantan - Obstruction.

Source: Indonesian Notice 6/71/21

Chart 1312 [ previous update 4514/20 ] WGS84 DATUM

Insert
16%, Obstn Rep (2020) 0° 45´·2S., 108° 27´·5E.

Chart 2470 [ previous update 328/21 ] WGS84 DATUM

Insert
16%, Obstn Rep (2020) 0° 45´·2S., 108° 27´·5E.

Chart 2870 [ previous update 4514/20 ] WGS84 DATUM

Insert
16%, Obstn Rep (2020) 0° 45´·2S., 108° 27´·5E.

Chart 2872 [ previous update 4514/20 ] WGS84 DATUM

Insert
16%, Obstn Rep (2020) 0° 45´·2S., 108° 27´·5E.

Chart 3721 [ previous update 5150/20 ] WGS84 DATUM

Insert
16%, Obstn Rep (2020) 0° 45´·17S., 108° 27´·45E.

789 AUSTRALIA - Queensland - NM Block.

Source: Australian Notice 2/43/21

Chart Aus 293 [ previous update 535/21 ] WGS84 DATUM

Insert the accompanying block, centred on: 10° 35´·0S., 142° 14´·2E.

861 AUSTRALIA - South Australia - NM Blocks. Miscellaneous corrections. Note. Legends.

Source: Australian Notice 2/47/21

Chart Aus 343 [ previous update 2018/20 ] WGS84 DATUM

Insert the accompanying block, centred on: 36° 10´·8S., 134° 26´·8E.
Delete magenta limit and chart reference, Aus 126, centred on: 35° 30´·3S., 136° 39´·0E.

Chart Aus 346 [ previous update 117/21 ] WGS84 DATUM

Insert the accompanying block, centred on: 37° 20´·8S., 135° 54´·0E.
Delete magenta limit and chart reference, Aus 126, centred on: 36° 00´·7S., 138° 20´·0E.

Chart Aus 347 [ previous update 599/17 ] WGS84 DATUM

Delete magenta limit and chart reference, Aus 126, centred on: 36° 00´·7S., 138° 20´·0E.

Chart Aus 485 [ previous update 117/21 ] WGS84 DATUM

Insert the accompanying block, centred on: 32° 44´·4S., 136° 39´·3E.
Delete magenta limit and chart reference, Aus 126, centred on: 35° 30´·0S., 136° 40´·0E.
36° 00´·6S., 137° 58´·4E.

2.26
Wk08/21
 II
861 AUSTRALIA - South Australia - NM Blocks. Miscellaneous corrections. Note. Legends. (continued)

Chart Aus 776 [ previous update 1457/19 ] WGS84 DATUM

Insert the accompanying block, centred on: 35° 01´·4S., 137° 19´·2E.
Delete magenta limit and chart reference, Aus 126, centred on: 35° 05´·20S., 136° 38´·48E.

Chart Aus 780 [ previous update 780/21 ] WGS84 DATUM

Insert the accompanying block, centred on: 35° 47´·5S., 136° 46´·4E.
legend, ENC (see Note), centred on: 35° 37´·80S., 138° 02´·32E.
35° 22´·50S., 136° 56´·40E.
Delete magenta limit and chart reference, Aus 126, centred on: 35° 35´·67S., 136° 56´·66E.
35° 30´·37S., 137° 02´·44E.
note, OMISSIONS FROM CHART, centred on: 35° 48´·92S., 137° 14´·40E.

806 UNITED STATES OF AMERICA - West Coast - NM Block. Obstructions. Depth. Floating docks.
Source: ENC US5OR16M

Chart 2849 (Panel C, Swan Island Basin) [ previous update 398/21 ] NAD83 DATUM
Insert the accompanying block, centred on: 45° 34´·0N., 122° 43´·1W.

Chart 2849 (Panel B) [ previous update 398/21 ] NAD83 DATUM

Insert
11#, Obstn (a) 45° 34´·13N., 122° 43´·62W.
Delete
3&+ Obstns, close NW of: (a) above
Insert depth, 99 (b) 45° 34´·11N., 122° 43´·53W.
Delete
9Ó+ Obstn, close SW of:
(b) above

5$+ Obstns, close N of:

(b) above
Insert floating dock, single firm line, joining: 45° 34´·06N., 122° 43´·45W.
45° 34´·04N., 122° 43´·32W.
45° 34´·02N., 122° 43´·33W.
45° 34´·04N., 122° 43´·46W.
and
(c) 45° 33´·99N., 122° 43´·65W.
(d) 45° 34´·02N., 122° 43´·71W.
(e) 45° 34´·03N., 122° 43´·68W.
(f) 45° 34´·01N., 122° 43´·62W.
Delete former floating dock, single firm line, within: (c)-(f) above

840 UNITED STATES OF AMERICA - West Coast - Fog signal.

Source: US Coast Guard District 11 LNM 3/18725/21

Chart 4908 [ previous update New Chart 20/12/2018 ] NAD83 DATUM

Amend fog signal to, Horn(MRASS), at light 34° 09´·37N., 119° 13´·64W.

2.27
Wk08/21
 II

871 CANADA - British Columbia - Submarine cable. Note.

Source: Canadian Notices 12/3800/20 and 12/3955-3960/20

Chart 3754 [ previous update 2349/20 ] NAD27 DATUM

Insert submarine cable, É, joining: 54° 13´·98N., 130° 19´·97W.
54° 12´·92N., 130° 21´·88W.
54° 13´·73N., 130° 26´·44W.
54° 14´·96N., 130° 29´·04W.
54° 19´·03N., 130° 34´·06W.
54° 25´·56N., 130° 34´·10W.
54° 27´·82N., 130° 35´·07W.
54° 34´·55N., 130° 34´·06W.
54° 40´·61N., 130° 38´·97W.
54° 43´·43N., 130° 44´·66W.
54° 42´·79N., 130° 47´·14W.
54° 43´·03N., 130° 51´·64W.
54° 47´·29N., 130° 59´·88W.
54° 54´·14N., 131° 04´·49W.
54° 56´·00N., 131° 04´·64W.
the accompanying note, SUBMARINE CABLES, centred on: 53° 48´·97N., 132° 49´·58W.

Chart 4935 [ previous update 5947/20 ] NAD83 DATUM

Insert submarine cable, É, joining: 54° 13´·98N., 130° 20´·03W.
54° 14´·03N., 130° 20´·11W.
54° 14´·04N., 130° 20´·48W.
54° 13´·00N., 130° 21´·54W.
54° 12´·90N., 130° 21´·98W.
54° 13´·40N., 130° 24´·82W.
54° 13´·72N., 130° 26´·54W.
54° 14´·98N., 130° 29´·18W.

Chart 4936 [ previous update New Edition 31/12/2020 ] NAD83 DATUM

Insert submarine cable, É, joining: 54° 13´·98N., 130° 20´·03W.
54° 14´·03N., 130° 20´·11W.
54° 14´·04N., 130° 20´·48W.
54° 13´·00N., 130° 21´·54W.
54° 12´·90N., 130° 21´·98W.
54° 13´·40N., 130° 24´·82W.
54° 13´·72N., 130° 26´·54W.
54° 14´·95N., 130° 29´·14W.
54° 18´·62N., 130° 33´·53W.
54° 18´·96N., 130° 33´·47W.
54° 19´·11N., 130° 33´·55W.
54° 19´·01N., 130° 34´·16W.
54° 21´·68N., 130° 34´·33W.

2.28
Wk08/21
 II
871 CANADA - British Columbia - Submarine cable. Note. (continued)

Chart 4937 [ previous update 4400/20 ] NAD83 DATUM

Insert submarine cable, É, joining: 54° 13´ 58·9"N., 130° 20´ 02·0"W.
54° 14´ 01·7"N., 130° 20´ 06·5"W.
54° 14´ 02·4"N., 130° 20´ 29·0"W.
54° 12´ 59·9"N., 130° 21´ 32·4"W.
54° 12´ 53·9"N., 130° 22´ 07·0"W.
54° 13´ 24·3"N., 130° 24´ 49·1"W.
54° 13´ 43·1"N., 130° 26´ 32·1"W.
54° 14´ 19·3"N., 130° 27´ 36·0"W.

Chart 4938 (Panel, Porpoise Harbour, Ridley Island and Approaches/et les Approches) [ previous update 2349/20 ]
NAD83 DATUM
Insert submarine cable, É, joining: 54° 13´ 58·9"N., 130° 20´ 02·1"W.
54° 14´ 01·7"N., 130° 20´ 06·5"W.
54° 14´ 02·4"N., 130° 20´ 29·0"W.
54° 12´ 59·9"N., 130° 21´ 32·4"W.
54° 12´ 54·0"N., 130° 22´ 00·0"W.

826 CHILE - Northern Coasts - Submarine cables.

Source: Chilean Notice 12/98/20

Chart 4217 [ previous update 5083/19 ] WGS84 DATUM

Insert submarine cable, É, joining: 18° 26´·96S., 70° 18´·17W.
18° 26´·82S., 70° 18´·74W.
18° 25´·47S., 70° 21´·30W.
18° 25´·35S., 70° 21´·84W.
18° 25´·35S., 70° 24´·55W.
18° 25´·40S., 70° 24´·90W.
18° 25´·47S., 70° 25´·16W.
18° 25´·60S., 70° 25´·50W.
the accompanying note, SUBMARINE CABLES, centred on: 18° 22´·12S., 70° 17´·35W.

Chart 4230 [ previous update 5015/19 ] PSAD56 DATUM

Insert submarine cable, É, joining: (a) 29° 53´·1S., 71° 16´·3W.
29° 51´·2S., 71° 22´·2W.
29° 45´·4S., 71° 33´·6W.
and
(a) above
29° 53´·6S., 71° 22´·7W.
29° 55´·2S., 71° 28´·7W.
29° 58´·8S., 71° 38´·3W.
the accompanying note, SUBMARINE CABLES, centred on: 27° 32´·8S., 73° 06´·0W.

2.29
Wk08/21
 II
826 CHILE - Northern Coasts - Submarine cables. (continued)

Chart 4235 [ previous update 5015/19 ] PSAD56 DATUM

Insert submarine cable, É, joining: (a) 29° 53´·1S., 71° 16´·3W.
29° 51´·2S., 71° 22´·2W.
29° 45´·4S., 71° 33´·6W.
and
(a) above
29° 53´·6S., 71° 22´·7W.
29° 55´·2S., 71° 28´·7W.
29° 58´·8S., 71° 38´·4W.
and
(b) 32° 54´·9S., 71° 30´·3W.
32° 49´·4S., 71° 37´·4W.
and
(b) above
32° 53´·9S., 71° 32´·9W.
32° 53´·8S., 71° 39´·0W.

Chart 4237 [ previous update 5015/19 ] SIRGAS DATUM

Insert submarine cable, É, joining: 29° 54´·166S., 71° 24´·200W.
29° 53´·800S., 71° 22´·838W.
29° 53´·600S., 71° 19´·988W.
the accompanying note, SUBMARINE CABLES, centred on: 29° 58´·769S., 71° 17´·159W.

Chart 4238 [ previous update 3159/20 ] WGS84 DATUM

Insert submarine cable, É, joining: (a) 32° 55´·03S., 71° 30´·56W.
32° 49´·65S., 71° 37´·50W.
and
(a) above
32° 54´·17S., 71° 33´·05W.
32° 54´·00S., 71° 39´·14W.

Chart 4240 [ previous update 5802/20 ] PSAD56 DATUM

Insert submarine cable, É, joining: (a) 32° 54´·9S., 71° 30´·3W.
32° 49´·4S., 71° 37´·4W.
and
(a) above
32° 53´·9S., 71° 32´·9W.
32° 53´·8S., 71° 39´·0W.
and
(b) 36° 51´·2S., 73° 09´·0W.
36° 51´·2S., 73° 14´·8W.
36° 52´·0S., 73° 23´·5W.
36° 52´·6S., 73° 28´·6W.
36° 52´·1S., 73° 34´·0W.
36° 47´·3S., 73° 40´·0W.
and
(b) above
36° 54´·8S., 73° 40´·1W.

2.30
Wk08/21
 II
826 CHILE - Northern Coasts - Submarine cables. (continued)

Chart 4245 [ previous update 5802/20 ] PSAD56 DATUM

Insert submarine cable, É, joining: (a) 36° 51´·2S., 73° 09´·2W.
36° 51´·2S., 73° 14´·8W.
36° 52´·0S., 73° 23´·4W.
36° 52´·6S., 73° 28´·6W.
36° 52´·1S., 73° 33´·9W.
36° 47´·3S., 73° 40´·0W.
and
(a) above
36° 54´·8S., 73° 40´·1W.
the accompanying note, SUBMARINE CABLES, centred on: 37° 27´·0S., 75° 26´·4W.

Chart 4246 [ previous update 5802/20 ] SAD69 DATUM

Insert submarine cable, É, joining: (a) 36° 51´·36S., 73° 09´·11W.
36° 51´·45S., 73° 14´·86W.
36° 52´·20S., 73° 23´·55W.
36° 52´·84S., 73° 28´·71W.
36° 52´·28S., 73° 34´·04W.
36° 47´·54S., 73° 40´·11W.
and
(a) above
36° 53´·64S., 73° 28´·35W.
36° 54´·97S., 73° 40´·22W.
the accompanying note, SUBMARINE CABLES, centred on: 37° 06´·09S., 72° 51´·91W.

870 COLOMBIA - Pacific Ocean Coast - Light.

Source: Colombian Notice 264/20

Chart 2257 [ previous update 29/21 ] WGS84 DATUM

Insert
¶ LFl.10s65m20M 3° 00´·2N., 78° 10´·1W.

Chart 2258 [ previous update 5787/20 ] WGS84 DATUM

Insert
¶ LFl.10s65m20M 3° 00´·2N., 78° 10´·1W.

Chart 4811 (INT 811) [ previous update 5787/20 ] WGS84 DATUM

Insert
¶{ 3° 00´·2N., 78° 10´·1W.

2.31
Wk08/21
 II

791 WEST INDIES - Trinidad and Tobago - Mooring buoy.

Source: Trinidad and Tobago Ministry of Works and Transport Navigational Warning 54/20

Chart 483 [ previous update 6129/20 ] WGS84 DATUM

Insert
RFl(4)Y.20s 10° 18´·66N., 61° 50´·17W.

Chart 1044 [ previous update 6129/20 ] WGS84 DATUM

Insert
RFl(4)Y.20s 10° 18´·3N., 61° 50´·2W.

Chart 1045 [ previous update 6129/20 ] WGS84 DATUM

Insert
RFl(4)Y.20s 10° 18´·3N., 61° 50´·2W.

811* WEST INDIES - Virgin Islands - Submarine power cable.

Source: Pro-Stock Marine

Chart 2020 (Panel A, North Sound and Approaches) [ previous update 1039/20 ] WGS84 DATUM
Insert submarine power cable, ÉÊÉ, joining: 18° 30´·169N., 64° 21´·460W.
18° 30´·138N., 64° 21´·463W.
18° 30´·113N., 64° 21´·598W.
18° 30´·073N., 64° 21´·687W.
18° 29´·998N., 64° 21´·698W.
18° 29´·782N., 64° 21´·663W.
18° 29´·633N., 64° 21´·648W.
18° 29´·587N., 64° 21´·635W.
18° 29´·524N., 64° 21´·633W.

822 UNITED STATES OF AMERICA - Gulf of Mexico - Platform.

Source: US Coast Guard District 8 LNM 2/11330/21

Chart 3854 [ previous update 5994/20 ] NAD83 DATUM

Delete
¼{ 28° 25´·64N., 93° 01´·87W.

886 MEXICO - Gulf of Mexico - Light.

Source: Mexican Notice 23/290/20

Chart 1307 [ previous update 6287/20 ] WGS84 DATUM

Amend range of light to, 23M 22° 07´·9N., 91° 22´·8W.

796 UNITED STATES OF AMERICA - East Coast - Obstruction.

Source: OCS

Chart 2920 (Panel 1) [ previous update 711/21 ] NAD83 DATUM

Insert
22,Obstn 37° 16´·99N., 76° 18´·26W.

2.32
Wk08/21
 II

803 UNITED STATES OF AMERICA - East Coast - Obstructions.

Source: OCS

Chart 2919 [ previous update 685/21 ] NAD83 DATUM

Insert
29, Obstn 37° 13´·39N., 76° 19´·45W.

19, Obstn 37° 12´·27N., 76° 14´·08W.

20, Obstn 37° 11´·74N., 76° 17´·39W.

836 UNITED STATES OF AMERICA - East Coast - Beacon. Light-beacon.

Source: US Coast Guard District 5 3/12266/21

Chart 2921 (Panel 1) [ previous update 64/21 ] NAD83 DATUM

Replace
Kh¦ ’3’ with Th¦ Fl.G.2·5s15ft4M ’3’ 38° 45´·30N., 76° 32´·92W.

862 UNITED STATES OF AMERICA - East Coast - Buoy.

Source: US Coast Guard District 5 LNM 3/12318/21

Chart 2563 (Panel, Surf City to Atlantic City) [ previous update 655/21 ] NAD83 DATUM
Insert
GfFl(5)Y.20s ’B’ 39° 18´·57N., 74° 06´·55W.

Chart 2860 [ previous update 698/21 ] NAD27 DATUM

Insert
GfFl(5)Y.20s ’A’ 39° 16´·3N., 73° 56´·4W.

Chart 2861 [ previous update 685/21 ] NAD83 DATUM

Insert
GfFl(5)Y.20s ’A’ 39° 16´·3N., 73° 56´·4W.

2.33
Wk08/21
 II

823(T)/21 ENGLAND - South Coast - Wreck. Restricted area.

Source: UKHO and Trinity House
1. *The wreck of F/V Joanna C with least depth 13·9m has been located in position 50° 42´·47N., 0° 04´·06E.
2. A temporary prohibited area, radius 200m, has been established, centred on the wreck.
3. Vessels are prohibited from interfering with, or anchoring, fishing or trawling in the vicinity of the wreck without
permission from the Marine Accident Investigation Branch.
4. Failure to comply with this direction is a criminal offence.
5. Mariners are advised to navigate with caution in the area.
6. *Former Notice 6218(T)/20 is cancelled
*Indicates new or revised entry
(ETRS89 DATUM)

Charts affected - 536 (INT 1740) - 1652 - 2450 (INT 1703) - 2451 (INT 1704)

851(P)/21 IRELAND - East Coast - Dredged depths.

Source: Dublin Port Company

Update Feature Position

Delete dredged depth 4·6m, centred on:
dredged depth 6·2m, centred on:
dredged depth 6·5m, centred on:
53° 20´·83N., 6° 14´·96W.
53° 20´·81N., 6° 14´·83W.
53° 20´·79N., 6° 14´·52W.
53° 20´·78N., 6° 14´·43W.
53° 20´·83N., 6° 14´·32W.
53° 20´·80N., 6° 13´·84W.
53° 20´·85N., 6° 14´·63W.
53° 20´·77N., 6° 14´·31W.
53° 20´·77N., 6° 14´·22W.
53° 20´·76N., 6° 14´·07W.
53° 20´·74N., 6° 13´·86W.
53° 20´·68N., 6° 13´·82W.

Chart affected - 8095

864(T)/21 POLAND - Measuring instruments.

Source: Polish Notice 3-4/39(T)/21
1. Measuring instruments have been established, positioned at regular intervals, extending the length of the Polish coastline
between position 53° 57´·83N., 14° 20´·09E. and position 54° 27´·38N., 19° 29´·46E.
2. The instruments are located on the seabed and are situated up to 3NM seaward from the coast.
3. Mariners are advised to navigate with caution in the area and to contact the University of Gdansk for the latest information
regarding the location of the instruments.
(WGS84 DATUM)

Charts affected - 2014 (INT 1219) - 2015 (INT 1201) - 2018 (INT 1202) - 2040 (INT 1218) - 2288 - 2677 (INT 1297) -
2679 - 2688 (INT 1288)

2.34
Wk08/21
 II

876(T)/21 SWEDEN - East Coast - Restricted area.

Source: Swedish Notice 844/15611(T)/21
1. Icebreaking is prohibited between Holmön Island and the mainland, in the vicinity of position 63° 50´·00N., 20° 49´·00E.
(WGS84 DATUM)

Charts affected - 893 (INT 1175) - 2085

812(P)/21 DENMARK - North Sea Coast - Restricted area. Buoyage.

Source: Danish Notice 51/885(P)/20
1. A prohibited area has been established, bounded by the following positions:

55° 28´·545N., 8° 24´·833E.

55° 28´·520N., 8° 24´·743E.
55° 28´·570N., 8° 24´·634E.
55° 28´·674N., 8° 24´·532E.
55° 28´·696N., 8° 24´·608E.
2. Special light-buoys, Fl(4)Y.10s, have been deployed, in positions:

55° 28´·674N., 8° 24´·532E.

55° 28´·570N., 8° 24´·634E.
55° 28´·520N., 8° 24´·743E.
3. Unauthorised navigation, diving, anchoring, fishing and working on the seabed is prohibited in the area.
(WGS84 DATUM)

Chart affected - 420 (INT 1451)

788(P)/21 FRANCE - West Coast - Restricted area.

Source: French Notice 50/66/20
1. Changes to restrictions in the approach channel to Port de Bayonne have taken place in the vicinity of position
43° 32´·506N., 1° 33´·586W.
2. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
3. These and other changes will be included in New Edition 1175 to be published early 2021.
(WGS84 DATUM)

Chart affected - 1175 (INT 1848)

2.35
Wk08/21
 II

807(P)/21 FRANCE - West Coast - Submarine cable. Wind farm.

Source: French Notice 51/3(P)/20
1. A submarine cable associated with the new wind farm, is being laid, joining the following positions:

47° 14´·22N., 2° 16´·35W.

47° 13´·84N., 2° 16´·70W.
47° 13´·55N., 2° 16´·86W.
47° 12´·18N., 2° 18´·42W.
47° 10´·50N., 2° 19´·82W.
47° 10´·22N., 2° 20´·17W.
47° 10´·15N., 2° 20´·47W.
47° 10´·15N., 2° 23´·43W.
47° 09´·56N., 2° 26´·93W.
47° 09´·58N., 2° 27´·79W.
47° 10´·99N., 2° 34´·24W.
47° 10´·51N., 2° 36´·20W.
47° 09´·68N., 2° 36´·58W.
47° 09´·41N., 2° 36´·43W.
47° 09´·40N., 2° 36´·35W.
47° 09´·45N., 2° 36´·31W.
47° 09´·64N., 2° 36´·48W.
2. Mariners are advised to navigate with caution in this area.
3. These changes will be included in the next New Edition of Chart 2986.
(WGS84 DATUM)

Charts affected - 2522 (INT 1802) - 2986 (INT 1840)

810(P)/21 FRANCE - West Coast - Submarine cable.

Source: French Notice 51/4(P)/20
1. A submarine cable is being laid between Virginia Beach (USA) and St. Hilaire de Riez (France), joining the following
positions:

46° 43´·70N., 1° 59´·53W.

46° 35´·76N., 2° 07´·53W.
46° 35´·21N., 2° 09´·09W.
46° 32´·90N., 2° 22´·29W.
46° 31´·71N., 2° 48´·61W.
46° 30´·83N., 3° 09´·27W.
46° 30´·66N., 3° 14´·68W.
46° 29´·1N., 3° 34´·1W.
46° 23´·9N., 4° 31´·8W.
46° 23´·3N., 4° 33´·7W.
46° 16´·0N., 4° 43´·3W.
46° 12´·9N., 4° 50´·3W.
2. Mariners are advised to navigate with caution in the area.
3. Charts will be updated when works are complete.
(WGS84 DATUM)

Charts affected - 20 - 1104 - 2522 (INT 1802) - 2663 (INT 1803) - 2997 - 4103 (INT 103)

2.36
Wk08/21
 II

877(P)/21 IVORY COAST - Works. Bridge.

Source: French Notice 52/14(P)/20
1. Construction of a bridge is taking place in an area bounded by the following positions:

5° 20´·24N., 4° 02´·41W.
5° 20´·41N., 4° 02´·14W.
5° 20´·39N., 4° 02´·12W.
5° 20´·22N., 4° 02´·38W.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 3103 (INT 2873)

2.37
Wk08/21
 II

874(P)/21 INDIAN OCEAN - Submarine cables.

Source: UKHO
1. A submarine cable, AAE-1, is being laid, joining the following approximate positions (see accompanying diagram):

29° 05´·0N., 32° 40´·0E.

28° 00´·0N., 33° 32´·0E.
26° 57´·0N., 35° 13´·0E.
24° 05´·0N., 37° 05´·0E.
22° 57´·0N., 38° 10´·0E.
21° 40´·0N., 38° 30´·0E.
21° 05´·0N., 38° 30´·0E.
17° 25´·0N., 40° 30´·0E.
15° 30´·0N., 42° 00´·0E.
13° 33´·0N., 42° 45´·0E.
12° 10´·0N., 43° 50´·0E.
12° 15´·0N., 45° 20´·0E.
13° 40´·0N., 50° 40´·0E.
13° 35´·0N., 55° 20´·0E.
12° 05´·0N., 61° 00´·0E.
9° 50´·0N., 68° 30´·0E.
9° 00´·0N., 70° 50´·0E.
7° 45´·0N., 72° 57´·0E.
5° 05´·0N., 78° 50´·0E.
4° 45´·0N., 82° 00´·0E.
5° 05´·0N., 82° 30´·0E.
5° 15´·0N., 85° 35´·0E.
5° 45´·0N., 86° 10´·0E.
6° 10´·0N., 90° 55´·0E.
5° 58´·0N., 93° 10´·0E.
6° 30´·0N., 95° 50´·0E.
5° 35´·0N., 100° 20´·0E.

and
21° 38´·0N., 39° 06´·0E.
21° 40´·0N., 38° 30´·0E.
and
11° 35´·0N., 43° 10´·0E.
12° 10´·0N., 43° 50´·0E.
and
12° 13´·0N., 45° 05´·0E.
12° 29´·0N., 45° 03´·0E.
12° 43´·0N., 45° 05´·0E.
12° 47´·0N., 45° 04´·0E.
12° 47´·0N., 45° 02´·0E.

2.38
Wk08/21
 II
874(P)/21 INDIAN OCEAN - Submarine cables. (continued)

and
12° 05´·0N., 61° 00´·0E.
21° 00´·0N., 62° 30´·0E.
22° 00´·0N., 62° 15´·0E.
24° 00´·0N., 58° 55´·0E.
24° 58´·0N., 56° 50´·0E.
25° 24´·0N., 57° 00´·0E.
26° 35´·0N., 56° 30´·0E.
26° 15´·0N., 55° 50´·0E.
25° 27´·0N., 55° 05´·0E.
25° 25´·0N., 53° 05´·0E.
25° 45´·0N., 52° 30´·0E.
25° 35´·0N., 51° 30´·0E.
and
24° 58´·0N., 56° 50´·0E.
25° 00´·0N., 56° 23´·0E.
and
24° 00´·0N., 58° 55´·0E.
23° 35´·0N., 58° 37´·0E.
and
21° 00´·0N., 62° 30´·0E.
24° 45´·0N., 67° 05´·0E.
and
9° 50´·0N., 68° 30´·0E.
18° 50´·0N., 72° 20´·0E.
19° 05´·0N., 72° 45´·0E.
and
6° 10´·0N., 90° 55´·0E.
10° 15´·0N., 91° 00´·0E.
13° 45´·0N., 91° 50´·0E.
16° 55´·0N., 93° 45´·0E.
16° 48´·0N., 94° 20´·0E.
4. Mariners are advised to navigate with caution in the area.
5. Charts will be updated when the works are complete.
6. Former Notice 568(P)/21 is cancelled.
7. NOTE: Content of Notice unchanged, re-issued to include Diagram.
(WGS84 DATUM)

Charts affected - 12 (INT 7142) - 15 (INT 7154) - 159 (INT 7010) - 164 (INT 7124) - 263 (INT 7120) - 264 (INT 7115)
- 333 (INT 7135) - 818 (INT 7433) - 830 - 2375 (INT 7132) - 2441 (INT 7233) - 2442 - 2760 - 2970 (INT 7002) - 3784
(INT 7014) - 3904 - 3943 - 4705 (INT 705) - 4706 (INT 706) - IN 273 - IN 293 (INT 7022) - IN 2036 (INT 7352)

879(T)/21 INDIA - East Coast - Scientific instruments.

Source: Indian Notice 24/241(T)/20
1. Underwater data recording instruments exist in the following positions:

10° 55´·10N., 79° 51´·49E.

10° 55´·09N., 79° 54´·10E.
2. Vessels operating in the vicinity are to maintain a safe distance from the instruments and are advised to navigate with
caution in the area.
(WGS84 DATUM)

Charts affected - 2069 - IN 32 (INT 754)

2.39
Wk08/21
 II

820(T)/21 MALACCA STRAIT - Buoy.

Source: Marine Department, Malaysia Notice 299(T)/20
1. The yellow special light-buoy, Fl.Y.5s, in position 1° 14´·28N., 103° 29´·63E. is reported off station.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 2403 - 3833 - 3947 - 4038

819(T)/21 MALAYSIA - Peninsular Malaysia, East Coast - Buoy.

Source: Marine Department, Malaysia Notice 298(T)/20
1. The light-buoy, Fl.R.5s Paton Bank, in position 4° 32´·67N., 103° 31´·34E. has been destroyed.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 1374 - 3446

831(T)/21 CHINA - Yellow Sea Coast - Dredging area.

Source: Chinese Notice 50/1849(T)/20
1. Dredging works are taking place within Xiaocha Wan within an area bounded by the following positions:

35° 59´·420N., 120° 16´·385E.

35° 59´·485N., 120° 16´·616E.
35° 59´·380N., 120° 16´·665E.
35° 59´·317N., 120° 16´·427E.
(CGCS 2000 DATUM)

Chart affected - 1506

2.40
Wk08/21
 II

839(P)/21 TAIWAN - Depths. Rocks. Tidal streams.

Source: UKHO
1. There have been numerous changes to the depths within Hua-Lien. The most significant are as follows:

Depth Position
14·2m 23° 58´·394N., 121° 37´·640E.
14·2m 23° 58´·563N., 121° 37´·640E.
12·5m 23° 58´·690N., 121° 37´·586E.
10·5m 23° 58´·822N., 121° 37´·447E.
9·9m 23° 58´·895N., 121° 37´·521E.
9m 23° 58´·933N., 121° 37´·583E.
9·3m 23° 58´·978N., 121° 37´·653E.
13·4m 23° 58´·723N., 121° 37´·810E.
11·4m 23° 58´·942N., 121° 37´·911E.
10·8m 23° 59´·167N., 121° 38´·021E.
9·6m 23° 59´·408N., 121° 38´·137E.
12·6m 23° 59´·096N., 121° 37´·860E.
10·6m 23° 59´·290N., 121° 38´·036E.
9·1m 23° 59´·559N., 121° 38´·206E.
3·9m 24° 00´·099N., 121° 38´·127E.
4·9m 23° 59´·981N., 121° 38´·333E.
2. All depths in the northern part of the port, north of latitude 23° 59´·452N., 121° 38´·156E., are less than 10m.
3. Depths less than charted exist within the unrestricted anchorage areas. The most significant are as follows:

Depth Position
8·2m 23° 58´·075N., 121° 37´·118E.
8·7m 23° 58´·195N., 121° 37´·140E.
14·5m 23° 58´·052N., 121° 37´·137E.
13·4m 23° 58´·136N., 121° 37´·243E.
10·2m 23° 58´·230N., 121° 37´·241E.
4. Underwater rocks exist in the following positions:

11·7m 23° 58´·778N., 121° 38´·314E.

19·1m 23° 58´·787N., 121° 38´·482E.
5. Tidal streams exist within the following positions:

Type Direction Mean spring rate Position

Ebb 89° 1kn 23° 57´·867N., 121° 37´·453E.
Flood 230° 0·5kn 23° 57´·815N., 121° 37´·498E.
6. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
7. These changes will be included in a New Edition of Chart 2618 to be published early 2021.
(WGS84 DATUM)

Chart affected - 2618

2.41
Wk08/21
 II

884(P)/21 CHINA - East Coast - Wind farm.

Source: Chinese Notice 49/1792T/20
1. A wind farm has been established within an area bounded by the following positions:

25° 50´·35N., 119° 56´·48E.

25° 49´·01N., 119° 56´·79E.
25° 48´·70N., 120° 02´·43E.
25° 50´·22N., 120° 03´·01E.
25° 50´·64N., 119° 57´·01E.
2. These changes will be included in New Editions of Charts 1761, 2401 and 2419 to be published early 2021.
(CGCS 2000 DATUM)

Charts affected - 1761 - 2401 - 2419

847(T)/21 JAPAN - Honshū - Depths.

Source: Japanese Notice 6/5062(T)/21
1. Depths of 0·5m less than charted exist within an area bounded by the following positions:

37° 56´ 05·1"N., 139° 04´ 05·9"E.

37° 56´ 05·4"N., 139° 04´ 06·4"E.
37° 56´ 08·2"N., 139° 04´ 04·4"E.
37° 56´ 08·0"N., 139° 04´ 03·9"E.
2. Depths of 0·5m to 1m less than charted exist within an area bounded by the shore and the following positions:

37° 55´ 52·5"N., 139° 04´ 00·5"E.

37° 55´ 54·9"N., 139° 03´ 56·8"E.
3. Depths less than charted exist in the following positions:

Depth Position
7·4m 37° 56´ 09·9"N., 139° 03´ 55·5"E.
8·2m 37° 56´ 07·5"N., 139° 03´ 57·1"E.
8·7m 37° 56´ 02·4"N., 139° 04´ 00·6"E.
8·8m 37° 55´ 59·9"N., 139° 04´ 01·2"E.
5·9m 37° 55´ 57·5"N., 139° 04´ 03·9"E.
8·5m 37° 55´ 57·9"N., 139° 03´ 55·2"E.
7·4m 37° 55´ 59·3"N., 139° 03´ 53·6"E.
2·3m 37° 55´ 36·9"N., 139° 03´ 50·3"E.
4·3m 37° 55´ 27·5"N., 139° 03´ 41·3"E.
2·8m 37° 55´ 22·3"N., 139° 03´ 36·7"E.
2·9m 37° 55´ 18·3"N., 139° 03´ 12·7"E.
(WGS84 DATUM)

Chart affected - JP 1155A

2.42
Wk08/21
 II

848(T)/21 JAPAN - Honshū - Dredging area. Works.

Source: Japanese Notice 6/5063(T)/21
1. Dredging works are taking place, until 19 March 2021, within an area bounded by the following positions:

39° 45´ 32·4"N., 140° 02´ 25·6"E.

39° 45´ 46·3"N., 140° 02´ 30·9"E.
39° 45´ 49·5"N., 140° 02´ 16·5"E.
39° 45´ 35·7"N., 140° 02´ 11·3"E.
(WGS84 DATUM)

Chart affected - JP 148

830(T)/21 KOREA - West Coast - Buoy.

Source: Korean Notice 52/1160(T)/20
1. A yellow ODAS light-buoy, Fl(5)Y.20s , has been established in position 37° 14´·44N., 125° 42´·33E.
(WGS84 DATUM)

Charts affected - 1256 - 1258

833(P)/21 PHILIPPINE ISLANDS - Luzon - Submarine cables.

Source: Phil Nav 2/21
1. Submarine cables are being laid joining the following positions:

13° 35´·18N., 124° 14´·39E.

13° 33´·08N., 124° 16´·30E.
13° 11´·90N., 124° 28´·09E.
13° 03´·54N., 124° 27´·01E.
12° 56´·46N., 124° 34´·07E.
12° 52´·44N., 124° 42´·43E.
12° 45´·35N., 124° 44´·00E.
12° 42´·42N., 124° 42´·06E.
12° 30´·53N., 124° 37´·79E.
and
12° 13´·44N., 123° 17´·10E.
12° 12´·04N., 123° 12´·91E.
12° 13´·28N., 123° 07´·08E.
12° 20´·12N., 122° 55´·02E.
12° 22´·84N., 122° 45´·85E.
12° 22´·30N., 122° 41´·22E.
2. Charts will be updated when full details are available.
3. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 3484 (INT 554) - 3489 (INT 553) - 4413 - 4416 - 4417 - 4485 - 4486 - 4487

2.43
Wk08/21
 II

887(T)/21 BRAZIL - South Coast - Buoy.

Source: Brazilian Local Nautical Radio Warning 0344/20
1. An ODAS light-buoy, Fl(5)Y.20s, has been established in position 24° 40´·8S., 42° 09´·7W.
(WGS84 DATUM)

Charts affected - 529 - 530

794(P)/21 PANAMA - Panama Canal - Light. Leading lights. Leading line.

Source: Panama Maritime Authority
1. A sectored light, Iso.WRG.2s, has been established in position 9° 21´·90N., 79° 53´·82W. The sectors are as follows:

R 178·6 - 179·6 (1°)

W 179·6 - 180·4 (0·8°)
G 180·4 - 181·4 (1°)
2. The leading lights, in positions 9° 21´·93N., 79° 53´·82W. and 9° 21´·90N., 79° 53´·82W. and the associated leading line,
180°, have been removed.
(WGS84 DATUM)

Chart affected - 8006

2.44
Wk08/21
To accompany Notice to Mariners 874(P)/21

Wk08/21
To accompany Notice to Mariners 826/21

On Chart 4217

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

To accompany Notice to Mariners 826/21

On Chart 4230

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

To accompany Notice to Mariners 826/21

On Chart 4237

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

To accompany Notice to Mariners 826/21

On Chart 4245

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

To accompany Notice to Mariners 826/21

On Chart 4246

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

To accompany Notice to Mariners 871/21

On Chart 3754

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

Wk08/21
To accompany Notice to Mariners 789/21. Image Size (mm) 203.5 by 182

Wk08/21
To accompany Notice to Mariners 798/21. Image Size (mm) 210.1 by 152

Wk08/21
To accompany Notice to Mariners 798/21. Image Size (mm) 98.8 by 133.3

Wk08/21
To accompany Notice to Mariners 798/21. Image Size (mm) 85.3 by 121.2

Wk08/21
To accompany Notice to Mariners 806/21. Image Size (mm) 202 by 116.6

Wk08/21
To accompany Notice to Mariners 824/21. Image Size (mm) 50.1 by 68.6

Wk08/21
To accompany Notice to Mariners 841/21. Image Size (mm) 189.3 by 177.7

Wk08/21
To accompany Notice to Mariners 861/21. Image Size (mm) 101 by 133.4

Wk08/21
To accompany Notice to Mariners 861/21. Image Size (mm) 97.7 by 127.5

Wk08/21
To accompany Notice to Mariners 861/21. Image Size (mm) 146.7 by 139.2

Wk08/21
To accompany Notice to Mariners 861/21. Image Size (mm) 136.5 by 177

Wk08/21
To accompany Notice to Mariners 861/21. Image Size (mm) 100.7 by 178.2

Wk08/21
 III

NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2020 Edition). Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via SafetyNET and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@ukho.gov.uk
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA
Co-ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 08, published on the UKHO website 15 Feb 21.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 08
The following NAVAREA I warnings were in force at 150500 UTC Feb 21.

2021 series: 015, 018, 019.

Summary of Navarea I warnings issued since Weekly Edition 07:

018 1. Navarea I warnings in force at 121000 UTC Feb 21. 2. Cancel 016/21.

019 1. RIGLIST. Correct at 150500 UTC Feb 21.

Southern North Sea: 51N to 55N

52-21.3N 003-35.3E Prospector 1 ACP P11-E platform
53-03.1N 002-17.1E Erda ACP Leman Oil Field
53-03.3N 001-41.2E Valaris 72 ACP Hewett Gas Field
53-06.5N 002-04.0E Seafox 4 ACP Leman Gas Field
53-14.0N 003-14.5E 590021
53-14.9N 002-01.5E Ensco 92 ACP Vulcan Gas Field
54-02.5N 000-26.5E Valaris 123

North Sea: 55N to 60N, East of 5W

55-24.0N 003-48.7E Maersk Resilient ACP A12 platform
56-16.7N 003-23.7E Maersk Invincible ACP Valhall Oil Field
56-21.6N 003-53.1E Maersk Integrator
56-43.5N 002-12.5E Ensco 120 ACP Jasmine Gas Field
57-00.8N 001-50.5E Maersk Highlander ACP Culzean Gas Field
57-01.9N 001-57.3E Valaris 122 ACP Shearwater Oil Field
57-08.0N 001-08.7E Prospector 5
57-09.2N 001-40.4E Valaris Gorilla VI
57-29.0N 002-03.1E Ocean Endeavor
57-45.0N 001-04.8E Ocean Patriot
57-48.9N 004-32.0E Maersk Inspirer ACP YME platform
57-57.6N 000-55.1W Noble Sam Hartley ACP Golden Eagle Oil and Gas Field
58-19.5N 000-41.9E Paul B Loyd Junior
NEW 58-43.6N 002-09.0E West Bollsta
58-50.5N 002-14.9E Rowan Viking alongside platform under construction, Norwegian Sector
58-50.7N 001-44.6E Rowan Stavanger ACP Gudrun Oil and Gas Field
59-35.4N 001-03.4E Noble Lloyd Noble ACP Mariner Oil Field

Norwegian Sea: 60N to 65N, East of 5W

60-27.4N 002-41.6E Askepott
60-30.4N 002-00.9E Maersk Intrepid ACP Martin Linge platform
60-43.8N 003-35.3E COSL Promoter
60-50.6N 003-34.5E Transocean Equinox
NEW 60-54.9N 003-40.2E Transocean Endurance
60-58.4N 003-30.2E West Hercules
61-05.8N 002-11.5E Deepsea Atlantic
61-16.6N 003-39.8E West Mira
61-24.3N 003-59.9E Deepsea Yantai
61-29.7N 002-08.8E Transocean Spitsbergen
64-53.2N 007-04.1E Transocean Norge

Wk08/21 3.1
 III

South and West Coasts of the British Isles

Nil.

NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform.
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no

2. Cancel 017/21.

3.2 Wk08/21
 IV

[08/21]
UPDATES TO ADMIRALTY SAILING DIRECTIONS

NP3 Africa Pilot Volume 3 (2019 Edition) Traffic regulations

13.117
1 Prohibited areas. Anchoring and fishing are
Kenya -- Mombasa — Limiting conditions; prohibited in an area centred on 5410·70N
navigable width; floating bridge 1156·80E, lying near the coast W of Warnemünde,
off Nienhagen (13.115). The area is marked at each
259 corner by buoys (special), deployed annually from the
1st May to the 30th November. A light buoy (special)
After Paragraph 10.14 1 line 4 Insert: is moored in the SW part of the area.
2 A cable area with a radius of 2½ cables, within
Navigable width which anchoring is prohibited, lies in position
10.14a 541685N 120858E.
1 Likoni Floating Bridge (40440S 393937E) is a Anchoring is prohibited within two areas (541159N
pedestrian bridge spanning Kilindini Channel, 120329E and 541115N 120339E) lying W of the
connecting Mombasa Island on the NE to Likoni on entrance to Warnemünde.
the SW. It comprises two fixed sections made of steel
trestles, two floating sections with a centre section German Notice 51/36/20 [NP18--No 44--Wk 08/21]
made up of pontoons which can be opened to allow
safe passage. When open it has a navigable width of
150 m, marked by light beacons (lateral). NP24 Black Sea and Sea of Azov Pilot
2 The floating bridge is used by pedestrians during (2019 Edition)
daylight hours only, based on the following schedule.
The times below indicate when the navigable channel Turkey -- Black Sea coast -- Koru Burnu —
will remain closed to vessel traffic: ODAS buoy
Period Time (Hours)
154
Morning Peak Crossing 06:00 -- 08:00
Paragraph 4.12 6 line 7 Replace by:
Evening Peak Crossing 16:30 -- 19:00
Unspecified Crossing When ship schedules ...berth of at least 2½ cables. An ODAS Buoy
indicate there will be (415342N 280555E) is moored 1¾ miles
no ship movements for ENE of the light.
extended periods of
time. Turkish Notice 51/174/20 [NP24--No 40--Wk 08/21]

For additional information and permission to transit

the bridge, contact the port authority. NP30 China Sea Pilot Volume 1 (2018 Edition)
Kenya Ports Authority [NP3--No 29--Wk 08/21]
China -- Gulf of Tonkin -- Qinzhou —
Controlling depths
Kenya -- Mombasa — Directions; floating bridge
224
262 Paragraph 7.17 1 lines 2--5 Replace by:
After Paragraph 10.29 2 line 6 Insert: West Channel has a least depth of 59 m close to W6
Light Buoy (port hand) (213289N 1083442E);
Through the opening span of Likoni Floating Bridge the maximum permitted draught is 85 m.
(10.14a), thence: East Channel has a least depth of 106 m
(213240N 1083823E); the maximum
Kenya Ports Authority [NP3--No 30--Wk 08/21] permitted draft is 120 m.

GB Chart 3993/20; Chinese Charts 16785/20; 16781/20

[NP30--No 166--Wk 08/21]
NP18 Baltic Pilot Volume 1 (2020 Edition)
China -- Gulf of Tonkin -- Qinzhou — Directions
Germany -- Mecklenburger Bucht --
Warnemünde approaches — Prohibited areas 225
Paragraph 7.20 3 lines 1--9 Delete
399

Paragraph 13.117 1--3 including heading and existing Chinese Chart 16781/20; ENC C1416770 (3.036); GB
Section IV Notice Week 50/20 Replace by: Chart 3992/17 [NP30--No 169--Wk 08/21]

Wk08/21 4.1
 IV

China -- Gulf of Tonkin -- After Paragraph 7.73 7 line 8 Insert:

Qinzhou Wan — Pilotage
Caution. The waters N and NE of O--Gurokami
226 Shima are encumbered with marine farms, and marine
farms lie on both sides of the channel, therefore
Paragraph 7.25 1 lines 1--2 For (212480N 1083710E) approaching from NW is not recommended.
Read (2125’·22N 10838’·77E)
ENC JP54NC8H (10.005) [NP42B--No 15--Wk 08/21]
Paragraph 7.30 1 lines 1--2 For (212480N 1083710E)
Read (2125’·22N 10838’·77E)

ENC C1416770 (3.036); GB Chart 3992/17 NP69 East Coast of the United States Pilot
[NP30--No 170--Wk 08/21] Volume 2 (2017 Edition)

China -- South China Sea -- Daxi Shuidao —

Directions; wrecks Georgia -- Savannah — Pilotage

274 211
Paragraph 8.35 1 lines 8--9 Delete
Paragraph 8.106 1 line(s) 6--9 Replace by:
Paragraph 8.35 4 lines 1--2 Delete Pilots are available 24 hours and board in the
following positions:
Chinese Chart 15379/20 [NP30--No 167--Wk 08/21] Pilot Boarding Area A (315607N 803463W);
Pilot Boarding Area B (315670N 804133W).
Deep draught vessels are taken in on the flood
China -- South China Sea -- Jiuzhou Gang — tide.
Directions; wrecks

276 United States Notice 51/11505/20

[NP69--No 45--Wk 08/21]
Paragraph 8.54 1 lines 6--8 Delete

Chinese Chart 15379/20 [NP30--No 168--Wk 08/21]

NP69A East Coasts of Central America and
Gulf of Mexico Pilot (2020 Edition)
NP42B Japan Pilot Volume 3 (2019 Edition)
Mexico -- Gulf of Mexico -- Bay of Campeche --
Seto Naikai -- Hiroshima Wan -- Kanokawa Ko Ciudad del Carmen — Development
and approaches — Directions

169 128

Paragraph 7.73 5 line(s) 3 For SE Read generally SE After Paragraph 6.86 1 line 7 Insert:

Paragraph 7.73 6 line(s) 1 For Clear Read NE Development. Construction of a new basin
(Darsena 4) for an offshore supply terminal is in
progress (2020). The basin (183895N 915130W)
Paragraph 7.73 6 line(s) 5 Replace by:
extends W, close N of the entrance to the fishing
...cable NE. Extensive marine farms lie S and SW vessel haven and is protected by N and S
of the shoal. Thence: breakwaters, from the heads of which lights will be
exhibited.
Paragraph 7.73 7 line(s) 5 Replace by:
SW of Oya Hana (341041N 1322574E); a Mexican Notice 23/282; 292; 293/20
marine farm lies close S of the point. [NP69A--No 7--Wk 08/21]

4.2 Wk08/21
 V

UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS

NP74, Vol A Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

SOUTH COAST. THE SOLENT. NEEDLES CHANNEL

A0528 - Needles. Outer Needle 50 39·73 N Oc(2)WRG 20s 24 W17 Round granite tower, ec 2, lt 2, ec 2, lt 14.
Rock 1 35·51 W R14 red band, red lantern R261°-300°(39°) Bearing 261·00° is
(GB:TH) R13 31 the approximate Shoreline Limit,
G14 W300°-083°(143°),
R(Unintens)083°-212°(129°),
W212°-217°(5°), G217°-224°(7°).
Shown 24 hours. Helicopter Platform
above lantern. Unreliable during
daylight hours only (T) 2021
--- .. Horn(2) 30s .. .. .. bl 1·5, si 2, bl 1·5, si 25
*

A0958 - Ramsgate New Port. 51 19·51 N Dir WRG 10s 10 5 Black %, orange ec 2.
Western Ferry Terminal. Ldg 1 24·86 E stripe, on white mast Oc G259°-269°(10°).
Lts 270°. Front Oc W269°-271°(2°).
Oc R271°-281°(10°).
TE 2021
*

A1585·5 - Rozel Bay. Dir Lt 245° 49 14·21 N Dir WRG 11 5 White column F G240°-244°(4°). F W244°-246°(2°).
2 02·76 W F R246°-250°(4°)
*

A3245 - KIN-04 57 01·12 N Fl Y 5s .. 5 Wind turbine ..

1 51·30 W
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. Aero R .. .. .. Obstruction
* * * * * * * *

WEST COAST. FIRTH OF CLYDE. LOCH LONG. FINNART OCEAN TERMINAL

A4411·9 - Cnap Point 56 07·38 N Fl(2)Y 6s 3 2 Grey pile on yellow ..
(GB:CPO) 4 50·19 W base
8
- - Dir Lt 024° .. Dir WRG 8 10 . . F G020·5°-022·5°(2°).
Al WG 2s 022·5°-023·5°(1°).
F W023·5°-024·5°(1°).
Al WR 2s 024·5°-025·5°(1°).
F R025·5°-027·5°(2°)
-- .. By day .. 5 .. ..
* * * * * * * *

WEST COAST. FIRTH OF CLYDE. LOCH LONG. FINNART OCEAN TERMINAL

A4412 Remove from list; deleted

WEST COAST. FIRTH OF CLYDE. LOCH LONG. FINNART OCEAN TERMINAL

A4412·1 Remove from list; deleted

A4412·85 - Mallan No 1 56 06·80 N Fl(2)Y 6s 3 2 Grey pile on yellow ..

(BP) 4 51·10 W base
8
- - Dir Lt 238° .. Dir WRG 8 2·3 . . F G233·5°-235·5°(2°).
Al WG 2s 235·5°-236·5°(1°).
F W236·5°-239·5°(3°).
Al WR 2s 239·5°-241·5°(2°).
F R241·5°-243·5°(2°)
* * * * * * * *

A4413·3 - Mallan No 2 56 07·20 N Fl(2)Y 6s 3 2 Grey pile on yellow ..

(BP) 4 49·58 W base
8
- - Dir Lt 191·5° .. Dir WRG 8 2 .. Al WG 2s 188°-189°(1°).
F W189°-194°(5°). F R194°-196°(2°)
* * * * * * * *

5.1 Wk08/21
 V

NP74, Vol A Edition 2020 continued.

WEST COAST. FIRTH OF CLYDE. LOCH LONG

A4413·5 - Mallan No 3 56 07·52 N Fl(2)Y 6s 3 2 Grey pile on yellow ..
(GB:MODN) 4 49·22 W base
8
- - Dir Lt 054° .. Dir WRG 8 2 .. F G050°-051°(1°).
Al WG 2s 051°-053°(2°).
F W053°-055°(2°).
Al WR 2s 055°-059°(4°).
F R059°-060°(1°)
* * * * * * * *

A4413·61 - Glenmallan Jetty. South 56 07·75 N Fl G 5s 7 5 Metal post Not shown when Port Closure signal
Dolphin 4 49·13 W 5 in use. (P) 2021
(GB:MODN)
- - - Traffic Signals. Port .. 3 F R (vert) 9 10 . . 1·5m apart. Occas. Restricted Area
Closure Signal closed when shown. (P) 2021
--- .. By day .. 1 .. (P) 2021
* * * * * * * *

A4413·62 - Glenmallan Jetty. S End 56 07·79 N 2 F G (vert) 10 5 Metal post 2m apart. (P) 2021
(GB:MODN) 4 49·12 W 6
* * * * * * * *

A4413·63 - Glenmallan Jetty. N End 56 07·86 N 2 F G (vert) 10 5 Metal post 2m apart. (P) 2021
(GB:MODN) 4 49·10 W 6
* * * * * * * *

A4413·64 - Glenmallan Jetty. North 56 07·94 N Fl G 5s 7 5 Metal post Not shown when Port Closure signal
Dolphin 4 49·07 W 5 in use. (P) 2021
(GB:MODN)
- - - Traffic Signals. Port .. 3 F R (vert) 9 10 . . 1·5m apart. Occas. Restricted Area
Closure Signal closed when shown. (P) 2021
--- .. By day .. 1 .. (P) 2021
* * * * * * * *

A4972·1 - Birkenhead. Woodside 53 23·76 N Bell(4) 15s .. .. .. ..

Landing Stage. N End. 40m 3 00·49 W
NNW
* * * * * * * *

NP75, Vol B Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

B0174 - Noorderhoofd. Ldg Lts 51 31·75 N Fl W 3s 50 28 Square tower, red fl 0·1.

NL, HP2, 0054 149·5°. Rear. 0·73M from 3 26·83 E superstructure Obscured by the land on certain
front. Westkapelle 52 bearings
* * * * * * * *

B0203 - Schone Waardin 51 26·54 N Oc WRG 9s 10 W13 Red mast, white ec 3.

NL, HP2, 0082 3 37·91 E R10 bands R235°-271°(36°), W271°-283°(12°),
G 9 5 G283°-335°(52°), R335°-341°(6°),
G341°-026°(45°), W026°-079°(53°),
R079°-090·5°(11·5°)
*

DIE ELBE
B1349 Remove from list; deleted

B1568·2 - Falkensteiner Ufer. 53 33·69 N Oc WR 4s 8 W1·4 Black post with red W299·5°-306·5°(7°),
DE, 4003, 311420 Quermarkenfeuer 9 46·54 E R1·4 pedestal R306·5°-328·5°(22°)
* * * * * * * *

5.2 Wk08/21
 V

NP75, Vol B Edition 2020 continued.

B1568·4 - Strandweg. 53 33·55 N Oc(2)WR 9s 8 W1·3 Black post with red R000°-060°(60°), W060°-078°(18°)
DE, 4003, 311430 Quermarkenfeuer 9 47·26 E R1·3 pedestal
* * * * * * * *

B2034·1 - Feggesund. Skarrehage W 56 56·97 N FR 6 4 Grey framework ..

DK, , 566A Ldg Lts 233·2°. Rear. 198m 8 51·79 E tower
from front 6
*

B2084·7 Hanstholm Havn. Vestmole. 57 07·53 N FG 6 .. .. ..

Head 8 35·43 E
* * * * * * * *

B2087·5 Hanstholm Havn. Østmole. 57 07·56 N FR 6 .. .. ..

Head 8 35·82 E
* * * * * * * *

B2592 Nevlunghavn. Tvistein 58 56·28 N Fl WRG 5s 16 W10 Lighthouse fl 1·5.

NO, , 043500 9 56·18 E R7·8 11 G206·9°-248·1°(41·2°),
G7·4 R248·1°-264·7°(16·6°),
W264·7°-095·3°(190·6°),
R095·3°-132·8°(37·5°)
-- .. Racon .. .. .. ALRS Vol 2 Station 64720
* * *

LANGESUNDSBUKTA. HELGEROAFJORDEN
B2595 - Åmlirogna 58 59·50 N Oc(2)WRG 8s 9 W6·1 Column G034·7°-078·2°(43·5°),
NO, , 045100 9 50·25 E R4·3 11 W078·2°-086·8°(8·6°),
G 4 R086·8°-149·2°(62·4°),
W149·2°-151·4°(2·2°),
G151·4°-181·5°(30·1°),
R181·5°-249°(67·5°),
G249°-278·6°(29·6°)
* *

LANGESUNDSBUKTA. LANGESUNDFJORDEN
B2598 - Langesund. Langøytangen 58 59·50 N Oc WRG 6s 17 W 8 Tower G220·7°-273·8°(53·1°),
NO, , 044200 9 45·43 E R5·9 14 W273·8°-275·9°(2·1°),
G5·6 R275·9°-315·8°(39·9°),
G315·8°-339·1°(23·3°),
W339·1°-008·8°(29·7°),
R008·8°-032·9°(24·1°),
W032·9°-036·5°(3·6°),
G036·5°-157·6°(121·1°)
* *

NP76, Vol C Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 6, dated 11 February 2021.

C1912 - Helsingør Havn. S Pier. 56 02·06 N FR 7 6 Red round metal Obscured when bearing less than
DK, , 2594 Head 12 37·20 E tower 219°. Not shown by day in reduced
6 visibility. Floodlit. TE; replaced by
port lateral buoy Q R close NE (T)
2020
*

ZATOKA POMORSKA. ŚWINOUJŚCIE TO SZCZECIN. ODRA RIVER. SZCZECIN PORT

C2813·2 Remove from list; deleted

5.3 Wk08/21
 V

NP76, Vol C Edition 2020 continued.

WEST COAST
C4233 - Klubbhällan. SW Point 63 19·85 N Fl W 3s 9 4 Grey U fl 0·3.
FI, , 7185 21 00·89 E Fishing. On request
* * * *

NP77. Vol D Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

D1546·1 - Ldg Lts 283·5°. Rear. 43 26·52 N Oc(2)W 5s 12 11 v on metal ec 1, lt 0·7, ec 1, lt 2·3.
ES, I, 01041 0·75M from front. On SW 3 28·60 W framework Vis 4° each side of leading line.
End of Argoños Bridge TE 2020
* *

D1631·24 - El Emballo. Centre 43 35·60 N Fl(2)R 7s 4 3 Red & on red pile fl 0·5, ec 1·5, fl 0·5, ec 4·5.
ES, I, 02126 5 55·93 W 4 TE 2020
*

D1633·25 - Astillero IPSA Bn 43 34·05 N Fl(2)R 7s 8 1 Red & on red post fl 0·5, ec 1·5, fl 0·5, ec 4·5.
ES, I, 02320 5 55·15 W TE 2020
*

D1819 - Puerto de Castiñeira. 42 31·79 N Fl(2)WR 7s 10 3 Red round tower fl 0·5, ec 1·5, fl 0·5, ec 4·5.
ES, I, 04200 Breakwater. Head 8 59·76 W 6 W263°-270°(7°), R270°-263°(353°).
TE 2020
*

D2028·4 - Angeiras. Shelter Access 41 15·89 N Oc R 6s 11 6 Red post, white bands ec 2

PT, I, 65 Ldg Lts 042°. Front. No. 1 8 43·64 W 5
*

D2682·4 - Porto das Velas. Anchorage 38 40·69 N Iso R 5s 12 6 Red column, white TE 2020
PT, I, 785 Lts in line 304·3°. Front 28 12·45 W bands
9
*

D6795 - Likoni Floating Bridge 4 04·37 S Fl G 5s .. . . Pile ..

39 39·41 E
* * * * * * * *

D6795·1 - Likoni Floating Bridge 4 04·45 S Fl R 5s .. . . Pile ..

39 39·35 E
* * * * * * * *

KING SALMAN COMPLEX

D7448·11 - N Breakwater Head. A 13 27 32·89 N Oc G 4s .. . . Green % on green ..
49 16·69 E beacon
* * * * * * * *

D7448·12 - E Breakwater Head. A 14 27 32·67 N Oc R 4s .. . . Red U on red beacon ..

49 16·91 E
* * * * * * * *

D7448·13 - N Breakwater. A 15 27 32·50 N Iso G 2s .. . . Green % on green ..

49 16·38 E beacon
* * * * * * * *

D7448·14 - E Breakwater. A 18 27 31·87 N Q R 1s .. . . Red U on red beacon ..

49 16·40 E
* * * * * * * *

5.4 Wk08/21
 V

NP77. Vol D Edition 2020 continued.

D7448·15 - E Breakwater. A 17 27 30·83 N Fl Y 5s .. . . Yellow × on yellow ..

49 16·41 E beacon
* * * * * * * *

NP78, Vol E Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

E0089·2 Puerto de Adra. Inner 36 44·64 N Fl(3)G 9s 5 2 Green column (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5.
ES, II, 22075 Breakwater. Head 3 01·22 W 3 TE 2020
*

E0094·3 - Dique extento de Poniente. 36 49·69 N Q(9)W 15s 11 3 $ on yellow post, TE 2020
ES, II, 22385 NW Head 2 28·95 W black band
4
*

E0184·5 - Beacon. In the water 38 50·78 N Fl(3)R 10s 3 5 Red & on red round (fl 0·5, ec 1·5) x 2, fl 0·5, ec 5·5
ES, II, 25362 0 07·53 E pillar
*

E0187·9 - Dique Norte. Espigón 38 50·67 N Fl(2)G 7s 7 1 Green post fl 0·5, ec 1·5, fl 0·5, ec 4·5.
ES, II, 25366 Central. Inner Wharf. Interior 0 06·82 E 5 TE 2020
Heel
* *

E6366·686 - El Ataya. Fishing Harbour 34 43·50 N Fl G 5s 6 10 Green beacon ..

TN, , 4532 11 17·90 E
*

E6373·913 - Téboulba. Secondary 35 40·50 N Fl G 6s 3 2 Green round beacon fl 1·5.

TN, , 3410 Channel. No 5 10 59·00 E TE 2020
*

E6373·926 - Téboulba. Secondary 35 40·40 N Fl R 6s 3 2 Red round beacon fl 1·5

TN, , 3570 Channel. No 18 10 57·80 E
*

E6376·5 - Monastir. New Fishing 35 45·35 N Fl G 4s 12 5 Green support fl 1.

TN, , 3010 Harbour. Entrance 10 50·36 E TE 2020
*

NP79, Vol F Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

KEMAMAN AND APPROACHES

F2859 - Port of Kemaman. Ldg Lts 4 15·01 N QR 21 12 White %, red stripe, ..
310°. Front. No 8 103 27·57 E on framework tower
*

F2859·1 - Port of Kemaman. Ldg Lts 4 15·17 N Iso R 4s 33 12 White +, red stripe, ..
310°. Rear. 457m from front. 103 27·38 E on framework tower
No 10
*

5.5 Wk08/21
 V

NP79, Vol F Edition 2020 continued.

F2860 - Port of Kemaman. No 1 4 13·72 N Fl G 5s 13 11 Green % on white ..

103 29·26 E column
*

F2860·15 - Port of Kemaman. Outer 4 12·92 N QR 12 5 Beacon ..

Approaches. South 103 29·85 E
*

F2860·2 - Port of Kemaman. Lts in 4 13·55 N Fl R 5s 11 8 Beacon on dolphin Rear Tanjung Mat Amin F2862
line 291°. Front. No 2 103 29·12 E
(MY)
*

F2860·7 - Port of Kemaman. Ldg Lts 4 15·40 N QG 21 12 White %, red stripe, ..

327°30′. Front. No 7 103 27·73 E on framework tower
*

F2860·71 - Port of Kemaman. Ldg Lts 4 15·50 N Iso G 4s 27 12 White +, red stripe, ..
327°30′. Rear. 210m from 103 27·67 E on framework tower
front. No 9
*

OILFIELD
F9530 - Bintang. A 6 33·77 N Mo(U)W 15s .. 10 Platform TE 2020
103 17·62 E
*

F9530·1 - Bintang. B 6 33·66 N Mo(U)W 15s .. 10 Platform TE 2020

103 15·18 E
*

NP80, Vol G Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

G3129 - Punta Coll 3 00·18 N LFl W 10s 65 20 Red tower, white fl 2

CO, P, 12 78 10·02 W bands
19
* * * * * * * *

G4734·3 - Hoquiam Reach. F Ldg Lts 46 58·19 N QW 7 . . Red U, black stripe, Intens 1·5° each side of rangeline
US, VI, 15785 274·2°. Front 123 55·89 W on framework tower,
on multi-pile
structure
*

NP82, Vol J Edition 2021. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

J1328·7 - Enterprise. Lower Ldg Lts 40 02·85 N FW 15 . . Framework tower Vis 1·5° each side of rangeline.
US, II, 3825 241·5°. Rear. 966m from 74 58·93 W Shown 24 hours
front
----- .. By day F W .. .. .. Vis 1·5° each side of rangeline
* * * * * * * *

5.6 Wk08/21
 V

NP82, Vol J Edition 2021 continued.

J3166·1 - Cut C Channel. Inbound. 27 42·20 N Iso W 6s 16 . . Framework tower on Vis 1·5° each side of rangeline.
US, III, 22605 Ldg Lts 061°. Rear. 0·578M 82 32·26 W piles Shown 24 hours
US, III, 22605·5 from front
------ .. By day Iso W .. .. .. ..
6s
- - - - - - Passing light .. Fl W 4s 6 5 .. ..
* * * * * * * *

J3188 - Cut F Channel. Inbound. 27 47·73 N 2 Fl W 2·5s 5 .. .. Vis 0·5° each side of rangeline.
US, III, 22810 Ldg Lts 000°. Front 82 31·39 W Shown 24 hours. Synchronized
US, III, 22810·5 - - - - - Passing light .. QW 4 4 .. ..
* * *

J3205·1 - Cut J2 Channel. Inbound 27 50·74 N Iso W 6s 14 .. .. Vis 1·5° each side of rangeline
US, III, 23755 Ldg Lts 010°. Rear. 785m 82 33·98 W
US, III, 23755·1 from front
----- .. By day Iso W .. .. .. ..
6s
- - - - - Passing lights .. 2 Fl W 2·5s .. 3 .. Synchronized. Located on NW and SE
Corners of Platform
* * * * * * * *

J4090·1 - Houston Pilots Scientific 29 26·29 N Fl W 2·5s 6 . . Platform Private

US, IV, 24077 Platform 94 50·05 W
* * * * * * * *

J4372·1 - Puerto de Ciudad del 18 37·68 N Fl W 6s 32 20 White truncated TE 2020

MX, , 04-235 Carmen. Xicalango. Ldg Lts 91 53·99 W conical masonry
180°. Rear. 185m from front tower, red bands
28
* *

NP83, Vol K Edition 2021. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

K3268·85 - Ellis Channel 10 35·35 S Fl R 2·5s .. . . Red & on beacon TE; replaced by light buoy Fl R 2·5s
142 14·14 E (T) 2021
*

K4676 - W Reef. SE End 18 08·56 S Fl R 3s 9 3 Red concrete tripod fl 0·3

FJ, F201, 4676 178 23·56 E 10
*

NP85, Vol M Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

M4149·9 Gureopdo 37 08·58 N Fl(5)Y 20s 18 9 Yellow × on yellow ..

KR, 410, 3362·6 125 54·74 E post
3
* * * * * * * *

M4192·501 - Bieungdo. S Breakwater 35 55·92 N Fl(3)G 7s 16 8 White round concrete . .

KR, 410, 3170·3 126 31·58 E tower
KR, 410, 4601 13
--- .. AIS .. .. .. MMSI No 004406103
* * * * * * * *

5.7 Wk08/21
 V

NP85, Vol M Edition 2020 continued.

M4192·51 - Bieungdo. W Breakwater 35 56·02 N Fl G 5s 14 7 White round metal ..

KR, 410, 3170·2 126 31·62 E tower
7
* * * * * * * *

M4192·52 - Bieungdo. E Breakwater 35 56·01 N Fl R 5s 16 7 Red round concrete ..

KR, 410, 3170·1 126 31·70 E tower
13
* * * * *

M7750 - South Harbour. S 47 03·12 N Fl G 3s 8 2 Green metal fl 0·5.

RU, 2401, 1205 Breakwater. Head 142 02·50 E framework tower TE 2021
5
*

M8052 - Kasatka 44 58·92 N Fl W 6s 45 8 Red round metal fl 1·5.

RU, 2401, 2465 147 44·03 E tower with platform TE 2021
5
*

NP86, Vol N Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 6, dated 11 February 2021.

N5019 Port Mangalia. NE 43 47·94 N Fl W 4s 23 10 Metal framework fl 1·5

RO, , 2 Breakwater. Head 28 36·03 E tower
21
--- .. Horn Mo(U) .. .. .. (bl 1·5, si 1) x 2, bl 5, si 30.
40s TD 2020
*

N7655·5 Remove from list; deleted

NP87, Vol P Edition 2020. Weekly Edition No. 8, Dated 25 February 2021.
Last Updates: Weekly Edition No. 7, dated 18 February 2021.

P3682·293 - Xiangshan. No 1. No 2 28 56·50 N Mo(C)Y 12s 14 7 Yellow × on yellow ..

CN, G102, 2622·21 121 58·50 E square metal tower
CN, G102, 2622·22 3
---- .. AIS .. .. .. MMSI No 994121549
* * * * * * * *

P3716·3085 - Ningbo Gang. Jintang Great 30 02·15 N Mo(C)Y 15s 6 3 Yellow × on yellow Sync with P3716·3086
CN, G102, 2404·015 Bridge. No 615 121 42·12 E square metal tower
4
* * * * * * * *

P3716·3086 - Ningbo Gang. Jintang Great 30 02·26 N Mo(C)Y 15s 6 3 Yellow × on yellow Sync with P3716· 3085
CN, G102, 2404·013 Bridge. No 613 121 42·34 E square metal tower
4
* * * * * * * *

5.8 Wk08/21
 V

NP87, Vol P Edition 2020 continued.

P3718·7305 - Jiaxing Gangqu Wupai. No 30 34·54 N Mo(C)Y 15s 12 3 Yellow × on yellow In Sync
CN, G102, 2271·007 1. No 2. No 3 121 03·20 E GRP column
CN, G102, 2271·008 5
CN, G102, 2271·009
* * * * * * * *

NP88, Vol Q Edition 2021. NEW EDITION Weekly Edition No. 8, Dated 25 February 2021.
NOTE: These are the first updates issued for the New Edition.

Cut out the above and paste it in the NEW EDITION First Updates box immediately below the
RECORD OF UPDATES title on page ii of NP88, Vol Q Edition 2021 New Edition.

Q1043·11 - Pulau Pari 5 51·70 S Fl R .. . . Red U on red post TE; replaced by Fl 10 7m 8M close
(ID) 106 37·21 E S (T) 2020
*

Q1043·115 - Pulau Pari 5 51·68 S Fl G .. . . Green % on green TE 2020

(ID) 106 37·25 E post
*

TELUK JAKARTA
Q1061·5 - Untung Jawa Island 5 58·59 S Q(6)+LFl W 7 8 " on black beacon, ..
ID, , 1728 (ID) 106 42·02 E 10s yellow top
* *

Q1062·5 - LNG Terminal 5 58·40 S Fl W 3s 30 12 Platform ..

ID, , 1716 (ID) 106 47·98 E
* * * *

Q1073·21 - 6 06·37 S Fl R 4s 6 5·3 Red & on red beacon fl 1

ID, , 1723·2 (ID) 106 51·82 E
* * * * * * * *

Q1073·23 - 6 06·37 S Fl R 3s 6 5·3 Red U on red post ..

ID, , 1723·2 (ID) 106 51·82 E
* * * * * * * *

Q1073·66 - W Breakwater. S End. Ldg 6 05·82 S Iso W 5s 20 10 % on white beacon ..

ID, , 1748·3 Lts. Front 106 52·39 E
(ID)
* * * * * * * *

Q1073·665 - W Breakwater. S End. Ldg 6 05·84 S Iso W 5s 20 10 + on white beacon ..

ID, , 1748·4 Lts. Rear. 43m from front 106 52·39 E
(ID)
* * * * * * * *

Q1076·3 - E Mole 6 04·87 S Fl Y .. . . Yellow lattice ..

(ID) 106 53·04 E
* *

TELUK JAKARTA. PELABUHAN TANJUNGPRIOK

Q1076·7 Remove from list; deleted

Q1158·2 - Ug Slempit (Sembilangan) 7 03·62 S Fl(3)W 10s 53 20 × on white round ..

ID, , 3510 (ID) 112 40·48 E concrete tower
50
* * * * * * * *

5.9 Wk08/21
 V

NP88, Vol Q Edition 2021 continued.

Q1168·4 - Selat Surabaya. 7 11·74 S Fl Y 5s .. . . × on yellow beacon ..

International Container 112 42·09 E
Terminal. W End
(ID)
* * * * * * * *

Q1168·5 - Selat Surabaya. Domestic 7 12·09 S Fl Y 5s .. . . × on yellow beacon ..

Container Terminal. SW End 112 42·75 E
(ID)
* * * * * * * *

Q1178·5 - Tanjungperak. Entrance. W 7 11·91 S Q Y 1s .. . . × on yellow beacon ..

Side 112 42·94 E
(ID)
* * * * * * * *

Q1211 - Probolinggo 7 42·91 S Fl W 3s 23 9 White beacon fl 0·5

ID, , 3879 (ID) 113 12·94 E 20
* * * * * * * *

Q1212 - Probolinggo. W Mole. 7 43·33 S Fl G 5s 14 12 Green metal fl 0·5

ID, , 3880 Head 113 13·05 E framework tower
(ID) 14
* * * * * * * *

Q1506·25 - Pare-Pare. Karang Tete 4 00·61 S Fl R 4s 5 9·1 Red & on red beacon fl 0·5
ID, , 5038 (ID) 119 36·99 E
* * * * * * * *

BROWSE ISLAND
Q1642·3 - FPSO Prelude 13 47·18 S Mo(U)W 11s .. 15 . . ..
123 19·05 E
* * * * * * * *

Q1679·02 - No 15 20 10·40 S Fl G 4s 20 6 Green beacon fl 0·6

118 30·49 E
*

Q1679·03 - No 16 20 10·33 S Fl R 4s 20 6 Red beacon fl 0·6

118 30·63 E
*

SPENCER GULF
Q1970 - Port Broughton 33 33·64 S Fl W 5s .. 5 .. ..
137 52·73 E
*

5.10 Wk08/21
 VI

COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE REQUIREMENTS,

PILOTAGE, VTS, REPORTING, RADIO COMMUNICATIONS AND TRANSMISSIONS
An increasing number of ports are introducing specific quarantine reporting requirements with regards to this virus. Its continued
spread is also impacting a number of other services covered by ADMIRALTY List of Radio Signals products. Due to the ongoing
and dynamic nature of the situation, mariners should contact the appropriate Port Authority, VTS, Pilot, coastguard, radio station
or other designated body covering their planned route and destination, for the latest advice and procedures. Due to the rapidly
changing situation, it is advised to check local situation at the earliest opportunity when passage planning.
VI

UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS

Weekly Edition No. 8 dated 25 February 2021

The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2021.pdf)

VOLUME 1, NP281(2), First Edition, 2020

Published Wk 48/20
(Last Updates: Weekly Edition No. 7 dated 18 February 2021)

MARITIME RADIO STATIONS

PAGES 231 and 232, INDONESIA (Sumatera).

PALEMBANG, Radiotelex frequency table.
Delete table and replace by:

Radiotelex [2202]
Position Transmits Receives Hours of Watch
2174·5 2174·5 0000-0100
2177 2177 2189·5 0130-0200
4177·5 4177·5 0300-0430
6268·5 6268·5 0200-0300 0800-0900
6317 6265·5 0430-0500
8376·5 8376·5 0600-0700
8419·5 8379·5 0530-0600
8436·5 8415 0400-0430 1130-1200
12520·5 12520·5 1000-1200
12584·5 12482 0700-0730 1200-1230
12657 12577·5 0830-0900
16695 16695 1230-1300
16812 16688·5 0700-0800 1330-1400

ITU MARS database (RSDRA2021000045559) 8/21

PAGE 232, INDONESIA (Sumatera).

PANGKAL BALAM, Contacts table.
Delete table and replace by:

Control Centre: 2°06′·12S 106°07′·82E MMSI 005251508 DSC VHF MF Diagram page 207
Telephone: +62 717 9103027 Fax: +62 813 79350827

ITU MARS database (RSDRA2021000045559) 8/21

PAGES 234 and 235, INDONESIA (Sumatera).

PLAJU, Contact details table.
Delete table and replace by:

Control Centre: 3°00′·00S 104°50′·00E MMSI 005250084 DSC VHF MF HF 8 MHz Diagram page 222
NOTE(S): Only for use by Pertamina vessels.
Wk08/21
ITU MARS database (RSDRA2021000045559) 8/21
6.1
Control Centre: 2°06′·12S 106°07′·82E MMSI 005251508 DSC VHF MF Diagram page 207
Telephone: +62 717 9103027 Fax: +62 813 79350827

ITU MARS database (RSDRA2021000045559) 8/21 VI

PAGES 234 and 235, INDONESIA (Sumatera).

PLAJU, Contact details table.
Delete table and replace by:

Control Centre: 3°00′·00S 104°50′·00E MMSI 005250084 DSC VHF MF HF 8 MHz Diagram page 222
NOTE(S): Only for use by Pertamina vessels.
VI
ITU MARS database (RSDRA2021000045559) 8/21

PAGES 236 and 237, INDONESIA (Sumatera).

SEI PAKNING.
Delete entry and replace by:

SEI PAKNING (PKP5)

Control Centre: 1°24′·72N 102°12′·96E MMSI 005250090 DSC VHF Diagram page 222
NOTE(S): Only for use by Pertamina vessels.

VHF 6.1
Ch 09 16 H24
Ch 19

ITU MARS database (RSDRA2021000045559) 8/21

VOLUME 2, NP282(1), First Edition, 2020

Published Wk 13/20
(Last Updates: Weekly Edition No. 7 dated 18 February 2021)

RADAR BEACONS

PAGE 56, KUWAIT, above 78080 Ahmadī Lt Buoy.

Insert:

Mīnā' Al-Zour Approach Front Ldg Lt 28°43′·71N 48°24′·42E Z 77950

Kuwaiti Notice 01/21 (RSDRA2021000045520) 8/21

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 174, UNITED KINGDOM, above Anchor Point North East.

Insert:

Amethyst A1D Offshore Platform 53°36′·64N 0°43′·36E 992351341 Real

Amethyst A2D Offshore Platform 53°37′·35N 0°47′·34E 992351347 Real 21

Amethyst B1D Offshore Platform 53°33′·66N 0°52′·64E 992351344 Real 21

Trinity House correspondence (RSDRA2021000045186) 8/21

VOLUME 2, NP282(2), First Edition, 2020

Published Wk 13/20
(Last Updates: Weekly Edition No. 7 dated 18 February 2021)

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 96, ARGENTINA, above Canal Emilio Mitre Km 36.5 Green Lt Buoy.
Insert:

Caleta Córdova Oil Terminal Lt

45°46′·39S 67°19′·42W 997011126 Real 21
Buoy
Caleta Olivia Oil Terminal Lt Buoy 46°25′·53S 67°28′·70W 997011127 Real 21
Wk08/21
6.2
(former update 38/20)
Argentine Notice 2/31/21 (RSDRA2021000045902) 8/21
Argentine Notice 2/30/21 (RSDRA2021000045902) 8/21
Amethyst B1D Offshore Platform 53°33′·66N 0°52′·64E 992351344 Real 21

Trinity House correspondence (RSDRA2021000045186) 8/21

VI

VOLUME 2, NP282(2), First Edition, 2020

Published Wk 13/20
(Last Updates: Weekly Edition No. 7 dated 18 February 2021)

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 96, ARGENTINA, above Canal Emilio Mitre Km 36.5 Green Lt Buoy.
Insert:

Caleta Córdova Oil Terminal Lt

45°46′·39S 67°19′·42W 997011126 Real 21
Buoy
Caleta Olivia Oil Terminal Lt Buoy 46°25′·53S 67°28′·70W 997011127 Real 21

(former update 38/20)

Argentine Notice 2/31/21 (RSDRA2021000045902) 8/21
VI
Argentine Notice 2/30/21 (RSDRA2021000045902) 8/21

PAGE 112, CHINA, below Beizhi Koumen Hydrological Warning Lt Bn No 2.

Insert:

BG 7 Wreck 28°47′·95N 122°02′·89E 994126427 Broadcasts every 3 minutes Virtual

6.2
(former update 25/20)
Chinese Notice 4/107/21 (RSDRA2021000045868) 8/21

PAGE 128, CHINA, below Guibeiyu 24022 Wreck.

Insert:

Guishan Marine Windfarm Lt Buoy

22°06′·70N 113°45′·45E 994121744 Broadcasts every 3 minutes Real
No 1
Guishan Marine Windfarm Lt Buoy
22°05′·28N 113°45′·64E 994121745 Broadcasts every 3 minutes Real
No 2
Guishan Marine Windfarm Lt Buoy
22°05′·22N 113°43′·66E 994121746 Broadcasts every 3 minutes Real
No 3
Guishan Marine Windfarm Lt Buoy
22°06′·53N 113°42′·73E 994121747 Broadcasts every 3 minutes Real
No 4

Chinese Notice 4/118/21 (RSDRA2021000045868) 8/21

PAGE 128, CHINA, below H22A Wreck.

Insert:

Hai Sha No 1 22°04′·18N 114°06′·30E 994136980 Broadcasts every 3 minutes Virtual

Hai Sha No 2 22°04′·18N 114°05′·25E 994136981 Broadcasts every 3 minutes Virtual

Hai Sha No 3 22°03′·35N 114°05′·23E 994136982 Broadcasts every 3 minutes Virtual

Hai Sha No 4 22°03′·34N 114°06′·30E 994136983 Broadcasts every 3 minutes Virtual

Chinese Notice 4/119/21 (RSDRA2021000045868) 8/21

PAGE 134, CHINA.

Jiace Lt Buoy No 36.
Delete entry

Chinese Notice 4/103/21 (RSDRA2021000045868) 8/21

PAGE 142, CHINA.

NLH 1206 Wreck.
Delete entry

(former update 50/20)

Chinese Notice 4/104/21 (RSDRA2021000045868) 8/21

PAGE 154, CHINA.

Tanxu Shan Lt Buoy No 4.
DeleteWk08/21
entry
6.3
Chinese Notice 4/103/21 (RSDRA2021000045868) 8/21
PAGE 142, CHINA.
NLH 1206 Wreck.
Delete entry

(former update 50/20)

Chinese Notice 4/104/21 (RSDRA2021000045868) 8/21 VI

PAGE 154, CHINA.

Tanxu Shan Lt Buoy No 4.
Delete entry

Chinese Notice 4/103/21 (RSDRA2021000045868) 8/21

PAGE 156, CHINA, below WM Wreck 1.

Insert:

WMGH 0525 Wreck 31°51′·68N 121°20′·69E 994126421 Broadcasts every 3 minutes Virtual

Chinese Notice 4/99/21 (RSDRA2021000045868) 8/21

PAGE 158, CHINA.

WZH66 Wreck.
Delete entry

(former update 21/20) VI

Chinese Notice 4/106/21 (RSDRA2021000045868) 8/21

6.3
PAGE 160, CHINA, below Xiangshan Gang Daqiao Lt Buoy No 113.
Insert:

Xiangshan Wind Power Lt Buoy No

29°06′·22N 122°04′·00E 994121555 Broadcasts every 3 minutes Real
L21
Xiangshan Wind Power Lt Buoy No
29°06′·20N 122°01′·12E 994121556 Broadcasts every 3 minutes Real
L22
Xiangshan Wind Power Lt Buoy No
29°02′·27N 121°59′·11E 994121557 Broadcasts every 3 minutes Real
L26
Xiangshan Wind Power Lt Buoy No
29°01′·72N 122°02′·47E 994121558 Broadcasts every 3 minutes Real
L28

Chinese Notice 4/105/21 (RSDRA2021000045868) 8/21

PAGE 168, CHINA, below Zhenhai Power Plant Lt Bn.

Insert:

Zhesheng Power Lt Bn No 1 30°36′·90N 121°44′·29E 994121407 Broadcasts every 3 minutes Real

(former update 34/20)

Chinese Notice 4/102/21 (RSDRA2021000045868) 8/21

PAGE 194, NEW ZEALAND, below Pudney Rock.

Insert:

Rauoterangi Channel Lt Buoy 40°50′·58S 174°58′·71E 995121054 Real

New Zealand Notice 3/25/21 (RSDRA2021000045699) 8/21

Wk08/21
6.4
 VI
VI

VOLUME 3, NP283(2), First Edition, 2020

Published Wk 50/20
(Last Updates: Weekly Edition No. 7 dated 18 February 2021)

RADIO WEATHER SERVICES AND NAVIGATIONAL WARNINGS

PAGE 187, below INDONESIA (Sulawesi) section.

Insert new section:

INDONESIA (Sumatera)
PALEMBANG (PKC) [2202]
Control Centre: 2°58′·13S 104°46′·93E
A 448 WT (MF)
B 8705·4 WT (HF)
C 8806 (Ch 830) RT (HF)
A: 0200 1000
Weather
B: 0300 0700 Weather Bulletins.
Bulletins
C: 0400 1200
A1: 0000 0400 0800 1200
Navigational
B: 0100 0500 0900 1130 Navigational Warnings in English.
Warnings
C: 0200 0600 1000
1 After prior announcement on 500 kHz.

NOTE(S): Navigational Warnings follow the traffic lists at the times indicated.

SIBOLGA (PKB3) [2232]

Control Centre: 1°44′ 48N 98°46′·59E
474 WT (MF)
Navigational
0000 0400 0800 Navigational Warnings.
Warnings

ITU MARS database (RSDRA2021000045559) 8/21

Wk08/21 6.5
6.5
 VI
VI

VOLUME 6, PART 1, NP 286(1), First Edition, 2020 PAGES 19 & 20, DENMARK, EGERNSUND.
Published Wk 36/20
Delete entry and replace by:

–––––––––––––––––– EGERNSUND 54°54′N 9°36′E

UNCTAD LOCODE: DK END
(Last Updates: Weekly Edition No. 6 dated 11 February 2021)

PAGE 70, FRANCE (Atlantic and English Channel Coasts), FÉCAMP, Pilots
Pilots, PROCEDURE section. NOTE:
Delete and replace by: For information on compulsory pilotage and Pilot ordering, see GENERAL NOTES.

Port
PROCEDURE:
(1) Pilotage is compulsory for vessels and tows over 45m LOA. CONTACT DETAILS:
(2) Pilotage is not compulsory for the following: Telephone: +45 74 422765
(a) Sailing vessels less than 100 gt
(b) Mechanically powered vessels less than 150 gt Bridge
(c) French vessels 60m LOA or less equipped with two propeller shafts and a bow CONTACT DETAILS:
thruster VHF Channel: Ch 16
(3) Pilot ordering: Vessels should send request for pilotage and ETA 24h in advance Telephone: +45 88 724110
or at least 12h before HW or on leaving the last port of call if it is less than 24h away E-mail: vagtcentral@sonderborg.dk
stating:
(a) LOA and overall dimensions HOURS: Apr-Oct: 0615-2215 LT
(b) Draught Nov-Mar: 0615-1515 LT
(c) Whether the vessel is equipped with a bow thruster or other manoeuvring PROCEDURE:
capability (1) Vessels with LOA over 20m must contact the bridge watch at least 1h prior to the
(4) Vessel’s ETD should be advised 3h in advance and conrmed in writing. opening of the bridge via VHF or telephone.
(5) Pilot boards in position 49°46′·30N 0°20′·38E. (2) Vessels with LOA under 20m wishing to pass the bridge may contact the bridge
guard or indicate this by issuing the following signal at a distance from the bridge of at
French Bulletin 3/21, (RSDRA2021000018673), 8/21 least 500m:
(a) During the day: The international signal ag N - or in the absence thereof the
national ag hoisted at half forehead.
PAGE 120, IRELAND, NEW ROSS, Pilots, PROCEDURE, section (4) (b).
(b) At night: A white light from the bow.
Delete and replace by:
NOTE:
(b) NNW of Duncannon Fort: 52°13′·50N 6°56′·42W (bad weather) The bridge is remotely controlled and monitored from Sønderberg Harbour Office.

Port of Waterford correspondence, (RSDRA2021000045251), 8/21 Sønderborg Municipality 19 January 2021, (RSDRA2021000038754), 8/21

––––––––––––––––––––––––––––––
PAGE 35, DENMARK, NAKSKOV, Lolland, Port, CONTACT DETAILS
and HOURS sections.
VOLUME 6, PART 2, NP 286(2), First Edition, 2020 Delete and replace by:
Published Wk 37/20

–––––––––––––––––– CONTACT DETAILS:

VHF Channel: Ch 16; 12 13
(Last Updates: Weekly Edition No. 3 dated 21 January 2021)
Telephone: +45 54 677332
PAGE 18, DENMARK, BANDHOLM, Lolland, Port, CONTACT DETAILS +45 24 458290 (Guard)
section. E-mail: havne@lolland.dk
Delete and replace by: Website: www.lollandhavne.dk
HOURS: Mon-Thur: 0830-1500 LT
Fri: 0830-1200 LT
CONTACT DETAILS:
Lolland Ports, 21 January 2021, (RSDRA2021000038754), 8/21
Hr Mr
Telephone: +45 54 958066
E-mail: bandholmhavn@knuthenborg.dk
Website: www.bandholmhavn.dk

Odsherred Harbours, 20 January 2021, (RSDRA2021000038754), 8/21

1
Wk08/21
6.6
 VI
VI

PAGE 44, DENMARK, SØNDERBORG, King Christian X Bridge. VOLUME 6, PART 8, NP 286(8), First Edition, 2020
Delete section and replace by: Published Wk 14/20

––––––––––––––––––
King Christian X Bridge
(Last Updates: Weekly Edition No. 06 dated 11 February 2021)
LOCATION: 54°54′·66N 9°47′·02E
PAGE 77, KENYA, MOMBASA, Port, PROCEDURE, below section (4).
CONTACT DETAILS: Insert new section:
Bridge
VHF Channel: Ch 16; 12 13
Telephone: +45 74 423939 Likoni Floating Pedestrian Bridge (LFPB)

HOURS: Apr-Oct: 0630-2200 LT PROCEDURE:

Nov-Mar: 0630-1545 LT
PROCEDURE:
Vessels wishing to pass the bridge shall indicate this by giving the following signal at a
distance of at least 0·5 n miles or as soon as the bridge is within sight:
(1) During the day: The international signal ag N (or in the absence thereof the
national ag) hoisted on a half forehead and a long and a short tone with a whistle or
fog horn.
(2) At night: A white light for the bow and a long and a short tone with a whistle or fog
horn.
Sønderborg Municipality, 19 January 2021, (RSDRA2021000038754), 8/21
(1) Departure vessels: KPA operations in collaboration with the Ship’s Agent shall
issue 2h notice to the VTS before closure of the bridge.
(2) Arrival vessels: Ship’s Agent shall issue 3h notice of arrival to the VTS before
closure of the bridge.
(3) Vessel’s shall conrm 2h notice of arrival to VTS Port Control through VHF before
closure of the bridge.
(4) The navigational channel remains closed to allow pedestrians to cross mainly
during peak hours at the following times
(a) Morning crossing: 0600-0800 LT
(b) Evening crossing: 1630-1900 LT
(c) Unspecied crossing: Whenever the shipping schedule indicates that there will
be no vessel movement for extended periods of time

Port of Mombasa correspondence, (RSDRA2021000032580), 8/21

––––––––––––––––––––––––––––––
––––––––––––––––––––––––––––––
VOLUME 6, PART 6, NP 286(6), Second Edition, 2021
Published Wk 5/21

––––––––––––––––––
(Last Updates: Weekly Edition No. 5 dated 4 February 2021)

PAGE 49, CHINA, GUANGZHOU, including Huangpu and Nansha,

Pilots, PROCEDURE, sections (2) (i) and (j).
Delete and replace by:

(i) Zhuhai Port Jiuzhou Harbour No 1: 22°07′·70N 113°40′·40E

(j) Xibu Harbour Guishan Pilot Anchorage: 22°08′·00N 113°47′·88E

Chinese ENC_CN384002_ED18_001, (RSDRA2020000289266), 8/21

––––––––––––––––––––––––––––––

2
Wk08/21
6.7
 VII

UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS

There are no updates to miscellaneous Nautical Publications this week

UPDATE ON THE EFFECTS OF COVID--19 ON THE DELIVERY OF

NAUTICAL PUBLICATIONS

As a result of ongoing effects of COVID-- 19 on distribution infrastructure around the world, for
safety reasons, we took the decision a few months ago to delay the publication of any non--essential
ADMIRALTY Nautical Publications until further notice.
We started to ease the restrictions on the dispatch of some of our paper publications for July 2020.
We are continuing this effort and following some positive feedback on successful receipts of
publications, we are now in a position to confirm the publications schedule for the rest of the year.
As previously, we will continue to closely monitor our distribution network capacities.
We reserve ourselves the right to amend this publications schedule accordingly should significant
dispatch issues start arising again.

7.1
Wk08/21
 VIII

ADMIRALTY DIGITAL SERVICES

1. ENC / ECDIS and AVCS

a) Safety Notice
For a graphical way to establish that the ECDIS is correctly displaying the new symbols introduced in IHO S-52 Presentation Library
Edition 4.0 the mariner can check ECDIS Chart 1. ECDIS Chart 1 is a legend of the entire set of symbols that may be used within an
ENC and is installed on all type-approved ECDIS systems. See iho.int for further information. ECDIS Systems have been required to
use Presentation Library edition 4.0 since 1st September 2017 and previous editions are no longer SOLAS compliant.

b) ENCs temporarily withdrawn from AVCS

To review a cumulative list of ENCs temporarily withdrawn from AVCS, please visit the ‘Updates’ tab on:
admiralty.co.uk/AVCS

c) ENC Readme.txt file

The README.TXT file located within the ENC_ROOT folder on the latest AVCS discs contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the support tab at admiralty.co.uk/avcs.

This file is updated on a regular basis and should be consulted to ensure that all related issues are taken into consideration.

d) Temporary & Preliminary Notices to Mariners (T&P NMs) in ENCs

The use of T&P NM information is considered an essential part of keeping navigational charts up to date.

The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file in the INFO folder on the service media and at: admiralty.co.uk/ENC-TP-NMs

ADMIRALTY Information Overlay (AIO) shows ADMIRALTY paper T&Ps where they are not already included in the ENCs. Most
countries now include temporary information in their ENCs.

Further guidance can be found in the INFO folder on AIO discs.

e) Important notice regarding AVCS CD Service

Because of the limit to data volume that can be fitted onto a disc, AVCS Base and Update CDs are no longer available to download as
ISO files from the UKHO FTP site. For those customers who prefer to update their ECDIS with base and update datasets, we will
continue to provide them in V01X01 format as .zip files. These may be downloaded and unzipped to load into ECDIS as normal. AVCS
DVD ISO files are not affected.

For more information, please contact your ADMIRALTY Chart Agent.

f) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)

The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.

Email calls to AVCS OUS will receive an auto-response that asks the customer to resubmit their data request online by http. Please
contact your ADMIRALTY Distributor if support is required for use of the http service.

Due to the technology updates at UKHO, the ARCS Online Updating Service was withdrawn in July 2019.

2. ADMIRALTY Products Supporting Digital Navigation

i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.
ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.
iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.

8.1
Wk 08/21
 VIII

iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.

3. ADMIRALTY Digital Publications (ADP)

ADMIRALTY Sailing Directions: Removal of AIS and Racons

In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as this is held in
greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon information will be removed
from new editions of each Sailing Direction volume, and AIS and Racon information present in existing Sailing Direction volumes will
no longer be updated. For accurate, up-to-date information on AIS and Racons, refer to ADMIRALTY Radio Signals publications.

ADP V19 is available on the ADP Weekly Update DVD.

The UKHO only supports ADP V18 and V19. Users of older versions of ADP should upgrade to a supported version at their earliest
convenience. ADP V18 and V19 are the only versions that allow users to receive tidal updates as they are made available.

ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT

The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.

For information: Please note that there will not be a 2021 ADP release.

Historically we have made new versions of the ADP software available at the end of each year however, there will be no commercial
release of ADP this year. Regular changes/improvements have been made throughout the year and therefore there is no value in issuing
a new Software version.

The supported ADP versions continue to remain at V18 and V19.

The ADP software and the Data updates can still be downloaded from weekly ADP and AENP Update DVDs.

Users can also download ADP directly on the Distributors FTP Site at ftp://ukho.gov.uk

For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@ukho.gov.uk

4. ADMIRALTY e-Nautical Publications (AENP)

There is currently an e-Reader 1.3 enabling users to read Digital copies of our Sailing Directions paper publications.

A new e-Reader 1.4 was released to the Channel on 01/10/2020. This version 1.4 has got the same functionalities as the current version
1.3 but is more performant and user-friendly. While the current 1.3 version can be used on Windows 7 and 8.1 Operating Systems (OS),
the e-Reader 1.4 can only be used on Windows 8.1 and 10 OS, to follow the Microsoft guidelines of withdrawing support for Windows
7 OS.

To enable users to activate this new application, users might need to delete one e-Reader application from their Fleet Manager Licences
if the maximum 3 allowed has been reached.

Both the e-Readers 1.3 and 1.4 are supported at the UKHO.

The e-Reader 1.4 software and the Data updates can be downloaded from weekly ADP Update and Software DVDs.

Users can also download the e-Reader 1.4 software directly on the Distributors FTP Site at ftp://ukho.gov.uk

8.2
Wk 08/21
 VIII

5. Status of ADMIRALTY Digital Services

Update status table

Product Last issue date/Week Reissue Date/Week

i. ADMIRALTY Vector Chart Service (AVCS) Base .zip download 04 February 2021 - 05
ii. ADMIRALTY Information Overlay (AIO) Base CD 02 July 2020 - 27
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 14 January 2021 - 02
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 25 February 2021 - 08
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 19 November 2020 - 47
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 15 October 2020 - 42 29 April 2021 - 17
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 20 August 2020 - 34 15 April 2021 - 15
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 10 September 2020 - 37 25 March 2021 - 12
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 24 September 2020 - 39
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 28 January 2021 - 04
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 11 February 2021 - 06
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 10 December 2020 - 50
05 November 2020 – 45
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts

ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.

5. Supported ADMIRALTY Software Versions

Product Supported Versions

ADP V18, V19
ADMIRALTY e-Reader 1.3, 1.4
NavPac and Compact Data 4.1

If you are using an unsupported version, contact your Chart Agent to upgrade to the latest version as soon as possible.

8.3
Wk 08/21
 HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

Reporting Port Information affecting ADMIRALTY Products

NAME OF PORT

APPROXIMATE POSITION Latitude Longitude

GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.

Number of ships or tonnage handled per

year.

Maximum size of vessel handled.

Copy of Port Handbook (if available).

ANCHORAGES
Designation, depths, holding ground,
shelter afforded.

PILOTAGE
Authority for requests.

Embark position.

Regulations.

DIRECTIONS
Entry and berthing information.

Tidal streams.

Navigational aids.

TUGS
Number available.

WHARVES
Names, numbers or positions & lengths.

Depths alongside.

CARGO HANDLING
Containers, lighters, Ro-Ro etc.

REPAIRS
Hull, machinery and underwater.

Shipyards.

Docking or slipping facilities.

(Give size of vessels handled or
dimensions)

Divers.
 HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

RESCUE AND DISTRESS

Salvage, Lifeboat, Coastguard, etc.

SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)

Fresh water.
(with method of delivery and rate of
supply)

Provisions.

SERVICES
Medical.

Ship Sanitation.

Garbage and slops.

Ship chandlery, tank cleaning, compass

adjustment, hull painting.

COMMUNICATIONS
Nearest airport or airfield.

Port radio and information service. (with

frequencies and hours of operating)

PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.

VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.

ADDITIONAL DETAILS

NOTES:

1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.

2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
 HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
 HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.

2. Objective of GNSS Data Collection

The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.

It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.

It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.

3. Details required

a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.

b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).

c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.

d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
 Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services

For emergency information affecting safety of life at sea forward to: navwarnings@ukho.gov.uk
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@ukho.gov.uk
This form H.102 and instructions are available online: admiralty.co.uk/msi

Date Ref. number

Name of ship or sender IMO number
Address and general locality

E-mail / Tel / Fax of sender

Subject

Position
Latitude Longitude
(see Instruction 2)

GPS Datum Accuracy

ADMIRALTY Charts affected Edition

Latest Weekly Edition of

Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected

Latest update disk applied Week:

Make, model and or age of ECDIS if

applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:

Name of observer / reporter

H.102A submitted Yes No H.102B submitted Yes No

Tick box if not willing to be named as source of this information

Alternatively use our H-Note App located here:

admiralty.co.uk/H-note