27wknm20 Week27 2020

Notices
3241 -- 3334/20
T & P Notices in Force
ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 27
02 July 2020
(Published on the ADMIRALTY website 22 June 2020)
CONTENTS
I Explanatory Notes. Publications List

II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services
For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: navwarnings@ukho.gov.uk
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@ukho.gov.uk
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@ukho.gov.uk
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2020. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
intellectual.property@ukho.gov.uk
I
GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS

ON THE UKHO WEBSITE
The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
admiralty.co.uk/msi or the searchable NM Website www.ukho.gov.uk/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.
NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.
Software required:
Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website (www.adobe.com).
SEARCHABLE NOTICES TO MARINERS
Enter the www.ukho.gov.uk/nmwebsearch website and select the search option that you require
following the on screen instructions:
Search NMs by - Chart Number only

Search NMs by - Chart Number + Previous NM Number/Year
Search NMs by - Chart Number + Between Previous and Present Dates
Search for Single NM by NM Number/Year
To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.
NOTICES TO MARINERS ON-LINE
Enter the admiralty.co.uk/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List
FURTHER GUIDANCE NOTES
For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
File content and description
PC and printer specifications
CUSTOMER SERVICE
If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:
Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: customerservices@ukho.gov.uk
Our Singapore team can also be contacted outside of UK hours on:

Tel: +65 6424 4200
Wk27/20 1.2
,
ADMIRALTY NOTICES TO MARINERS

7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10% LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH8.+27KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ 5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\
:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN13
IRUIXUWKHUGHWDLOV
7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV
Planning for the future

Plan with ADMIRALTY Maritime Data Solutions, brought to you by the United Kingdom Hydrographic Office.
Admiralty Way, Taunton, Somerset

TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
customerservices@ukho.gov.uk
gov.uk/ukho
Find out more about our market-leading

ADMIRALTY Maritime Data Solutions:
admiralty.co.uk
and are trademarks of the Secretary of State for Defence
© Crown Copyright 2020. All rights reserved. Correct at the time of publishing.
Wk27/20
I
EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as
this is held in greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon
information will be removed from new editions of each Sailing Direction volume, and AIS and Racon information present in
existing Sailing Direction volumes will no longer be updated. For accurate, up-to-date information on AIS and Racons, refer
to ADMIRALTY Radio Signals publications.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.
Wk27/20 1.4
,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJLQ6HFWLRQ9,WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13 $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN13JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13 $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
aWKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
bWKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQVXFKDVDQHZK\GURJUDSKLFVXUYH\LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN137KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO$'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1&YHUVLRQVRIFKDUWV
Wk27/20
I
[27/20]
ADMIRALTY Charts affected by the Publication List
ADMIRALTY Charts International Charts
152 INT 11
598 INT 12
1066 INT 13
1892 INT 14
2449 INT 24
2470 INT 73
2638 INT 1549
2797 INT 1741
3102 INT 2876
3200
3596 ADMIRALTY Publications
3730
4011 NP 18
4012 e-NP 18
4013 NP 131
4014
4024
4073
4212
4213
4906
X 894
X 1402
X 2107
X 2108
X 2115
X 2589
X 2594
COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE REQUIREMENTS,

PILOTAGE, VTS, REPORTING, RADIO COMMUNICATIONS AND TRANSMISSIONS
An increasing number of ports are introducing specific quarantine reporting requirements with regards to
this virus. Its continued spread is also impacting a number of other services covered by Admiralty List of
Radio Signals products. Due to the ongoing and dynamic nature of the situation, mariners should contact
the appropriate Port Authority, VTS, Pilot, coastguard, radio station or other designated body covering
their planned route and destination, for the latest advice and procedures. Due to the rapidly changing
situation, it is advised to check local situation at the earliest opportunity when passage planning.
WMO SURVEY
The World Meteorological Organization is conducting a survey regarding the World-Wide

Meteorological Information and Warning Service available at: WWW.JCOMM.INFO/MMMS
Your participation is GREATLY appreciated and VALUED.
 denotes chart available in the ADMIRALTY Raster Chart Service series.
Wk27/20 1.6
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS
New Editions of ADMIRALTY Charts published 02 July 2020
Chart Title, limits and other remarks Scale Folio 2020 Catalogue
page
152 International Chart Series, England - East Coast, River Tyne to River Tees. 1:75,000 7 26
INT 1549
Includes changes to depths from the latest British Government Surveys.
Note: This chart remains affected by Notice 1210(T)/20. This chart is to be

deleted from the list of charts affected by Notice 4447(P)/19.
598 Brazil - East Coast, Porto de Vitória and Porto de Tubarão. 1:15,000 95 118, 120
Porto de Vitória. 1:7,500
Includes significant safety-related information as follows: new piers and

dolphins and changes to coastline, depths and buoyage.
Note: This chart is to be deleted from the list of charts affected by Notice
3183(P)/20.
2449 North Sea , Dover Strait to Westerschelde. 1:150,000 9 24
Includes significant safety-related information as follows: new windfarms,

platform, submarine cable and changes to depths and wrecks.
Note: This chart remains affected by Notices 428(P)/19, 2320(T)/19,

2927(P)/19 and 2854(T)/20. This chart is to be deleted from the list of charts
affected by Notices 242(T)/19, 2973(P)/20 and 3093(P)/20.
2638 Indonesia, Ports and Approaches in Sulawesi. 58 72, 74

A Selat Bangka and Selat Lembeh. 1:200,000
B Bitung. 1:30,000
C Teluk Parepare. 1:50,000
D Teluk Palu. 1:200,000
E Pantoloan. 1:25,000
F Makassar. 1:25,000
Includes significant safety-related information as follows: changes to depths,

coastline, lights, beacons and buoyage.
Note: On publication of this New Edition former Notice 2720(P)/20 is

cancelled. This chart remains affected by Notice 5227(T)/18.
1.7 Wk27/20
I
New Editions of ADMIRALTY Charts published 02 July 2020 (continued)
Chart Title, limits and other remarks Scale Folio 2020 Catalogue
page
3102 International Chart Series, Africa - West Coast, Ghana, Takoradi and 1:15,000 34 52
INT 2876 Sekondi Bays.
Includes significant safety-related information as follows: changes to

coastline, breakwaters, lights, depths and works in progress. Panels A and B
have been cancelled.
Note: On publication of this New Edition former Notice 4467(P)/19 is

cancelled.
4011 International Chart Series, North Atlantic Ocean, Northern Part. 1:10,000,000 19 16, 134
INT 11
Includes updated lines of equal magnetic variation for 2020.
Note: This chart remains affected by Notices 1728(T)/20, 2756(T)/20 and

2912(T)/20.
4012 International Chart Series, North Atlantic Ocean, Southern Part. 1:10,000,000 19 16
INT 12
Note: This chart remains affected by Notice 5962(T)/19.
4013 International Chart Series, North Atlantic Ocean, Western Part. 1:10,000,000 82 16, 134
INT 13
Note: This chart remains affected by Notices 5962(T)/19 and 2756(T)/20.
4014 International Chart Series, North Atlantic Ocean, Eastern Part. 1:10,000,000 19 16, 134
INT 14
Note: This chart remains affected by Notices 1728(T)/20 and 2912(T)/20.
4073 International Chart Series, Indian Ocean, Eastern Part. 1:10,000,000 42 16, 136
INT 73
Note: This chart remains affected by Notice 2821(T)/20.
Wk27/20 1.8
I
ADMIRALTY Publications
NP No. Title and other remarks Date Remarks
NP18 & ADMIRALTY Sailing Directions, Baltic Pilot Volume I 02/07/2020 Updated to Week 12/20 (19/03/20) First
e-NP18 Nineteenth Edition. updates in NM week 27/20. This edition
supersedes NP18 (Eighteenth Edition
ISBN Number: 978-0-70-774-5718 2018) which is cancelled.
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED
ADMIRALTY CHARTS TO BE PUBLISHED 16 JULY 2020
New Editions of ADMIRALTY Charts

Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio
1066 Indonesia, Java Sea. 1:800,000 1066 60
Includes significant safety-related information as follows: new

submarine cables.
1892 International Chart Series, English Channel, Dover Strait, Western 1:75,000 1892 1
INT 1741 Part. INT 1741
Includes changes to depths from the latest British Government

Surveys.
2470 Indonesia and Malaysia, Singapore Strait to Selat Sunda including 1:1,500,000 2470 46
Java Sea.

submarine cables.
2797 Indonesia, Jakarta to Semarang. 1:500,000 2797 60

submarine cables.
3200 Southern Ocean, Falkland Islands to South Sandwich Islands and 1:3,750,000 3200 96
Graham Land.
3596 South Atlantic Ocean, Approaches to South Georgia. 1:750,000 3596 96
1.9 Wk27/20
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED
ADMIRALTY CHARTS TO BE PUBLISHED 16 JULY 2020
New Editions of ADMIRALTY Charts (continued)

Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio
3730 Indonesia, Jawa - North Coast, Cirebon to Semarang. 1:250,000 3730 60

submarine cables.
4024 International Chart Series, Southern Ocean, Weddell Sea to Mar 1:10,000,000 4024 96
INT 24 del Plata. INT 24
Includes updated line of equal magnetic variation for 2020.
4212 Southern Ocean, Drake Passage. 1:3,500,000 4212 96
4213 South Atlantic and Southern Oceans, Scotia Sea. 1:3,500,000 4213 96
Includes updated lines of equal magnetic variation 2020.
4906 International Chart Series, Antarctica, Weddell Sea. 1:2,000,000 4906 100
INT 906 INT 906
Includes updated lines of equal magnetic variation 2020.
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN
ADMIRALTY Charts
Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition
152 International Chart Series, England - East Coast, River Tyne to River Tees. 152
INT 1549 INT 1549
598 Brazil - East Coast, Porto de Vitória and Porto de Tubarão. 598
2449 North Sea , Dover Strait to Westerschelde. 2449
2638 Indonesia, Ports and Approaches in Sulawesi. 2638
3102 International Chart Series, Africa - West Coast, Ghana, Takoradi and Sekondi 3102
INT 2876 Bays. INT 2876
4011 International Chart Series, North Atlantic Ocean, Northern Part. 4011
INT 11 INT 11
Wk27/20 1.10
I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN
ADMIRALTY Charts (continued)
Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition
4012 International Chart Series, North Atlantic Ocean, Southern Part. 4012
INT 12 INT 12
4013 International Chart Series, North Atlantic Ocean, Western Part. 4013
INT 13 INT 13
4014 International Chart Series, North Atlantic Ocean, Eastern Part. 4014
INT 14 INT 14
4073 International Chart Series, Indian Ocean, Eastern Part. 4073

INT 73 INT 73
ADMIRALTY CHARTS INDEPENDENTLY WITHDRAWN
ADMIRALTY Charts
Chart to be Date of
WITHDRAWN Main Title withdrawal
X894 Denmark – Kattegat, Ålborg Bugt. 01 July 2020
Note: On withdrawal of this chart former Notices 2421(P)/20 and

3170(T)/20 are cancelled. This chart is to be deleted from the list of charts
affected by Notices 747(T)/19, 648(P)/20 and 1138(T)/20.
X1402 International Chart Series, Skagerrak. 01 July 2020

INT 1300
Note: This chart is to be deleted from the list of charts affected by Notices
3321(P)/19, 442(P)/20, 648(P)/20 and 1332(T)/20.
X2107 Entrance to the Baltic, Kattegat, Northern Part. 01 July 2020
Note: On withdrawal of this chart former Notices 2577(T)/20, 3098(P)/20

and 3170(T)/20 are cancelled. This chart is to be deleted from the list of
charts affected by Notice 648(P)/20.
X2108 Entrance to the Baltic, Kattegat, Southern Part. 01 July 2020
Note: On withdrawal of this chart former Notices 2782(T)/20, 2919(P)/20,

3098(P)/20, 3130(T)/20 and 3137(T)/20 are cancelled. This chart is to be
deleted from the list of charts affected by Notices 648(P)/20 and
1138(T)/20.
1.11 Wk27/20
I
ADMIRALTY CHARTS INDEPENDENTLY WITHDRAWN
ADMIRALTY Charts (continued)
Chart to be Date of
WITHDRAWN Main Title withdrawal
X2115 Entrance to the Baltic, The Sound. 01 July 2020
Note: This chart is to be deleted from the list of charts affected by Notices
729(T)/19, 648(P)/20, 916(P)/20 and 2860(T)/20.
X2589 International Chart Series, Denmark – Kattegat, Samsø Bælt. 01 July 2020
INT 1379
Note: On withdrawal of this chart former Notices 2919(P)/20 and
3137(T)/20 are cancelled. This chart is to be deleted from the list of charts
affected by Notice 648(P)/20.
X2594 International Chart Series, Entrance to the Baltic, The Sound, Northern 01 July 2020
INT 1331 Part.
Note: On withdrawal of this chart former Notice 2989(T)/20 is cancelled.

This chart is to be deleted from the list of charts affected by Notices
648(P)/20, 839(P)/20 and 2860(T)/20.
ADMIRALTY CHART AGENT / DISTRIBUTOR INFORMATION
NP131 - Catalogue of ADMIRALTY Charts (NP131), 2020 Edition

Amendments to Part 1, ADMIRALTY Authorised Chart Agents / Distributors
Page 6, Distributor Section,
Amend:
OneOcean (Antibes)
30 Avenue General Maiziere
Leclerc, Antibes
06600
T: +33 49 704 7122
antibes@oneocean.com
www.oneocean.com
IACA, Paper, Digital
This is an amendment to a current listing.
Wk27/20 1.12
I

Amendments to Part 1, ADMIRALTY Authorised Chart Agents / Distributors (continued)
Amend:
OneOcean (Canada) Inc

555 rene-Levesque Blvd West
Suite 1600, Montreal
Quebec, H2Z 1B1
T: +1 514 866 8342
F: +1 514 866 9050
sales@marinepress.com
www.oneocean.com
IACA, Paper, Digital, POD
Amend:
e-Marine Co., Ltd

#209, 44 Achasan-ro
78-gil, Gwangjin-gu
Seoul, 04969
T: +82 (0) 70 7204 9344
F: +82 (0) 22 266 9666
peter-kim@emarine.kr
www.emarine.co.kr
Digital
Amend:
OneOcean Group Limited

Unit 4, Voltage
6 Mollison Avenue
Enfield
EN3 7XQ
T: +44 (0) 1992 805400
F: +44 (0) 1992 805410
enquiries@oneocean.com
www.oneocean.com
1.13 Wk27/20
I

Amend:
OneOcean (Nederland) BV
Parmentierplein 20
Rotterdam, 3088 GN
T: +31 104 167 622
F: +31 104 167 218
netherlands@oneocean.com
www.oneocean.com
Amend:
OneOcean (Singapore)
896 Dunearn Road #03-05
Sime Darby Centre
589472
T: +65 6545 9880
F: +65 6546 8892
singapore@oneocean.com
www.oneocean.com
Amend:
OneOcean (Southampton) Superyacht

Digital House, Kemps Quay Industrial Park
Quayside Road
Southampton, SO18 1AD
T: +44 (0) 2380 714300
F: +44 (0) 2380 714345
southampton@oneocean.com
www.oneocean.com
Wk27/20 1.14
I

Page 8, Sub-Distributor Section,
Insert:
Ambex Limited
SUB DISTRIBUTOR OF: NAVICO
NORWAY AS
The Mews, 11 North Road
Lancing
West Sussex
BN15 9AH
T: +44 (0) 1903 765123
F: +44 (0) 1903 765456
sales@ambex-marine.com
www.ambex-marine.com
Digital
1.15 Wk27/20
IA
TEMPORARY AND PRELIMINARY NOTICES
In Force 26 June 2020
(Former In Force List dated 22 May 2020 is cancelled)
Cancelled Notices
Area Notice No.

2 1526(T)/18, 189(T)/20, 417(T)/20, 1104(T)/20, 1116(T)/20, 1796(P)/20, 2449(P)/20, 2983(P)/20, 2996(P)/20
3 2781(T)/19, 4480(T)/19, 2486(T)/20
4 2500(P)/19, 4403(T)/19, 6327(T)/19, 780(T)/20, 827(T)/20, 1115(T)/20, 1331(T)/20, 1359(T)/20, 1557(T)/20,
1859(T)/20, 2295(P)/20, 2378(T)/20, 2421(P)/20, 2577(T)/20, 2583(T)/20, 2584(T)/20, 2622(P)/20, 2662(T)/20,
2782(T)/20, 2919(P)/20, 2989(T)/20, 3098(P)/20, 3130(T)/20, 3137(T)/20, 3170(T)/20
5 3989(P)/19, 5564(T)/19, 1046(T)/20, 1319(T)/20, 1590(T)/20, 2226(T)/20, 2317(P)/20, 2562(T)/20, 2578(P)/20
6 4236(T)/18, 932(T)/20, 1349(T)/20, 1586(T)/20
8 2428(P)/18, 2563(P)/18, 2806(P)/18, 2547(P)/19, 1606(P)/20, 1920(P)/20
9 4467(P)/19
11 3160(P)/20
12 2879(T)/19, 2355(T)/20
13 2616(P)/19
14 4505(P)/19, 4670(T)/19, 1090(T)/20, 1597(P)/20, 1599(P)/20, 1603(P)/20, 1934(P)/20, 2119(P)/20, 2381(T)/20,
2603(P)/20, 2614(T)/20, 2644(P)/20, 2660(T)/20
15 5200(T)/12, 4806(T)/14, 4498(T)/19, 5504(T)/19, 6611(T)/19, 6616(P)/19, 1647(P)/20, 1783(T)/20, 2408(P)/20,
2591(P)/20, 2593(P)/20, 2702(P)/20, 2942(P)/20, 2943(P)/20, 2947(P)/20
17 2204(P)/19, 2079(P)/20, 2240(P)/20, 2720(P)/20, 2859(P)/20
18 4545(T)/19, 5397(T)/19, 6475(P)/19, 1019(T)/20, 1191(T)/20, 1200(T)/20, 2291(T)/20, 2686(T)/20, 2693(T)/20,
2903(T)/20, 3163(T)/20
19 784(T)/20
20 2493(P)/20, 2704(T)/20
24 2608(P)/19, 5946(P)/19, 2760(P)/20
25 1800(P)/16, 2034(P)/20, 2765(P)/20, 2904(P)/20
No. of No- Charts affected Locality & Subject Folio(s)

tice
2. BRITISH ISLES
397(T)/14 2792 ...................... IRELAND, West Coast: Light-beacons; Pontoon.............................................. 4
2521(P)/15 Q 6403, Q 6404...... SCOTLAND, West Coast: Firing practice area ................................................. 350
5506(P)/15 8064 ...................... ENGLAND, East Coast: Note............................................................................ 7
3304(P)/16 Q 6403, Q 6404...... SCOTLAND, West Coast: Military practice areas ............................................ 350
5111(P)/16 8156 ...................... ENGLAND, East Coast: Landmark................................................................... 8
5769(P)/16 8264 ...................... WALES, South Coast: Note ............................................................................... 2
5838(P)/16 8264 ...................... WALES, South Coast: General information ...................................................... 2
5959(P)/16 8264 ...................... WALES, South Coast: Dredged area ................................................................. 2
6113(P)/16 8197 ...................... ENGLAND, South West Coast: Note ................................................................ 1
1178(P)/17 8123 ...................... SCOTLAND, East Coast: Harbour limit; Legends............................................ 6
1282(P)/17 8276 ...................... SCOTLAND, East Coast: Note.......................................................................... 6
1986(P)/17 8263 ...................... WALES, South Coast: Note ............................................................................... 2
2066(P)/17 8263 ...................... WALES, South Coast: Light .............................................................................. 2
2885(P)/17 8123 ...................... SCOTLAND, East Coast: Restricted area; Legends.......................................... 6
3748(P)/17 8271 ...................... SCOTLAND, Shetland Islands: Note ................................................................ 6
4638(P)/17 8001 ...................... ENGLAND, East Coast: Jetty; Legend.............................................................. 7
4820(P)/17 8271 ...................... SCOTLAND, Shetland Islands: Legends .......................................................... 6
1A.1
Wk27/20
IA
2. BRITISH ISLES - continued
4997(P)/17 8197 ...................... ENGLAND, South West Coast: Note ................................................................ 1
5048(P)/17 8156 ...................... ENGLAND, East Coast: Landmarks ................................................................. 8
5569(P)/17 8276 ...................... SCOTLAND, East Coast: Light......................................................................... 6
581(P)/18 8276 ...................... SCOTLAND, East Coast: Pilot boarding place ................................................. 6
1791(P)/18 2789, 2790 ........... IRELAND, West Coast: Works; Buoyage; Lights; Spoil ground ...................... 4
3771(P)/18 871, 1902 ............. ENGLAND, South Coast: Works....................................................................... 1
3869(P)/18 8156 ...................... ENGLAND, East Coast: Jetty; Berth................................................................. 8
4059(P)/18 8067 ...................... IRELAND, East Coast: Note ............................................................................. 3
4499(T)/18 1121, 1826, 1951, ENGLAND, West Coast: Light-float; Buoy ...................................................... 3
1978, 1981 ...........
503(P)/19 8290 ...................... SCOTLAND, East Coast: Lights ....................................................................... 7
614(T)/19 1447 ...................... IRELAND, East Coast: Buoyage ....................................................................... 3
647(P)/19 8264 ...................... WALES, South Coast: Buoyage......................................................................... 2
1358(P)/19 8290 ...................... SCOTLAND, East Coast: Legend ..................................................................... 7
1379(P)/19 8263 ...................... WALES, South Coast: Light .............................................................................. 2
1546(T)/19 1889, 1890 ........... SCOTLAND, East Coast: Buoy......................................................................... 6
1604(T)/19 1464 ...................... WALES, North Coast: Depths............................................................................ 3
2189(P)/19 8045 ...................... ENGLAND, East Coast: Pilot boarding place; Legend ..................................... 7
2347(P)/19 266, 1408, 1503, ENGLAND, East Coast: Wells; Works .............................................................. 7, 9
1504, 1631, 2182A,
2182B....................
2349(P)/19 2480, 2498, 2528 SCOTLAND, West Coast: Depths ..................................................................... 5
2614(P)/19 8120 ...................... ENGLAND, Bristol Channel: Reported anchorage ........................................... 2
2688(T)/19 536 ........................ ENGLAND, South Coast: Wreck ...................................................................... 1
2758(T)/19 1835, 2482 ........... ENGLAND, East Coast: Works ......................................................................... 8
2900(T)/19 106, 1503, 1504 .. ENGLAND, East Coast: Offshore installation; Works ...................................... 7
3060(T)/19 1161....................... WALES, South Coast: Pier ................................................................................ 2
3426(T)/19 2474 ...................... SCOTLAND, West Coast: Pier; Works.............................................................. 5
3554(T)/19 2 ............................ CELTIC SEA, Irish Sector: Scientific instruments ............................................ 6
3605(T)/19 1752 ...................... IRELAND, East Coast: Works; Pier .................................................................. 3
4196(P)/19 8095 ...................... IRELAND, East Coast: Maintained channel ..................................................... 3
4251(P)/19 807, 808, 1136, ENGLISH CHANNEL: Submarine power cable; Works .................................. 1, 16
2669, 2675, 3140,
3654, 3655 ...........
4297(T)/19 2388 ...................... SCOTLAND, West Coast: Scientific instruments ............................................. 5
4447(P)/19 44, 267, 268, 1191, IRISH SEA: Works; Submarine cables .............................................................. 3, 7, 9
1192, 1422, 1468,
1826, 1981, 2093,
2094, 2182A,
2182B, 2696, 4140,
DE 50 .....................
4529(P)/19 2037 ...................... ENGLAND, South Coast: Wreck ...................................................................... 1
5024(P)/19 8279, 8280 ........... SCOTLAND, Firth of Clyde: Radio reporting point ......................................... 2, 3
5322(T)/19 1994 ...................... SCOTLAND, West Coast: Works; Buoyage...................................................... 3
5426(T)/19 3275 ...................... WALES, South Coast: Works; Buoy.................................................................. 2
5458(P)/19 1535 ...................... ENGLAND, East Coast: Depths ........................................................................ 7
5544(T)/19 2022 ...................... ENGLAND, South Coast: Works; Lights .......................................................... 1
5600(T)/19 1320, 2094, 2696 ISLE OF MAN: Beacon..................................................................................... 3
5730(P)/19 2905 ...................... SCOTLAND, West Coast: Works; Pontoons; Dredging area; Reclamation area 5
5785(P)/19 2702, 2725, 2767, IRELAND, West Coast: Works; Spoil ground ................................................... 4
2792 ......................
5788(P)/19 8095 ...................... IRELAND, East Coast: Notes............................................................................ 3
5832(P)/19 8095 ...................... IRELAND, East Coast: Works; Jetty; Lights; RoRo; Reclamation area; Berth; 3
Dredging area .....................................................................................................
6028(P)/19 2793 ...................... ENGLAND, South Coast: Depths; Works; Pontoons ........................................ 1
1A.2
Wk27/20
IA
6271(P)/19 2625, 2628, 2629, ENGLAND, South Coast: Maintained channels; Dredged areas; Depths; 1
2631 ...................... Works; Jetty........................................................................................................
6428(T)/19 1188, 3496, 3497. ENGLAND, East Coast: Buoy........................................................................... 7
6596(T)/19 1463, 1977 ........... WALES, North Coast: Measuring instrument; Buoy......................................... 3
69(T)/20 2793 ...................... ENGLAND, South Coast: Buoy ........................................................................ 1
88(T)/20 442, 1267, 1613, ENGLAND, South Coast: Buoyage................................................................... 1
1900, 2655, 2656,
2675 ......................
97(T)/20 3273, 3274 ........... WALES, South Coast: Buoy .............................................................................. 2
115(T)/20 1951, 1978, 1981 ENGLAND, West Coast: Buoy.......................................................................... 3
197(T)/20 1752, 1753 ........... IRELAND, East Coast: Depths; Maintained channels ...................................... 3
373(T)/20 1901, 1967 ........... ENGLAND, South Coast: Works; Vertical clearance; Bridge ........................... 1
413(T)/20 1410, 1411, 1468, IRELAND, East Coast: Scientific instruments; Buoyage.................................. 3
1787 ......................
418(T)/20 1777 ...................... IRELAND, South Coast: Works ........................................................................ 2
445(P)/20 1125, 2420, 2667, IRELAND, West Coast: Submarine cable ......................................................... 4
2704, 2725 ...........
620(P)/20 8269 ...................... IRELAND, North Coast: Lights; Buoy; Light-beacons..................................... 3
657(T)/20 175, 190 ............... SCOTLAND, East Coast: Scientific instrument ................................................ 6, 7
778(T)/20 1183, 1975, 3741, ENGLAND, East Coast: Measuring instruments............................................... 7
3750 ......................
825(T)/20 1994, 2000 ........... SCOTLAND, West Coast: Pier .......................................................................... 3
879(T)/20 1491, 2693 ........... ENGLAND, East Coast: Measuring instruments; Buoyage .............................. 7
977(P)/20 1866, 2126, 2220 SCOTLAND, West Coast: Depths ..................................................................... 3
1210(T)/20 152, 156 ............... ENGLAND, East Coast: Buoyage ..................................................................... 7
1410(T)/20 26, 1613, 3315 .... ENGLAND, South Coast: Foul.......................................................................... 1
1485(T)/20 1934 ...................... ENGLAND, East Coast: Works ......................................................................... 7
1569(P)/20 8280 ...................... SCOTLAND, Firth of Clyde: Note .................................................................... 3
1620(P)/20 1606, 1607 ........... ENGLAND, East Coast: Depths; Drying heights .............................................. 8
1629(P)/20 2825 ...................... SCOTLAND, Hebrides: Works.......................................................................... 5
1651(P)/20 2209, 2480, 2498, SCOTLAND, West Coast: Depths; Drying height............................................. 5
2528, 2534, 2540
1667(T)/20 1413, 2011............ WALES, North Coast: Wrecks ........................................................................... 3
1684(P)/20 2011....................... WALES, North Coast: Light; Obstructions; Buoy; Works................................. 3
1728(T)/20 2, 1127, 4010, IRELAND, West Coast: Buoy............................................................................ 5, 6, 15,19
4011, 4014, 4102.
1755(T)/20 741 ........................ SCOTLAND, East Coast: Wreck....................................................................... 6
1765(T)/20 1942, 1954, 2249, SCOTLAND, Orkney Islands: Moored storage tanker; Lights; Restricted area; 6
2250, 2562, 2584 Automatic Identification System........................................................................
1766(P)/20 107, 121, 1190..... ENGLAND, East Coast: Works ......................................................................... 7
1872(T)/20 2210 ...................... SCOTLAND, West Coast: Scientific instruments; Buoyage ............................. 5
1878(P)/20 8290 ...................... SCOTLAND, East Coast: Restricted areas ........................................................ 7
1906(T)/20 1975, 3741 ........... ENGLAND, East Coast: Scientific instrument; Buoy ....................................... 7
1908(T)/20 2511, 2811............ IRELAND, North Coast: Scientific instruments; Buoyage ............................... 3
1981(P)/20 2253 ...................... ENGLAND, South Coast: Buoy; Works............................................................ 1
2002(P)/20 8279 ...................... SCOTLAND, Firth of Clyde: Pontoon .............................................................. 2
2286(T)/20 2255, 2268 ........... ENGLAND, South Coast: Works; Spoil ground................................................ 1
2344(T)/20 1151, 1152............ ENGLAND, Bristol Channel: Buoy .................................................................. 2
2456(P)/20 1794, 2209, 2210, SCOTLAND, West Coast: Depths ..................................................................... 5
2479, 2480, 2528
2521(T)/20 104, 107 ............... ENGLAND, East Coast: Buoy........................................................................... 7
2532(T)/20 3496, 3497 ........... ENGLAND, East Coast: Works ......................................................................... 7
2547(T)/20 210, 213, 1409 .... SCOTLAND, East Coast: Buoyage ................................................................... 6
2604(P)/20 1934, 1935 ........... ENGLAND, East Coast: Safe vertical clearance ............................................... 7
2618(P)/20 175, 190, 1407 .... SCOTLAND, East Coast: Works; Buoyage; Restricted area............................. 6, 7
1A.3
Wk27/20
IA
2744(T)/20 2702, 2725, 2767, IRELAND, West Coast: Buoyage ...................................................................... 4
2792 ......................
2834(T)/20 1121, 1411, 1826, WALES, West Coast: Buoy; Automatic Identification System; Restricted area 3
1970, 1977 ...........
2848(P)/20 2290 ...................... ENGLAND, South Coast: Drying heights; Depths; Buoyage; Pontoon; Wreck 1
2854(T)/20 323, 1610, 2449 .. ENGLAND, South East Coast: Buoy ................................................................ 1, 7, 9
2868(P)/20 106, 1503, 1504 .. ENGLAND, East Coast: Depths; Wrecks .......................................................... 7
2917(T)/20 26, 1613, 3315 .... ENGLAND, South Coast: Obstructions ............................................................ 1
2999(T)/20 1185, 3683............ ENGLAND, East Coast: Moorings; Works ....................................................... 8
3053(T)/20 107, 121, 1190..... ENGLAND, East Coast: Works ......................................................................... 7
3056(T)/20 104, 107, 1190..... ENGLAND, East Coast: Buoy........................................................................... 7
3131(T)/20 175, 190, 1407 .... SCOTLAND, East Coast: Scientific instruments; Buoyage .............................. 6, 7
3151(T)/20 104, 107, 1190..... ENGLAND, East Coast: Buoyage ..................................................................... 7
3165(T)/20 2045, 2450 ........... ENGLAND, South Coast: Wreck ...................................................................... 1
3173(T)/20 1320, 1826 ........... ENGLAND, West Coast: Buoyage .................................................................... 3
3219(T)/20 2036, 2038, 2793 ENGLAND, South Coast: Scientific instruments.............................................. 1
3233(P)/20 3746 ...................... SCOTLAND, Firth of Clyde: Works; Lights ..................................................... 3
3310(T)/20 1267, 1613, 1900 ENGLAND, South Coast: Measuring instrument; Buoy ................................... 1
3. NORTH RUSSIA, NORWAY, THE FÆROE ISLANDS AND ICELAND
4644(T)/12 2961 ...................... RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
3446(P)/16 8182 ...................... RUSSIA, Barents Sea Coast: Obstruction ......................................................... 14
3937(P)/16 8182 ...................... RUSSIA, Barents Sea Coast: Floating dock ...................................................... 14
4889(P)/16 8182 ...................... RUSSIA, Barents Sea Coast: Maritime limit; Legend....................................... 14
4973(T)/16 2966, 8182 ........... RUSSIA, Barents Sea Coast: Mooring buoys.................................................... 14
4988(P)/16 8182 ...................... RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
5930(P)/16 8182 ...................... RUSSIA, Barents Sea Coast: Note..................................................................... 14
6550(P)/16 8182 ...................... RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
3336(T)/18 2966 ...................... RUSSIA, Barents Sea Coast: Jetties .................................................................. 14
3433(P)/18 8182 ...................... RUSSIA, Barents Sea Coast: Obstruction; Buoyage; Legends ......................... 14
4351(T)/18 2966, 8182 ........... RUSSIA, Barents Sea Coast: Buoy.................................................................... 14
1031(T)/19 2966 ...................... RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
1959(P)/19 1429, 4101 ........... NORWAY, West Coast: Works; Submarine pipeline; Offshore installation....... 13
3287(T)/19 2683, 4100 ........... NORWAY, North Coast: Measuring instruments ............................................... 14
3863(P)/19 8182 ...................... RUSSIA, Barents Sea Coast: Wreck .................................................................. 14
5360(T)/19 1428, 2182D ........ NORWAY, West Coast: Buoy............................................................................. 13
5402(T)/19 2682, 3137, 4010 NORWEGIAN SEA, Svalbard: Measuring instruments.................................... 14, 15
5403(T)/19 3136, 3137 ........... NORWEGIAN SEA, Svalbard: Measuring instruments.................................... 15
6220(P)/19 3569 ...................... FØROYAR: Depths; Restricted area; Works; Light........................................... 15
134(T)/20 2683, 3136, 3137, NORWEGIAN SEA, Svalbard: Measuring instruments.................................... 14, 15
4010, 4100 ...........
1048(P)/20 8182 ...................... RUSSIA, Barents Sea Coast: Obstruction ......................................................... 14
1157(T)/20 1428, 1429 ........... NORWAY, West Coast: Buoy............................................................................. 13
1697(P)/20 1427, 2182C, NORWAY, West Coast: Works; Submarine pipeline.......................................... 6, 13
2182D ...................
1942(T)/20 2683 ...................... NORWEGIAN SEA, Svalbard: Well ................................................................. 14
2053(T)/20 1429 ...................... NORWAY, West Coast: Light............................................................................. 13
2187(T)/20 1428 ...................... NORWAY, West Coast: Buoy............................................................................. 13
2191(T)/20 1427, 2182D ........ NORWAY, West Coast: Buoy............................................................................. 13
2483(P)/20 2683, 4100 ........... NORWAY, North Coast: Restricted area ............................................................ 14
2774(T)/20 1427, 1428 ........... NORWAY, West Coast: Well.............................................................................. 13
2997(T)/20 1428, 1429 ........... NORWAY, West Coast: Buoy............................................................................. 13
3035(P)/20 1429 ...................... NORWAY, West Coast: Submarine cable........................................................... 13
4. BALTIC SEA AND APPROACHES
3416(P)/15 8026 ...................... GERMANY, Baltic Coast: Note......................................................................... 10
1526(P)/16 8026 ...................... GERMANY, Baltic Coast: Restricted areas....................................................... 10
2306(P)/16 811, 820................ SWEDEN, East Coast: Works; Restricted area; Buoyage ................................. 10
1A.4
Wk27/20
IA
4. BALTIC SEA AND APPROACHES - continued
3607(T)/16 2855, 2856 ........... SWEDEN, South Coast: Depths ........................................................................ 10
4089(P)/16 8026 ...................... GERMANY, Baltic Coast: Maintained channel................................................. 10
4551(P)/16 8174 ...................... DENMARK, East Coast: Leading line; Lights .................................................. 9
4823(P)/16 8196 ...................... DENMARK, East Coast: Alongside depths....................................................... 10
5377(P)/16 8196 ...................... DENMARK, East Coast: Light-beacons............................................................ 10
6306(P)/16 8174 ...................... DENMARK, East Coast: Restricted area; Buoyage; Works.............................. 9
6312(P)/16 8085 ...................... SWEDEN, West Coast: Works........................................................................... 10
248(T)/17 857, 8085 ............. SWEDEN, West Coast: Horizontal clearance; Works ....................................... 10
354(P)/17 8252 ...................... SWEDEN, East Coast: Anchorage area ............................................................. 10
1123(P)/17 8162 ...................... RUSSIA, Baltic Sea Coast: Maritime limit; Legends; Works............................ 11
1679(T)/17 2018, 2054, 2816 SWEDEN, East Coast: Measuring instruments ................................................. 10
3431(T)/17 2048, 2231, 2288 LATVIA: Buoy................................................................................................... 10
3553(P)/17 8267 ...................... GERMANY, Baltic Coast: Berths; Dredged area .............................................. 10
3610(P)/17 8085 ...................... SWEDEN, West Coast: Dredged depths; Channel limits .................................. 10
4165(T)/17 820 ........................ SWEDEN, East Coast: Works; Buoyage ........................................................... 10
4380(P)/17 8267 ...................... GERMANY, Baltic Coast: Buoy........................................................................ 10
4859(T)/17 944 ........................ DENMARK, Islands: Leading line .................................................................... 10
5008(P)/17 8162 ...................... RUSSIA, Baltic Sea Coast: Automatic Identification Systems ......................... 11
5180(P)/17 8059 ...................... RUSSIA, Baltic Sea Coast: Legends ................................................................. 11
5265(P)/17 8028 ...................... ESTONIA: Obstruction...................................................................................... 35
5308(P)/17 831, 832, 881 ...... SWEDEN, East Coast: Depths........................................................................... 10
5344(P)/17 8252 ...................... SWEDEN, East Coast: Reported anchorages .................................................... 10
5538(P)/17 8085, 8086 ........... SWEDEN, West Coast: Note ............................................................................. 10
5763(P)/17 8028 ...................... ESTONIA: Note................................................................................................. 35
5866(P)/17 8059 ...................... RUSSIA, Baltic Sea Coast: Note ....................................................................... 11
5871(P)/17 8059 ...................... RUSSIA, Baltic Sea Coast: Light; Leading line ................................................ 11
48(P)/18 8295 ...................... POLAND: Restricted areas; Submarine pipeline............................................... 10
477(T)/18 3800, 3863 ........... FINLAND, West Coast: Depth .......................................................................... 11
853(P)/18 8058 ...................... RUSSIA, Baltic Sea Coast: Precautionary area ................................................. 11
1724(P)/18 8237 ...................... FINLAND, South Coast: Note ........................................................................... 11
1726(P)/18 8296 ...................... DENMARK, Islands: Dredged areas; Depths.................................................... 10
1767(P)/18 8293 ...................... POLAND: Note.................................................................................................. 10
1785(P)/18 8296 ...................... SWEDEN, West Coast: Note ............................................................................. 10
2409(P)/18 8174 ...................... DENMARK, East Coast: Works; Dredged area; Coastline; Restricted area; 9
Light-beacons; Light; Lights in line...................................................................
2925(P)/18 8252 ...................... SWEDEN, East Coast: Legends ........................................................................ 10
3341(T)/18 902, 8296 ............. DENMARK, Islands: Works; Buoyage.............................................................. 10
3492(P)/18 8237 ...................... FINLAND, South Coast: Breakwater; Legends; Restricted areas; Swept areas 11
4808(T)/18 811......................... SWEDEN, East Coast: Works; Restricted area.................................................. 10
5012(P)/18 8294 ...................... POLAND: Notes ................................................................................................ 10
5112(P)/18 8295 ...................... POLAND: Buoy; Automatic Identification System........................................... 10
5393(T)/18 2292 ...................... LATVIA: Works; Buoyage................................................................................. 10
6072(T)/18 911, 8296.............. SWEDEN, West Coast: Depths; Buoyage ......................................................... 10
333(T)/19 911, 8296.............. SWEDEN, West Coast: Depths.......................................................................... 10
511(P)/19 8252 ...................... SWEDEN, East Coast: Lights; Leading lines .................................................... 10
581(P)/19 8162 ...................... RUSSIA, Baltic Sea Coast: Beacons; Lights; Leading line ............................... 11
729(T)/19 2115, 2945............ GERMANY, Baltic Coast: Restricted area ........................................................ 10
747(T)/19 894 ........................ DENMARK, East Coast: Submarine pipelines; Buoyage ................................. 10
1062(T)/19 2014, 2018, 2816 POLAND: Buoy................................................................................................. 10
1070(T)/19 802 ........................ SWEDEN, East Coast: Works............................................................................ 10
1364(T)/19 2014, 2018, 2040 POLAND: Buoy; Automatic Identification System........................................... 10
1380(P)/19 8293 ...................... POLAND: Obstructions ..................................................................................... 10
1388(T)/19 800 ........................ SWEDEN, East Coast: Restricted area .............................................................. 10
1793(P)/19 8085 ...................... SWEDEN, West Coast: Note ............................................................................. 10
1A.5
Wk27/20
IA
1899(P)/19 2040, 2636, 2688, POLAND: Light................................................................................................. 10
8294, 8295 ...........
2242(P)/19 831 ........................ SWEDEN, East Coast: Submarine cables.......................................................... 10
2348(P)/19 902, 8296 ............. DENMARK, Islands: Dredged depths; Submarine cable .................................. 10
2412(P)/19 8207 ...................... DENMARK, Islands: Channel depth................................................................. 10
2428(P)/19 8296 ...................... DENMARK, Islands: Restricted area ................................................................ 10
2822(T)/19 857, 858, 8085 .... SWEDEN, West Coast: Depths.......................................................................... 10
3158(P)/19 8252 ...................... SWEDEN, East Coast: Alongside depths; Depth; Obstruction ......................... 10
3306(P)/19 8207 ...................... DENMARK, Islands: Coastline; Dredged area ................................................. 10
3389(T)/19 2215 ...................... ESTONIA: Buoy ................................................................................................ 10
3478(P)/19 2856 ...................... SWEDEN, East Coast: Submarine pipeline....................................................... 10
3553(T)/19 2277, 2716, 8100 LATVIA: Works; Piles; Buoyage....................................................................... 10
3619(P)/19 8207 ...................... DENMARK, Islands: Note ................................................................................ 10
3740(T)/19 811, 820................ SWEDEN, East Coast: Restricted area; Bridge; Works; Buoyage .................... 10
4290(T)/19 2264 ...................... RUSSIA, Baltic Sea Coast: Mooring buoys ...................................................... 11
4460(T)/19 875 ........................ SWEDEN, West Coast: Depth; Maximum authorised draught.......................... 10
4675(P)/19 8071 ...................... GERMANY, Nord-Ostsee Kanal: Note ............................................................. 9
5404(T)/19 2596 ...................... DENMARK, Islands: Measuring instruments ................................................... 10
5437(P)/19 8134 ...................... RUSSIA, Baltic Sea Coast: Legends ................................................................. 10
5779(P)/19 8293 ...................... POLAND: Safe vertical clearance ..................................................................... 10
5802(P)/19 8162 ...................... RUSSIA, Baltic Sea Coast: Obstruction ............................................................ 11
5905(T)/19 889, 890 ............... SWEDEN, East Coast: Measuring instruments ................................................. 11
5941(T)/19 902, 8296 ............. DENMARK, Islands: Measuring instruments; Buoyage ................................... 10
6037(P)/19 8026 ...................... GERMANY, Baltic Coast: Note......................................................................... 10
6094(P)/19 8162 ...................... RUSSIA, Baltic Sea Coast: Anchorage area ...................................................... 11
6099(T)/19 2637 ...................... POLAND: Buoyage; Lights; Restricted area ..................................................... 10
6360(P)/19 8207 ...................... DENMARK, Islands: Restricted area ................................................................ 10
6375(T)/19 2018, 2040 ........... POLAND: Buoy................................................................................................. 10
6402(P)/19 798, 2014, 2015, BALTIC SEA: Submarine pipelines .................................................................. 10, 11
2018, 2048, 2054,
2055, 2059, 2073,
2075, 2241, 2248,
2264, 2288, 2816,
2817, 2945, 3818,
3819, 3820 ...........
6569(T)/19 802 ........................ SWEDEN, East Coast: Works; Berths ............................................................... 10
6572(T)/19 811, 820................ SWEDEN, East Coast: Works; Berths ............................................................... 10
6696(P)/19 8071 ...................... GERMANY, Nord-Ostsee Kanal: Light............................................................. 9
309(T)/20 2018, 2040, 2288 POLAND: Measuring instruments; Buoyage .................................................... 10
492(P)/20 931 ........................ DENMARK, Islands: Quay; Dredged areas; Channel; Virtual aids to 10
navigation; Buoyage; Works ..............................................................................
515(P)/20 8296 ...................... DENMARK, Islands: Harbour limits; Legends ................................................. 10
534(T)/20 931 ........................ DENMARK, Islands: Light ............................................................................... 10
569(T)/20 2843 ...................... SWEDEN, East Coast: Depth ............................................................................ 10
648(P)/20 259, 874, 875, 876, DENMARK, East Coast: Traffic separation schemes; Routeing measures; 6, 7, 10
2182B, 2182C, Precautionary areas ............................................................................................
5503 ......................
663(T)/20 2014, 2018, 2040, POLAND: Buoyage ........................................................................................... 10
2288, 2816 ...........
826(T)/20 2014, 2018 ........... POLAND: Measuring instruments..................................................................... 10
839(P)/20 902, 903, 2594, DENMARK, Islands: Submarine cables............................................................ 10
2595 ......................
868(P)/20 2289, 2292 ........... LATVIA: Works; Buoyage................................................................................. 10
916(P)/20 2015, 2115, 2816, DENMARK, Islands: Works; Wind farm; Buoyage .......................................... 10
2945 ......................
917(T)/20 857, 858, 8085 .... SWEDEN, West Coast: Depths.......................................................................... 10
973(T)/20 2018, 2040 ........... POLAND: Buoy................................................................................................. 10
1132(P)/20 8237 ...................... FINLAND, South Coast: Swept area; Breakwater; Light.................................. 11
1A.6
Wk27/20
IA
1138(T)/20 894, 2108 ............. DENMARK, East Coast: Buoy.......................................................................... 10
1150(T)/20 2359 ...................... GERMANY, Baltic Coast: Works ...................................................................... 10
1264(T)/20 2248 ...................... ESTONIA: Restricted area................................................................................. 11
1289(P)/20 8296 ...................... DENMARK, Islands: Depths............................................................................. 10
1290(P)/20 8293, 8295 ........... POLAND: Routeing measures; Maritime limit; Dredged depth........................ 10
1333(T)/20 857, 8085 ............. SWEDEN, West Coast: Works........................................................................... 10
1436(P)/20 940, 2583 ............. DENMARK, Islands: Bridge; Channels; Buoyage; Restricted areas ................ 10
1763(P)/20 888 ........................ SWEDEN, East Coast: Works............................................................................ 10
1839(T)/20 2276 ...................... LITHUANIA: Buoy ........................................................................................... 10
1843(P)/20 2276 ...................... LITHUANIA: Depths; Maintained channels; Works; Submarine pipeline ....... 10
1897(T)/20 938, 2106, 2596 .. DENMARK, Islands: Works.............................................................................. 10
1944(T)/20 902 ........................ DENMARK, Islands: Depths............................................................................. 10
1959(T)/20 857, 8085 ............. SWEDEN, West Coast: Maximum authorised draught...................................... 10
2051(T)/20 2014, 2018 ........... POLAND: Buoy; Automatic Identification System........................................... 10
2093(P)/20 8085 ...................... SWEDEN, West Coast: Notes............................................................................ 10
2143(T)/20 925 ........................ SWEDEN, East Coast: Works; Harbour developments; Obstructions; Buoyage 11
2154(P)/20 8085 ...................... SWEDEN, West Coast: Swept area ................................................................... 10
2220(T)/20 2843 ...................... SWEDEN, East Coast: Depth; Buoyage ............................................................ 10
2285(T)/20 2014, 2015, 2018, POLAND: Measuring instruments..................................................................... 10
2040, 2288, 2679,
2688, 8295 ...........
2316(T)/20 2612 ...................... FINLAND, West Coast: Fairways; Swept areas; Buoyage; Recommended 11
tracks ..................................................................................................................
2335(T)/20 919 ........................ GERMANY, Baltic Coast: Pontoons ................................................................. 10
2374(T)/20 2276 ...................... LITHUANIA: Works ......................................................................................... 10
2411(T)/20 798, 2048, 2054, SWEDEN, East Coast: Buoyage........................................................................ 10
2055, 2816, 2817
2430(P)/20 8252 ...................... SWEDEN, East Coast: Pilot boarding places .................................................... 10
2495(T)/20 810 ........................ SWEDEN, East Coast: Works; Bridges; Buoyage............................................. 10
2499(T)/20 2855 ...................... SWEDEN, South Coast: Quay; Buoyage; Works .............................................. 10
2501(T)/20 911......................... SWEDEN, West Coast: Works........................................................................... 10
2502(P)/20 845 ........................ SWEDEN, East Coast: Works; Lights; Floodlights ........................................... 10
2602(T)/20 2098, 3864 ........... FINLAND, West Coast: Buoyage ...................................................................... 11
2790(T)/20 2040, 2288 ........... LITHUANIA: Works ......................................................................................... 10
2793(T)/20 2276 ...................... LITHUANIA: Measuring instrument ................................................................ 10
2815(T)/20 2677 ...................... POLAND: Submarine pipelines; Buoyage; Restricted areas............................. 10
2825(T)/20 2227, 2241, 2248 ESTONIA: Restricted area................................................................................. 10, 11
2842(P)/20 837 ........................ SWEDEN, East Coast: Beacons ........................................................................ 10
2860(T)/20 876, 2115, 2594... SWEDEN, West Coast: Works........................................................................... 10
2964(T)/20 2620, 3863 ........... FINLAND, West Coast: Light............................................................................ 11
3010(T)/20 2277, 2716 ........... LATVIA: Buoyage ............................................................................................. 10
3143(P)/20 874 ........................ SWEDEN, West Coast: Buoyage....................................................................... 10
3318(T)/20 2014, 2018, 2040, POLAND: Explosives dumping ground ............................................................ 10
2816 ......................
3329(T)/20 2106, 2117, 2359, GERMANY, Baltic Coast: Buoyage .................................................................. 10
2942, 2944 ...........
5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM
1198(P)/17 8229 ...................... DENMARK, North Sea Coast: Pier; Works ...................................................... 9
1438(P)/17 8089 ...................... GERMANY, North Sea Coast: Floating dock.................................................... 9
1994(P)/17 1632 ...................... NORTH SEA, Netherlands Sector: Submarine pipeline.................................... 9
2552(P)/17 8229 ...................... DENMARK, North Sea Coast: Note; Depth...................................................... 9
5240(P)/17 8229 ...................... DENMARK, North Sea Coast: Spoil grounds................................................... 9
66(P)/18 8011....................... NETHERLANDS: Legend; Maritime limit ....................................................... 9
1256(P)/18 272, 274, 1405, NORTH SEA, Norwegian Sector: Works; Submarine pipeline ......................... 6, 7, 9, 13
1422, 2182B,
2182C....................
1A.7
Wk27/20
IA
BELGIUM - continued
1375(P)/18 8010 ...................... NETHERLANDS: Maritime limits.................................................................... 9
1678(P)/18 8008 ...................... GERMANY, North Sea Coast: Restricted areas ................................................ 9
1766(P)/18 8010 ...................... BELGIUM: Note................................................................................................ 9
2429(P)/18 268, 272, 273, 274, NORTH SEA: Submarine power cable.............................................................. 6, 7, 13
278, 1191, 1192,
1405, 1427, 2182A,
2182B, 2182C,
4140 ......................
2800(P)/18 8231 ...................... NETHERLANDS: Restricted areas ................................................................... 9
3931(P)/18 8097 ...................... NETHERLANDS: Buoy; Automatic Identification System.............................. 9
4360(T)/18 128 ........................ BELGIUM: Moorings ........................................................................................ 9
4715(T)/18 207 ........................ NETHERLANDS: Restricted area; Buoyage; Light-beacon............................. 9
4902(P)/18 8135 ...................... GERMANY, North Sea Coast: Note .................................................................. 9
5349(P)/18 8135 ...................... GERMANY, North Sea Coast: Dredged areas; Legends ................................... 9
242(T)/19 1630, 1872, 1874, BELGIUM: Platform; Automatic Identification System; Restricted area ......... 9
8012 ......................
428(P)/19 110, 1406, 1630, NETHERLANDS: Submarine power cable....................................................... 7, 9
1872, 1874, 2449
785(P)/19 8135 ...................... GERMANY, North Sea Coast: Restricted area.................................................. 9
909(P)/19 8072 ...................... GERMANY, North Sea Coast: Anchorage areas ............................................... 9
1038(P)/19 1408, 1503, 2182A NORTH SEA, United Kingdom Sector: Works; Platform; Obstructions .......... 7
1040(P)/19 8230 ...................... NETHERLANDS: Jetty; Lights......................................................................... 9
1157(T)/19 110, 1872, 1874... NETHERLANDS: Foul; Buoyage..................................................................... 9
1236(P)/19 8072 ...................... GERMANY, North Sea Coast: Radar beacon.................................................... 9
1382(T)/19 128, 8010 ............. BELGIUM: Works ............................................................................................. 9
1516(P)/19 208 ........................ NETHERLANDS: Works; Jetty......................................................................... 9
1648(T)/19 1457 ...................... NETHERLANDS: Pile ...................................................................................... 9
1681(T)/19 128 ........................ BELGIUM: Pontoon .......................................................................................... 9
1684(P)/19 8010 ...................... NETHERLANDS: Buoyage .............................................................................. 9
2005(P)/19 8008 ...................... GERMANY, North Sea Coast: Light; Buoyage................................................. 9
2320(T)/19 323, 1406, 1610, BELGIUM: Wreck; Virtual aid to navigation .................................................... 1, 7, 9
1872, 1873, 2449
2580(T)/19 114......................... BELGIUM: Works ............................................................................................. 9
2666(P)/19 130, 1408, 1630, NETHERLANDS: Submarine pipeline ............................................................. 7, 9
1631 ......................
2741(P)/19 1406, 1630, 8297 BELGIUM: Works; Wind farm; Buoyage.......................................................... 7, 9
2927(P)/19 1406, 1630, 1872, BELGIUM: Works; Wind farm; Buoyage.......................................................... 7, 9
1874, 2449, 8012,
8297 ......................
3321(P)/19 1402, 1422, 2182A, NORTH SEA, Norwegian Sector: Works; Submarine cables............................ 6, 7, 9
2182B, 2182C,
3766, 4140, DE 50,
DE 87, DE 103.......
3353(T)/19 1408, 1632 ........... NETHERLANDS: Measuring instrument ......................................................... 7, 9
3844(P)/19 1632, 2182A, NORTH SEA, Netherlands Sector: Works; Platform......................................... 7, 9
2182B, 4140, DE 50
4084(P)/19 8230 ...................... NETHERLANDS: Buoy.................................................................................... 9
4773(T)/19 274, 278 ............... NORTH SEA, United Kingdom Sector: Buoyage ............................................. 7
5541(T)/19 1546 ...................... NETHERLANDS: Buoy.................................................................................... 9
5829(P)/19 1630, 8012, 8297 NORTH SEA, Netherlands Sector: Precautionary areas; Restricted areas ........ 9
6023(T)/19 110......................... NORTH SEA, Netherlands Sector: Buoy .......................................................... 9
6210(T)/19 1631, 1632, 1633, NETHERLANDS: Traffic separation scheme ................................................... 7, 9
2182A, 2182B,
DE 50, DE 87.........
6214(T)/19 110, 116, 120, NETHERLANDS: Fairways; Restricted areas; Precautionary area; Submarine 9
1872, 1874, 8011, cable ...................................................................................................................
8012 ......................
1A.8
Wk27/20
IA
BELGIUM - continued
40(T)/20 273, 2182B........... NORTH SEA, United Kingdom Sector: Scientific instrument .......................... 7
191(T)/20 126, 1546 ............. NETHERLANDS: Wreck; Buoyage.................................................................. 9
442(P)/20 272, 1402, 1405, NORTH SEA, Norwegian Sector: Submarine cable.......................................... 6, 7, 9, 13
1422, 2182B,
2182C, 4140, DE 50
451(T)/20 128 ........................ BELGIUM: Light; Obstruction; Buoy ............................................................... 9
940(P)/20 8010 ...................... BELGIUM: Notes .............................................................................................. 9
986(P)/20 8097 ...................... NORTH SEA, German Sector: Vessel traffic services....................................... 9
1049(P)/20 1422, 2182A, NETHERLANDS: Submarine power cable....................................................... 7, 9
2182B, 3766,
DE 50, DE 87,
DE 103 ...................
1196(P)/20 122, 125, 130, NETHERLANDS: Works; Wind farm ............................................................... 7, 9
1406, 1408, 1630,
1631, 8231, 8297
1291(P)/20 8069 ...................... GERMANY, North Sea Coast: Channel limits .................................................. 9
1292(P)/20 8070 ...................... GERMANY, North Sea Coast: Channel limits .................................................. 9
1332(T)/20 1402, 1422 ........... DENMARK, North Sea Coast: Wreck............................................................... 9
1671(P)/20 295, 1427, 1428, NORTH SEA, Norwegian Sector: Works; Precautionary area; Submarine 6, 13
2182D ................... cable; Submarine pipeline; Offshore installations .............................................
1688(P)/20 274, 292, 1405, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Offshore 6, 7, 13
1427, 2182C......... installation ..........................................................................................................
1693(T)/20 274, 1405, 2182C NORTH SEA, Norwegian Sector: Buoy............................................................ 6, 7, 13
1713(P)/20 8230 ...................... NETHERLANDS: Restricted area..................................................................... 9
1806(T)/20 207 ........................ NETHERLANDS: Works; Vertical clearance.................................................... 9
1935(T)/20 1872, 1873 ........... BELGIUM: Buoy............................................................................................... 9
2088(P)/20 8015 ...................... NETHERLANDS: Note; Fixed point ................................................................ 9
2090(P)/20 8016 ...................... NETHERLANDS: Notes ................................................................................... 9
2199(P)/20 267, 1422, 2182A, DENMARK, North Sea Coast: Submarine cables; Works................................. 7, 9
2182B, 3766, DE 50
2308(T)/20 1872, 1874 ........... BELGIUM: Buoy............................................................................................... 9
2313(T)/20 1872, 1873, 1874 BELGIUM: Depths ............................................................................................ 9
2333(P)/20 8071 ...................... GERMANY, North Sea Coast: Restricted areas; Anchorage areas; Buoy......... 9
2398(T)/20 267, 1422, DE 50 . NORTH SEA, Danish Sector: Restricted areas.................................................. 7, 9
2606(T)/20 208 ........................ NETHERLANDS: Buoy.................................................................................... 9
2679(T)/20 122, 130 ............... NORTH SEA, Netherlands Sector: Obstructions............................................... 9
2731(P)/20 1187, 1191, 2182A, NORTH SEA, United Kingdom Sector: Works; Restricted area ....................... 7
2182B....................
2739(T)/20 DE 50, DE 87, GERMANY, North Sea Coast: Buoy; Fog signal .............................................. 9
DE 103 ...................
2750(P)/20 8010 ...................... BELGIUM: Note................................................................................................ 9
2767(P)/20 892 ........................ DENMARK, North Sea Coast: Outfall; Restricted area; Buoyage.................... 10
2778(T)/20 295, 1427, 1428 .. NORTH SEA, Norwegian Sector: Well ............................................................. 6, 13
2973(P)/20 110, 1630, 1872, BELGIUM: Wind farm; Restricted area; Submarine power cable; Lights; 9
1874, 8012 ........... Works; Buoyage .................................................................................................
3000(P)/20 274, 292, 1405, NORTH SEA, Norwegian Sector: Works; Precautionary area .......................... 6, 7, 13
2182C....................
3036(T)/20 1427, 2182C, NORTH SEA, Norwegian Sector: Well ............................................................. 6, 13
2182D ...................
3078(T)/20 128, 8010 ............. BELGIUM: Works; Buoyage............................................................................. 9
3084(T)/20 1408, 1632, 1633, NORTH SEA, Netherlands Sector: Obstructions............................................... 7, 9
2182A....................
3085(T)/20 126 ........................ NETHERLANDS: Foul ..................................................................................... 9
3093(P)/20 1630, 8297 ........... BELGIUM: Restricted area; Wind turbines ....................................................... 9
3095(T)/20 1408, 1457, 1632, NETHERLANDS: Traffic separation schemes; Obstructions ........................... 7, 9
1633, DE 50, DE 87,
DE 90 .....................
1A.9
Wk27/20
IA
BELGIUM - continued
3099(T)/20 8097, DE 90, DE 91 GERMANY, North Sea Coast: Less water......................................................... 9
3102(T)/20 110, 266, 1630, NORTH SEA, Netherlands Sector: Measuring instruments; Buoyage .............. 7, 9
1633, DE 90 ..........
3150(T)/20 DE 50 ..................... GERMANY, North Sea Coast: Buoy ................................................................. 9
3228(P)/20 8012 ...................... BELGIUM: Marine Reserves; Restricted areas; Mine laying practice area ...... 9
6. FRANCE AND SPAIN, NORTH AND WEST COASTS, AND PORTUGAL
6155(P)/15 3224 ...................... PORTUGAL, West Coast: Depths; Drying height............................................. 18
2473(P)/16 8136 ...................... FRANCE, North Coast: Maritime limits; Legends; Coastline........................... 16
3270(P)/16 8133 ...................... PORTUGAL, West Coast: Anchorage areas ...................................................... 18
5297(P)/16 8137 ...................... PORTUGAL, West Coast: Coastline; Legends; Maritime limit ........................ 16
61(P)/17 8247 ...................... FRANCE, North Coast: Automatic Identification Systems ............................... 16
1657(P)/17 8136 ...................... FRANCE, North Coast: Note............................................................................. 16
3662(P)/17 8186 ...................... FRANCE, West Coast: Spoil grounds................................................................ 17
3927(P)/17 8136 ...................... FRANCE, North Coast: Spoil ground................................................................ 16
907(P)/18 8136 ...................... FRANCE, North Coast: Obstructions ................................................................ 16
1343(P)/18 8247 ...................... FRANCE, West Coast: Note .............................................................................. 16
1512(T)/18 3220 ...................... PORTUGAL, West Coast: Buoyage .................................................................. 18
1525(T)/18 83 .......................... PORTUGAL, South Coast: Buoy ...................................................................... 18
2079(P)/18 8040 ...................... FRANCE, West Coast: Quay ............................................................................. 17
2083(P)/18 8137 ...................... PORTUGAL, West Coast: Recommended track; Maritime limit ...................... 16
2122(T)/18 83, 89 ................... PORTUGAL, South Coast: Buoyage ................................................................. 18
4626(P)/18 8186 ...................... FRANCE, West Coast: Channel limits; Anchorage area; Note.......................... 17
4937(P)/18 8247 ...................... FRANCE, West Coast: Buoy ............................................................................. 16
5180(P)/18 3258 ...................... PORTUGAL, West Coast: Buoyage; Light-beacons ......................................... 18
5353(P)/18 8163 ...................... FRANCE, North Coast: Light............................................................................ 16
5450(T)/18 2522, 2986 ........... FRANCE, West Coast: Measuring instruments ................................................. 17
5803(T)/18 89, 3636 ............... PORTUGAL, South Coast: Scientific instrument.............................................. 18
5805(P)/18 1764 ...................... SPAIN, West Coast: Depths; Maintained channel; Alongside depths................ 18
5809(T)/18 91, 93 ................... PORTUGAL, South Coast: Wreck..................................................................... 18
5831(T)/18 3634 ...................... PORTUGAL, West Coast: Marine farm............................................................. 18
476(T)/19 3257 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
534(P)/19 8179 ...................... PORTUGAL, West Coast: Lights ...................................................................... 18
1466(P)/19 2819, 2820 ........... FRANCE, West Coast: Depths; Drying height; Rock........................................ 17
1573(T)/19 2148, 2451, 2613 FRANCE, North Coast: Buoy; Automatic Identification System...................... 1, 16
3974(T)/19 3220, 3221 ........... PORTUGAL, West Coast: Depths ..................................................................... 18
4331(P)/19 2350, 2356 ........... FRANCE, West Coast: Depths; Rock; Drying height........................................ 16
5898(T)/19 83 .......................... PORTUGAL, South Coast: Depth ..................................................................... 18
5900(T)/19 3259, 3260 ........... PORTUGAL, West Coast: Buoyage .................................................................. 18
6434(T)/19 83 .......................... PORTUGAL, South Coast: Depths.................................................................... 18
421(T)/20 2148, 2451 ........... FRANCE, North Coast: Wreck; Restricted area ................................................ 1, 16
924(P)/20 8247 ...................... FRANCE, West Coast: Notes............................................................................. 16
929(P)/20 1142....................... SPAIN, North Coast: Lights; Coastline; Wrecks................................................ 17
933(T)/20 3635, 3636 ........... PORTUGAL, West Coast: Buoy ........................................................................ 18
1254(T)/20 20, 1104................ FRANCE, West Coast: Scientific instruments; Buoy ........................................ 16
1357(T)/20 3259, 3635, 3636, PORTUGAL, West Coast: Buoy; Automatic Identification System; Virtual aid 18
8160 ...................... to navigation.......................................................................................................
1562(T)/20 2986, 2989, 8040 FRANCE, West Coast: Works............................................................................ 17
1594(T)/20 73 .......................... SPAIN, South West Coast: Buoyage; Pier; Works ............................................. 18
1609(P)/20 8092 ...................... SPAIN, South West Coast: Pilot boarding place ................................................ 20
2069(P)/20 8247 ...................... FRANCE, West Coast: Note .............................................................................. 16
2144(T)/20 1730, 1731 ........... SPAIN, West Coast: Measuring instrument; Buoy............................................. 18
1A.10
Wk27/20
IA
6. FRANCE AND SPAIN, NORTH AND WEST COASTS, AND PORTUGAL - continued
2884(T)/20 3224 ...................... PORTUGAL, West Coast: Scientific instrument ............................................... 18
2912(T)/20 87, 3634, 4011, PORTUGAL, West Coast: Buoy ........................................................................ 18, 19
4014, 4103 ...........
3248(P)/20 8164 ...................... FRANCE, North Coast: Notes ........................................................................... 16
7. NORTH ATLANTIC OCEAN
2974(T)/14 4407 ...................... NORTH ATLANTIC OCEAN: Sub-surface oceanographic buoys and 82
moorings.............................................................................................................
1804(T)/19 1685, 1831 ........... NORTH ATLANTIC OCEAN, Arquipélago da Madeira: Buoy ....................... 20
5962(T)/19 4012, 4013, 4216, NORTH ATLANTIC OCEAN: Buoy ................................................................ 19, 82, 87
4407 ......................
110(P)/20 306, 311, 595, 658, NORTH ATLANTIC OCEAN: Works; Submarine cables ................................ 18, 20, 34,
1381, 1383, 1384, 35
1385, 1684, 1685,
1771, 1831, 3100,
3118, 3432, 3635,
3636, 3859, 4138,
4146, 4148, 4150,
4151, 4152, 4175,
4176 ......................
1483(T)/20 529, 709, 716, 721, NORTH ATLANTIC OCEAN: Data buoys ....................................................... 19, 20, 32,
1510, 4104, 4115, 34, 35, 36,
4202, 4203, 4209, 38, 42, 43,
4215, 4216, 4510, 46, 53, 74,
4702, 4703, 4705, 87, 95
4706, 4707, 4714,
4809, IN 31, IN 33
1547(T)/20 1690, 3134 ........... NORTH ATLANTIC OCEAN: Buoy ................................................................ 20
1875(T)/20 1685 ...................... NORTH ATLANTIC OCEAN, Arquipélago da Madeira: Works; Buoyage...... 20
2877(T)/20 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Buoy........................ 19
8. MEDITERRANEAN AND BLACK SEAS
938(T)/12 2214, 2233 ........... RUSSIA, Black Sea Coast: Scientific instruments ............................................ 31
2188(T)/13 965 ........................ ITALY, Sicilia: Piers........................................................................................... 24
4821(T)/13 1578 ...................... MONTENEGRO: Buoy ..................................................................................... 27
5325(T)/15 183, 4300, 4302 .. CYPRUS: Scientific instruments ....................................................................... 24
630(P)/16 8105 ...................... TURKEY, West Coast: Buoy ............................................................................. 29
817(P)/16 8119....................... TURKEY, South Coast: Buoy............................................................................ 30
1670(P)/16 8119....................... TURKEY, South Coast: Buoyage ...................................................................... 30
1758(P)/16 8205 ...................... BULGARIA: Restricted area; Legend ............................................................... 31
1978(P)/16 8178 ...................... LEBANON: Wrecks........................................................................................... 30
2172(P)/16 8213 ...................... ITALY, East Coast: Restricted area; Works........................................................ 27
2339(P)/16 8115....................... BULGARIA: Restricted areas; Legends ............................................................ 31
2501(P)/16 8204 ...................... BULGARIA: Dredged depth; Berth; Wreck...................................................... 31
2640(P)/16 8052 ...................... CYPRUS: Marine Reserves ............................................................................... 30
3102(P)/16 8213 ...................... SLOVENIA: Marine Reserve ............................................................................ 27
4017(T)/16 1211....................... ITALY, Sardegna: Wreck; Restricted area.......................................................... 25
4211(T)/16 3318 ...................... RUSSIA, Black Sea Coast: Works; Buoyage..................................................... 31
4581(P)/16 8243 ...................... CROATIA: Seaplane operating areas................................................................. 27
4867(P)/16 8119....................... TURKEY, South Coast: Buoyage ...................................................................... 30
5194(T)/16 2216 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
5398(T)/16 2233 ...................... RUSSIA, Black Sea Coast: Measuring instruments .......................................... 31
6529(P)/16 8226 ...................... ITALY, West Coast: Notes.................................................................................. 26
6572(P)/16 2203 ...................... UKRAINE: Legend............................................................................................ 31
1A.11
Wk27/20
IA
8. MEDITERRANEAN AND BLACK SEAS - continued
189(T)/17 908 ........................ ITALY, West Coast: Restricted areas.................................................................. 26
992(P)/17 8009 ...................... FRANCE, South Coast: Radar beacon............................................................... 25
1046(P)/17 8178 ...................... LEBANON: Light; Buoy ................................................................................... 30
1196(P)/17 8243 ...................... CROATIA: Automatic Identification System .................................................... 27
1260(P)/17 8017 ...................... GREECE, Aegean Sea Coast: Wreck; Buoy ...................................................... 28
1419(P)/17 8226 ...................... ITALY, West Coast: Lights................................................................................. 26
1854(P)/17 8161 ...................... MALTA: Note .................................................................................................... 24
1966(P)/17 8228 ...................... ITALY, East Coast: Light-beacon....................................................................... 27
2108(T)/17 3312 ...................... RUSSIA, Black Sea Coast: Scientific instruments; Mooring buoys.................. 31
2221(P)/17 8044 ...................... GREECE, Aegean Sea Coast: Note ................................................................... 28
2607(T)/17 2114....................... FRANCE, South Coast: Restricted area; Works ................................................ 25
2761(P)/17 8243 ...................... CROATIA: Dolphins; Floating docks................................................................ 27
2783(P)/17 8138 ...................... TURKEY, Marmara Denizi: Lights ................................................................... 29
2784(P)/17 8172 ...................... RUSSIA, Black Sea Coast: Explosives dumping ground .................................. 31
2912(T)/17 1159, 1198............ TURKEY, İstanbul Boğazi: Buoyage................................................................. 29
3187(P)/17 8092 ...................... MOROCCO, North Coast: Dredged depths; Legends; Note ............................. 20
3363(P)/17 8226 ...................... ITALY, West Coast: Restricted area ................................................................... 26
3511(P)/17 8257 ...................... SPAIN, Mediterranean Sea Coast: Dredged areas ............................................. 25
3577(P)/17 8173 ...................... TURKEY, Black Sea Coast: Harbour limit........................................................ 31
3690(T)/17 194, 2123, 2538 .. MALTA: Buoyage .............................................................................................. 24
3738(P)/17 3402 ...................... LIBYA: Anchorage areas; Submarine pipelines; Buoyage; Restricted area ...... 24
4311(P)/17 8225 ...................... ITALY, West Coast: Note ................................................................................... 26
4382(P)/17 8115....................... BULGARIA: Legend ......................................................................................... 31
4403(P)/17 8220 ...................... ITALY, West Coast: Breakwaters; Lights........................................................... 26
4926(T)/17 2242 ...................... UKRAINE: Buoy ............................................................................................... 31
5058(P)/17 8178 ...................... LEBANON: Works ............................................................................................ 30
5712(T)/17 1996 ...................... CROATIA: Buoyage .......................................................................................... 27
5788(P)/17 8178 ...................... LEBANON: Works ............................................................................................ 30
204(P)/18 8243 ...................... CROATIA: Light; Automatic Identification System.......................................... 27
236(P)/18 8052 ...................... CYPRUS: Note .................................................................................................. 30
741(P)/18 167, 176 ............... TUNISIA: Platform; Restricted area.................................................................. 24
795(P)/18 8055 ...................... EGYPT, North Coast: Restricted areas; Works; Anchor berth; Note................. 24
915(P)/18 5506 ...................... TURKEY, İstanbul Boğazi: Lights; Radar beacons; Legend; Safe vertical 29
clearances ...........................................................................................................
932(P)/18 8148 ...................... TURKEY, South Coast: Jetty; Light .................................................................. 30
1027(P)/18 8034 ...................... MALTA: Restricted area .................................................................................... 24
1168(P)/18 8254 ...................... CROATIA: Restricted area ................................................................................ 27
1485(P)/18 8254 ...................... CROATIA: Note................................................................................................. 27
1676(P)/18 8213 ...................... ITALY, East Coast: Light ................................................................................... 27
2384(P)/18 8091 ...................... ISRAEL, Mediterranean Sea Coast: Pilot boarding places................................ 30
2683(T)/18 2166 ...................... FRANCE, South Coast: Buoyage; Restricted areas........................................... 25
3086(P)/18 8161 ...................... MALTA: Legends............................................................................................... 24
3174(P)/18 8105 ...................... TURKEY, West Coast: Restricted areas............................................................. 29
3284(P)/18 8243 ...................... CROATIA: Pilot boarding places....................................................................... 27
3389(P)/18 8243 ...................... CROATIA: Note................................................................................................. 27
3459(P)/18 8121 ...................... TURKEY, Marmara Denizi: Note...................................................................... 29
4104(T)/18 1483 ...................... ITALY, East Coast: Buoyage.............................................................................. 27
4297(P)/18 8240 ...................... ITALY, Sicilia: Light-beacon ............................................................................. 24
4393(P)/18 8121 ...................... TURKEY, Marmara Denizi: Works ................................................................... 29
4417(P)/18 8148 ...................... TURKEY, South Coast: Anchorage areas .......................................................... 30
4429(P)/18 8235 ...................... ITALY, West Coast: Light .................................................................................. 26
4430(P)/18 8091 ...................... ISRAEL, Mediterranean Sea Coast: Routeing measures ................................... 30
4446(P)/18 8119....................... TURKEY, South Coast: Note............................................................................. 30
4536(T)/18 1159, 1198............ TURKEY, İstanbul Boğazi: Buoy ...................................................................... 29
1A.12
Wk27/20
IA
4539(T)/18 1055, 1644 ........... TURKEY, West Coast: Buoy ............................................................................. 29, 30
4811(P)/18 8241 ...................... FRANCE, South Coast: Legend ........................................................................ 25
4852(T)/18 1580 ...................... CROATIA: Buoy................................................................................................ 27
4897(P)/18 8110....................... TURKEY, West Coast: Anchorage areas ........................................................... 29
4997(T)/18 1158, 3930............ TURKEY, Black Sea Coast: Buoy ..................................................................... 29, 31
5108(P)/18 8110....................... TURKEY, West Coast: Recommended tracks; Pilot boarding places; Legends 29
5116(P)/18 8173 ...................... TURKEY, Black Sea Coast: Anchorage areas ................................................... 31
5134(P)/18 8017, 8234 ........... GREECE, Aegean Sea Coast: Note ................................................................... 28
5287(P)/18 8119....................... TURKEY, South Coast: Lights .......................................................................... 30
5625(T)/18 140 ........................ ITALY, East Coast: Restricted area .................................................................... 27
6126(T)/18 2203 ...................... UKRAINE: Works ............................................................................................. 31
65(P)/19 8225 ...................... ITALY, West Coast: Light-beacon...................................................................... 26
222(P)/19 8110....................... TURKEY, West Coast: Restricted area .............................................................. 29
235(P)/19 8110....................... TURKEY, West Coast: Note .............................................................................. 29
376(T)/19 2216, 2242 ........... RUSSIA, Black Sea Coast: Light-beacon.......................................................... 31
531(P)/19 8128 ...................... TURKEY, Marmara Denizi: Buoy; Automatic Identification System............... 29
713(T)/19 2284 ...................... ROMANIA: Buoy.............................................................................................. 31
928(P)/19 8115....................... BULGARIA: Piers; Dredged area; Berths; Legends ......................................... 31
1195(P)/19 5506, 5507, 8121 TURKEY, Marmara Denizi: Pilotage................................................................. 29
1218(P)/19 8235 ...................... ITALY, West Coast: Depths; Buoy; Submarine pipelines; Reclamation area; 26
Light; Works; Restricted area.............................................................................
1231(P)/19 8034, 8161 ........... MALTA: Buoy; Automatic Identification System ............................................. 24
1250(P)/19 5507 ...................... TURKEY, Çanakkale Boğazi: Routeing measures ............................................ 29
1464(T)/19 954 ........................ ITALY, West Coast: Works; Submarine pipeline ............................................... 26
1490(T)/19 1643 ...................... ITALY, South Coast: Works; Buoyage............................................................... 27
1568(T)/19 1591, 8091 ........... ISRAEL, Mediterranean Sea Coast: Buoy......................................................... 30
1649(P)/19 8017 ...................... GREECE, Aegean Sea Coast: Wreck................................................................. 28
1653(P)/19 8119....................... TURKEY, South Coast: Automatic Identification Systems ............................... 30
1665(P)/19 8121 ...................... TURKEY, Marmara Denizi: Note...................................................................... 29
1694(P)/19 8121, 8128 ........... TURKEY, Marmara Denizi: Legends ................................................................ 29
1783(P)/19 8243 ...................... CROATIA: Coastline; Legend ........................................................................... 27
1845(P)/19 8240 ...................... ITALY, Sicilia: Restricted area........................................................................... 24
1846(P)/19 8240 ...................... ITALY, Sicilia: Restricted area; Pontoon ........................................................... 24
1853(T)/19 2216, 2242 ........... RUSSIA, Black Sea Coast: Anchorage area ...................................................... 31
1887(T)/19 2282, 2284 ........... ROMANIA: Dredged area; Spoil ground .......................................................... 31
2144(P)/19 8091 ...................... ISRAEL, Mediterranean Sea Coast: Automatic Identification System; Buoy... 30
2162(P)/19 8110....................... TURKEY, West Coast: Restricted areas............................................................. 29
2199(P)/19 8017 ...................... GREECE, Aegean Sea Coast: Wrecks ............................................................... 28
2203(P)/19 3313, 3317 ........... GEORGIA: Depths ............................................................................................ 31
2432(P)/19 8017 ...................... GREECE, Aegean Sea Coast: Maritime limits; Floating docks; Wreck; Buoy; 28
Legend................................................................................................................
2460(T)/19 8235, IT 84............ ITALY, West Coast: Works; Buoyage ................................................................ 26
2717(P)/19 8017 ...................... GREECE, Aegean Sea Coast: Wrecks ............................................................... 28
2722(P)/19 8148 ...................... TURKEY, South Coast: Jetty; Light .................................................................. 30
2991(P)/19 8105 ...................... TURKEY, West Coast: Note .............................................................................. 29
3088(T)/19 1569, 2122 ........... TUNISIA: Foul .................................................................................................. 24
3125(P)/19 497, 8128 ............. TURKEY, Marmara Denizi: Traffic separation scheme .................................... 29
3409(T)/19 1996 ...................... CROATIA: Buoyage .......................................................................................... 27
3596(P)/19 8009 ...................... FRANCE, South Coast: Restricted area; Legend .............................................. 25
3604(P)/19 1683 ...................... GREECE, Aegean Sea Coast: Dredging area; Works ........................................ 28
3881(P)/19 8092 ...................... MOROCCO, North Coast: Works; Breakwater; Lights..................................... 20
4085(P)/19 8239 ...................... ITALY, West Coast: Maritime limit; Unsurveyed area; Floating dock; Mooring 26
buoy....................................................................................................................
1A.13
Wk27/20
IA
4100(P)/19 8115....................... BULGARIA: Anchorage areas .......................................................................... 31
4102(P)/19 8009 ...................... FRANCE, South Coast: Note............................................................................. 25
4224(P)/19 8055 ...................... EGYPT, North Coast: Reclamation area; Breakwaters; Dredged area; 24
Channels; Buoyage; Light-beacons....................................................................
4366(P)/19 1445 ...................... ITALY, East Coast: Dredged area ...................................................................... 27
4508(P)/19 8205 ...................... BULGARIA: Pilot boarding place..................................................................... 31
4674(P)/19 8161 ...................... MALTA: Note .................................................................................................... 24
4697(T)/19 1417, 1643 ........... ITALY, South Coast: Measuring instruments..................................................... 27
4719(P)/19 8161 ...................... MALTA: Legends............................................................................................... 24
5192(T)/19 3318, 8074 ........... RUSSIA, Black Sea Coast: Works ..................................................................... 31
5310(T)/19 1426 ...................... SLOVENIA: Works ........................................................................................... 27
5442(P)/19 8240 ...................... ITALY, Sicilia: Radar beacon............................................................................. 24
5447(P)/19 8226 ...................... ITALY, West Coast: Lights................................................................................. 26
5463(P)/19 8061 ...................... ISRAEL, Mediterranean Sea Coast: Channels; Pilot boarding place; Buoyage; 30
Anchor berths; Swinging circles ........................................................................
5467(T)/19 1710 ...................... ALGERIA: Buoy ............................................................................................... 24
5633(P)/19 8110....................... TURKEY, West Coast: Legend .......................................................................... 29
5794(P)/19 8017 ...................... GREECE, Aegean Sea Coast: Wrecks; Legend ................................................. 28
5822(P)/19 8121 ...................... TURKEY, Marmara Denizi: Buoy; Wreck ........................................................ 29
5848(P)/19 8128 ...................... TURKEY, Marmara Denizi: Anchorage areas ................................................... 29
6018(P)/19 8092 ...................... MOROCCO, North Coast: Dredged depths; Works; Depths; Alongside depths; 20
Light-beacons; Dredged areas............................................................................
6117(P)/19 8257 ...................... SPAIN, Mediterranean Sea Coast: Anchorage areas; Channels; Pilot boarding 25
place ...................................................................................................................
6213(P)/19 8119....................... TURKEY, South Coast: Anchorage areas .......................................................... 30
6296(P)/19 8128 ...................... TURKEY, Marmara Denizi: Anchorage areas ................................................... 29
6303(P)/19 8110....................... TURKEY, West Coast: Anchorage areas ........................................................... 29
6311(T)/19 252 ........................ ALGERIA: Obstruction; Buoy .......................................................................... 24
6397(P)/19 2214, 2216, 2217, UKRAINE: General information ....................................................................... 31
2232, 2233, 2234,
2242 ......................
6406(T)/19 2284 ...................... ROMANIA: Buoyage ........................................................................................ 31
6519(T)/19 9 ............................ TUNISIA: Buoyage; Channel ............................................................................ 24
368(T)/20 118......................... ITALY, West Coast: Works................................................................................. 26
511(P)/20 8148 ...................... TURKEY, South Coast: Note............................................................................. 30
513(P)/20 8210 ...................... ITALY, East Coast: Restricted areas .................................................................. 27
516(P)/20 8148 ...................... TURKEY, South Coast: Restricted areas; Pilot boarding places ....................... 30
559(T)/20 1585, 2634 ........... ISRAEL, Mediterranean Sea Coast: Buoy......................................................... 30
611(T)/20 1996, 2719 ........... CROATIA: Buoy................................................................................................ 27
626(T)/20 3403 ...................... TUNISIA: Wreck ............................................................................................... 24
679(T)/20 36 .......................... MALTA: Wreck; Buoy....................................................................................... 24
722(P)/20 8243 ...................... CROATIA: Pilot boarding place ........................................................................ 27
900(P)/20 8277 ...................... GIBRALTAR: Legend ....................................................................................... 18
1147(T)/20 1585 ...................... ISRAEL, Mediterranean Sea Coast: Buoy; Wreck ............................................ 30
1152(P)/20 8172 ...................... RUSSIA, Black Sea Coast: Depths; Alongside depths; Fairway; Dredged 31
depths; Dredged area; Pier; Floating dock .........................................................
1189(T)/20 183, 2634 ............. ISRAEL, Mediterranean Sea Coast: Works; Submarine pipeline...................... 24, 30
1294(P)/20 8240 ...................... ITALY, Sicilia: Restricted areas ......................................................................... 24
1352(T)/20 964 ........................ ITALY, Sicilia: Obstruction................................................................................ 24
1409(T)/20 580 ........................ MOROCCO, North Coast: Works; Buoy ........................................................... 24
1526(T)/20 966, 973 ............... ITALY, Sicilia: Works ........................................................................................ 24
1589(P)/20 2114....................... FRANCE, South Coast: Obstruction; Wreck ..................................................... 25
1635(T)/20 2203 ...................... UKRAINE: Buoyage ......................................................................................... 31
1636(T)/20 1522 ...................... TURKEY, West Coast: Buoyage........................................................................ 29
1696(T)/20 1180....................... SPAIN, Mediterranean Sea Coast: Buoyage ...................................................... 25
1721(T)/20 1585 ...................... ISRAEL, Mediterranean Sea Coast: Buoy......................................................... 30
1A.14
Wk27/20
IA
2139(P)/20 8052 ...................... CYPRUS: Harbour limit .................................................................................... 30
2210(T)/20 2282 ...................... ROMANIA: Wreck ............................................................................................ 31
2248(T)/20 954, 8274 ............. ITALY, West Coast: Port development; Works; Buoyage .................................. 26
2257(P)/20 8228 ...................... ITALY, East Coast: Buoyage.............................................................................. 27
2560(T)/20 966, 973 ............... ITALY, Sicilia: Works ........................................................................................ 24
2659(P)/20 1019 ...................... ITALY, West Coast: Depths................................................................................ 26
2820(T)/20 2205, 2243 ........... UKRAINE: Buoyage ......................................................................................... 31
2956(T)/20 2284 ...................... ROMANIA: Buoy.............................................................................................. 31
2972(P)/20 2284 ...................... ROMANIA: Depth information......................................................................... 31
3069(P)/20 8017 ...................... GREECE, Aegean Sea Coast: Light................................................................... 28
3109(P)/20 8017 ...................... GREECE, Aegean Sea Coast: Legend ............................................................... 28
3147(P)/20 8061 ...................... ISRAEL, Mediterranean Sea Coast: Works ....................................................... 30
3152(P)/20 3119, 8055............ EGYPT, North Coast: Works; Restricted area; Anchor berths........................... 24
3265(T)/20 200, 1443 ............. ITALY, East Coast: Moored storage tanker; Restricted area.............................. 27
3314(T)/20 1591, 2634 ........... ISRAEL, Mediterranean Sea Coast: Restricted area.......................................... 30
9. AFRICA, WEST COAST AND SOUTH ATLANTIC
3064(T)/13 3101 ...................... IVORY COAST: Wreck ..................................................................................... 34
4735(P)/14 607 ........................ SENEGAL: Depths ............................................................................................ 20
4221(P)/15 8060 ...................... SENEGAL: Wreck ............................................................................................. 20
4498(T)/15 1664 ...................... SENEGAL: Wreck ............................................................................................. 20
4753(P)/15 8060 ...................... SENEGAL: Note................................................................................................ 20
1084(P)/16 8060 ...................... SENEGAL: Pilot boarding place ....................................................................... 20
4227(P)/16 8060 ...................... SENEGAL: Automatic Identification Systems.................................................. 20
4457(P)/16 8192 ...................... GUINEA: Light.................................................................................................. 20
5148(P)/16 8147 ...................... CONGO: Restricted area; Note.......................................................................... 34
875(P)/17 8192 ...................... GUINEA: Buoy; Radar beacon; Leading line ................................................... 20
3033(P)/17 8147 ...................... CONGO: Note.................................................................................................... 34
5782(P)/17 8192 ...................... GUINEA: Dredged depths ................................................................................. 20
1277(T)/18 601, 1147.............. GUINEA: Barge................................................................................................. 20
3504(T)/18 1699 ...................... MAURITANIA: Buoyage .................................................................................. 20
5016(T)/18 306, 307 ............... ANGOLA: Buoy ................................................................................................ 34
6173(P)/18 8035 ...................... IVORY COAST: Legend ................................................................................... 34
231(T)/19 1322 ...................... GABON: Buoyage ............................................................................................. 34
842(P)/19 862 ........................ MOROCCO, West Coast: Wreck; Obstructions................................................. 20
2511(P)/19 8035 ...................... IVORY COAST: Wreck; Obstructions; Anchor berth ....................................... 34
3718(T)/19 1661, 1699 ........... MAURITANIA: Wreck...................................................................................... 20
4298(T)/19 3859, 4175, 4176 NAMIBIA: Scientific instruments ..................................................................... 34
5265(T)/19 1661, 3134 ........... MAURITANIA: Wreck...................................................................................... 20
5317(T)/19 1661, 1690, 1699, MAURITANIA: Wreck; Restricted area............................................................ 20
3134 ......................
5780(P)/19 3103, 8035 ........... IVORY COAST: Works; Buoyage; Light .......................................................... 34
5787(P)/19 3103, 8035 ........... IVORY COAST: Works; RoRo; Buoyage; Automatic Identification System; 34
Wreck .................................................................................................................
6179(P)/19 1661, 1690, 1699 MAURITANIA: Works; Spoil grounds.............................................................. 20
1389(T)/20 4137, 4138 ........... NAMIBIA: Radar beacon .................................................................................. 34
1931(P)/20 1562 ...................... GUINEA: Quays; Depths; Maintained channel ................................................. 20
2045(T)/20 1000, 1001 ........... SENEGAL: Depths ............................................................................................ 20
2169(P)/20 8018 ...................... NIGERIA: Maritime limits; Legends................................................................. 34
2262(P)/20 1661, 1690, 1699 MAURITANIA: Depths; Wrecks; Obstructions; Dredged area......................... 20
2294(T)/20 1383 ...................... GHANA: Fog signal; Superbuoy ....................................................................... 34
2418(P)/20 856, 860, 861, MOROCCO, West Coast: Buoyage; Lights; Radar beacon ............................... 18, 20
3132, 3133, 8251
2616(P)/20 863 ........................ MOROCCO, West Coast: Marine farms; Buoyage............................................ 20
2885(T)/20 1000, 1001 ........... SENEGAL: Works ............................................................................................. 20
3080(T)/20 659 ........................ ANGOLA: Buoy ................................................................................................ 34
3223(P)/20 8018 ...................... NIGERIA: Lights ............................................................................................... 34
1A.15
Wk27/20
IA
10. AFRICA, SOUTH AND EAST COASTS, AND MADAGASCAR
1102(P)/15 8005 ...................... SOUTH AFRICA, East Coast: Restricted area; Dredged area .......................... 35
3022(P)/15 8005 ...................... SOUTH AFRICA, East Coast: Buoy ................................................................. 35
3085(T)/17 647 ........................ MOZAMBIQUE: Buoy ..................................................................................... 36
5638(P)/17 8038 ...................... SOUTH AFRICA, West Coast: Restricted area; Submarine pipeline; Buoyage; 35
Depths ................................................................................................................
5863(P)/17 8038 ...................... SOUTH AFRICA, West Coast: Note ................................................................. 35
209(T)/18 4153, 4155 ........... SOUTH AFRICA, South Coast: Buoy............................................................... 35
576(T)/18 1236, 4142, 8038 SOUTH AFRICA, South Coast: Wreck ............................................................. 35
1073(P)/18 8027 ...................... KENYA: Note .................................................................................................... 36
1103(P)/18 8027 ...................... KENYA: Storage tanker; Legend....................................................................... 36
2060(T)/18 643, 4170, 8005 .. SOUTH AFRICA, East Coast: Buoy ................................................................. 35
4924(P)/18 663, 3310, 3361 .. TANZANIA: Depths; Lights; Buoyage; Beacons; Leading line; Submarine 36
pipelines; Jetty; Rocks........................................................................................
5587(T)/18 4136 ...................... SOUTH AFRICA, West Coast: Works............................................................... 34
210(T)/19 643, 8005 ............. SOUTH AFRICA, East Coast: Depths............................................................... 35
403(T)/19 4142 ...................... SOUTH AFRICA, West Coast: Depth ............................................................... 35
1875(T)/19 2078, 4177 ........... SOUTH AFRICA, West Coast: Current meters ................................................. 34
2589(T)/19 1846, 8025 ........... SOUTH AFRICA, West Coast: Depths; Dredged depths .................................. 35
2590(T)/19 4158, 8021 ........... SOUTH AFRICA, South Coast: Depth.............................................................. 35
2591(T)/19 4162 ...................... SOUTH AFRICA, South Coast: Depths ............................................................ 35
2592(T)/19 4174, 8019 ........... SOUTH AFRICA, East Coast: Depths............................................................... 35
3228(T)/19 1236, 1922, 4142, SOUTH AFRICA, West Coast: Obstructions; Buoyage .................................... 35
4145, 4146, 4150,
4151, 4152, 4153,
4154, 4155 ...........
6161(P)/19 663 ........................ TANZANIA: Buoyage; Light-beacons; Works.................................................. 36
6566(T)/19 1236, 4142 ........... SOUTH AFRICA, West Coast: Rocks; Depths.................................................. 35
42(P)/20 668 ........................ KENYA: Works; Buoyage; Leading lights; Pilot boarding place ...................... 36
245(T)/20 1236, 4142 ........... SOUTH AFRICA, West Coast: Shellfish bed; Buoyage.................................... 35
632(P)/20 8027 ...................... KENYA: Legend ................................................................................................ 36
817(T)/20 4157, 4160, 8021 SOUTH AFRICA, South Coast: Buoy............................................................... 35
939(P)/20 8027 ...................... KENYA: Buoyage.............................................................................................. 36
1714(P)/20 3530 ...................... SOMALIA: Platform; Buoyage ......................................................................... 32
2673(P)/20 1003, 2758 ........... MOZAMBIQUE: Buoyage; Channel; Alongside depths; Berths ...................... 36
11. RED SEA, ARABIA, IRAQ AND IRAN
2035(T)/13 2884 ...................... IRAN: Wreck; Buoy........................................................................................... 40
3234(T)/13 1229 ...................... IRAQ: Wreck ..................................................................................................... 40
5236(T)/14 2523, 2883, 2886, QATAR: Buoyage .............................................................................................. 40
2887, 3950 ...........
4761(P)/15 8029 ...................... SAUDI ARABIA, Red Sea Coast: Note ............................................................ 32
5640(T)/15 3738, 3761, 3786, BAHRAIN: Buoy............................................................................................... 40
3788, 3790 ...........
500(P)/16 8106 ...................... UNITED ARAB EMIRATES: Light.................................................................. 40
1012(P)/16 8106 ...................... UNITED ARAB EMIRATES: Vertical clearance.............................................. 40
1182(T)/16 333, 2374 ............. EGYPT, Red Sea Coast: Platform; Light ........................................................... 32
4281(P)/16 63 .......................... SAUDI ARABIA, Red Sea Coast: Harbour developments; Depths .................. 32
4492(P)/16 11, 1268, 2882, IRAN: Platforms; Submarine cables; Submarine pipelines ............................... 40
2884, 3774 ...........
5105(P)/16 16 .......................... SAUDI ARABIA, Red Sea Coast: Depths; Wrecks; Submarine pipeline; 32
Rocks; Coral.......................................................................................................
6029(P)/16 8088 ...................... SAUDI ARABIA, East Coast: Platform ............................................................ 32
6310(P)/16 8106 ...................... UNITED ARAB EMIRATES: Buoy; Automatic Identification System; Radar 40
beacon ................................................................................................................
861(P)/17 2889, 3178, 3179 UNITED ARAB EMIRATES: Submarine cables; Works.................................. 40
1201(P)/17 8029 ...................... SAUDI ARABIA, Red Sea Coast: Note; Legend .............................................. 32
1731(P)/17 2889, 3178 ........... UNITED ARAB EMIRATES: Works; Submarine cable; Submarine pipelines 40
1755(P)/17 8106 ...................... UNITED ARAB EMIRATES: Pilot boarding place .......................................... 40
1A.16
Wk27/20
IA
11. RED SEA, ARABIA, IRAQ AND IRAN - continued
1870(P)/17 8106 ...................... UNITED ARAB EMIRATES: Note................................................................... 40
2226(P)/17 8106 ...................... UNITED ARAB EMIRATES: Anchorage area ................................................. 40
2363(P)/17 6, 12, 15, 143, 157, RED SEA: Routeing measures........................................................................... 32
158, 159, 164, 452,
453, 1925, 2375,
2658, 2659, 2964
2822(T)/17 2523, 3790 ........... QATAR: Buoy .................................................................................................... 40
3192(P)/17 8088 ...................... SAUDI ARABIA, East Coast: Foul ................................................................... 32
3559(P)/17 2837, 2889, 3178, UNITED ARAB EMIRATES: Submarine pipeline; Obstruction ...................... 40
3179, 3413 ...........
3851(P)/17 8191 ...................... UNITED ARAB EMIRATES: Landmark.......................................................... 40
4031(P)/17 1265, 3842, 3843, IRAQ: Channel; Depths; Wrecks ....................................................................... 40
3844, 3845, 3846
5287(T)/17 1235, 1265 ........... ARABIA: Buoyage ............................................................................................ 40
5518(P)/17 1228 ...................... IRAQ: Jetty; Dolphins; Mooring buoys; Floating dock; Dredged area ............. 40
77(P)/18 8191 ...................... UNITED ARAB EMIRATES: Harbour limit; Anchorage areas; Legends ........ 40
1453(T)/18 1235, 1265, 3773 ARABIA, Shaţţ al'Arab: Buoyage ..................................................................... 40
2003(P)/18 8109 ...................... UNITED ARAB EMIRATES: Anchorage area ................................................. 40
2528(T)/18 2133, 2373 ........... EGYPT, Red Sea Coast: Buoy ........................................................................... 32
3055(P)/18 3752, 8253 ........... UNITED ARAB EMIRATES: Works ................................................................ 40
3266(P)/18 8116....................... QATAR: Note..................................................................................................... 40
3362(P)/18 8245 ...................... DJIBOUTI: Anchorage areas ............................................................................. 32
3774(P)/18 8245 ...................... DJIBOUTI: Note ................................................................................................ 32
4030(P)/18 3772, 3781 ........... QATAR: Depths; Buoyage ................................................................................. 40
4177(T)/18 2444, 2837, 2886, UNITED ARAB EMIRATES: Buoy.................................................................. 40
2887, 2889, 3179,
3413 ......................
4857(P)/18 8029 ...................... SAUDI ARABIA, Red Sea Coast: Depths; Wrecks; Obstructions; Beacons; 32
Buoyage; Anchorage areas; Works; Reclamation area.......................................
5400(P)/18 2837, 2888, 3174, UNITED ARAB EMIRATES: Harbour limits; Anchorage areas; Anchor 40
3404 ...................... berths; Virtual aids to navigation; Lights; Buoyage; Pilot boarding places;
Quay; Berth; Marine farm; Landmark ...............................................................
5748(P)/18 8191 ...................... UNITED ARAB EMIRATES: Harbour limit; Legends; Anchorage area.......... 40
5951(T)/18 2444, 3179, 3413 UNITED ARAB EMIRATES: Obstruction ....................................................... 40
240(P)/19 2889, 3179, 3951 UNITED ARAB EMIRATES: Platforms........................................................... 40
431(P)/19 8116....................... QATAR: Anchorage areas .................................................................................. 40
631(T)/19 3762, 3763 ........... OMAN: Buoyage; Works................................................................................... 40
994(P)/19 1229, 1235, 2847, IRAQ: Works; Buoyage; Channel...................................................................... 40
2884 ......................
1044(P)/19 8245 ...................... DJIBOUTI: Restricted areas; Legends............................................................... 32
1646(P)/19 3737, 3738, 3759, BAHRAIN: Works ............................................................................................. 40
8043 ......................
1855(P)/19 3759, 8042, 8043 BAHRAIN: Works; Lights; Breakwater; Buoyage; Channel; Restricted area; 40
Submarine pipeline; Submarine cable; Radar beacon........................................
1937(T)/19 333, 2374 ............. EGYPT, Red Sea Coast: Buoy ........................................................................... 32
1946(T)/19 3520, 3723 ........... UNITED ARAB EMIRATES: Buoy.................................................................. 40
2009(P)/19 8043 ...................... BAHRAIN: Pilot boarding place ....................................................................... 40
2185(T)/19 2444, 3179, 3413 UNITED ARAB EMIRATES: Obstruction ....................................................... 40
2208(T)/19 2523, 2837, 2847, QATAR: Buoy .................................................................................................... 40
2886, 3772, 3950
2377(P)/19 8101 ...................... UNITED ARAB EMIRATES: Light; Buoyage; Light-beacon.......................... 40
2750(P)/19 8109 ...................... UNITED ARAB EMIRATES: Works ................................................................ 40
3045(P)/19 8253 ...................... UNITED ARAB EMIRATES: Buoy.................................................................. 40
3062(P)/19 12 .......................... SAUDI ARABIA, Red Sea Coast: Depths; Obstruction; Dredged areas; 32
Coastline.............................................................................................................
3103(P)/19 2577 ...................... SAUDI ARABIA, Red Sea Coast: Depths......................................................... 32
1A.17
Wk27/20
IA
11. RED SEA, ARABIA, IRAQ AND IRAN - continued
3126(P)/19 2837, 2889, 3178, UNITED ARAB EMIRATES: Works; Offshore installations ........................... 40
3179 ......................
3154(P)/19 3176, 3412 ........... UNITED ARAB EMIRATES: Restricted area .................................................. 40
3202(P)/19 3812, 8087 ........... SAUDI ARABIA, East Coast: Depths ............................................................... 32, 40
3896(T)/19 1223, 2882, 2884, KUWAIT: Lights; Wreck ................................................................................... 40
3773 ......................
4426(P)/19 8043 ...................... BAHRAIN: Note................................................................................................ 40
5100(T)/19 3174, 3175 ........... UNITED ARAB EMIRATES: Buoyage; Works................................................ 40
5127(P)/19 27, 2884 ............... IRAN: Channel; Buoyage; Dredged depths; Light-beacons; Dredged areas; 40
Dolphins; Reclamation area; Coastline; Swinging circle; Anchor berths ..........
5424(P)/19 8117....................... QATAR: Buoyage .............................................................................................. 40
5912(T)/19 15, 157 ................. SAUDI ARABIA, Red Sea Coast: Light-beacon............................................... 32
5960(T)/19 2443, 2444, 2837, UNITED ARAB EMIRATES: Works ................................................................ 40
2858, 2886, 2887,
2889, 3178, 3179
5976(P)/19 8101 ...................... UNITED ARAB EMIRATES: Legend; Dredged depths ................................... 40
6077(P)/19 3739, 8054 ........... UNITED ARAB EMIRATES: Light; Works; Buoyage; Breakwaters; Channel 40
6162(T)/19 2523 ...................... QATAR: Buoy .................................................................................................... 40
6182(P)/19 8054 ...................... UNITED ARAB EMIRATES: Restricted area .................................................. 40
6524(T)/19 11........................... IRAN: Buoy ....................................................................................................... 40
6633(T)/19 2889, 3179, 3779, UNITED ARAB EMIRATES: Dredging area; Works; Buoyage; 40
3780, 3951 ........... Recommended route...........................................................................................
6639(T)/19 1214, 1223, 2882, KUWAIT: Buoyage; Beacons ............................................................................ 40
2884, 3773 ...........
6699(P)/19 3718 ...................... SAUDI ARABIA, East Coast: Works; Buoyage; Dredged area ........................ 40
163(P)/20 2884 ...................... KUWAIT: Works; Buoyage; Causeways ........................................................... 40
225(P)/20 8118....................... QATAR: Dredged areas; Buoyage; Channels .................................................... 40
244(P)/20 2523, 2837, 2847, QATAR: Offshore installation............................................................................ 40
2858, 2886, 2887,
3772, 3950 ...........
791(P)/20 8054 ...................... UNITED ARAB EMIRATES: Dredged depths; Dredged areas; Coastline; 40
Berths .................................................................................................................
1057(T)/20 2887, 2888, 2889, UNITED ARAB EMIRATES: Wreck................................................................ 40, 48
3175, 3176, 3412,
3837, 8191 ...........
1503(T)/20 2889, 3179, 3951 UNITED ARAB EMIRATES: Buoy.................................................................. 40
1568(P)/20 8101 ...................... UNITED ARAB EMIRATES: Notes ................................................................. 40
1577(P)/20 8191 ...................... UNITED ARAB EMIRATES: Platform ............................................................ 40
1578(P)/20 8117....................... QATAR: Restricted areas; Legends.................................................................... 40
1587(P)/20 8117....................... QATAR: Light .................................................................................................... 40
1625(P)/20 1223, 1224, 2882, KUWAIT: Works; Submarine pipeline; Islet; Harbour limit; Buoyage; 40
2884, 3773, 3774 Obstructions; Anchorage area; Pilot boarding places; Light..............................
1822(T)/20 2854 ...................... OMAN: Wreck ................................................................................................... 40
2062(T)/20 3736 ...................... BAHRAIN: Buoyage ......................................................................................... 40
2084(P)/20 8117....................... QATAR: Light-beacons...................................................................................... 40
2367(P)/20 3176, 3739 ........... UNITED ARAB EMIRATES: Anchorage area; Maritime limit........................ 40
2447(P)/20 5, 6, 100, 265, 616, GULF OF ADEN: Submarine cables................................................................. 32, 36
666, 671, 2949,
2968, 2969, 2970,
3361, 3530 ...........
2505(T)/20 2889, 3179, 3951 UNITED ARAB EMIRATES: Buoyage ............................................................ 40
3064(P)/20 8116....................... QATAR: Maritime limits.................................................................................... 40
3127(P)/20 15, 16 ................... SAUDI ARABIA, Red Sea Coast: General information ................................... 32
3211(T)/20 2523, 2837, 2847, BAHRAIN: Buoy............................................................................................... 40
2858, 2886, 3738,
3790, 8043 ...........
3242(T)/20 3734, 3736 ........... BAHRAIN: Jetty; Works.................................................................................... 40
1A.18
Wk27/20
IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA
4002(P)/12 569 ........................ INDIA, East Coast: Port developments ............................................................. 43
3337(P)/15 8032 ...................... PAKISTAN: Light.............................................................................................. 41
1939(P)/16 8166 ...................... BANGLADESH: Wreck; Buoy ......................................................................... 43
4552(P)/16 3323 ...................... INDIAN OCEAN, Maldives: Works; Bridge..................................................... 42
463(P)/17 33, 38 ................... PAKISTAN: Depths; Lights ............................................................................... 41
2877(T)/17 IN 2036 .................. INDIA, West Coast: Buoyage ............................................................................ 41
3221(T)/17 39, 1465, IN 202, INDIA, West Coast: Buoy.................................................................................. 41
IN 203, IN 2031 .....
5395(T)/17 39, 707, 4705 ...... PAKISTAN: Wreck ............................................................................................ 32, 41
894(P)/18 8032 ...................... PAKISTAN: Note............................................................................................... 41
2184(P)/18 IN 2016 .................. INDIA, West Coast: Traffic separation scheme; Routeing measures; 41
Recommended routes .........................................................................................
2839(P)/18 321, IN 3010, INDIA, East Coast: Anchorage areas; Submarine pipelines; Restricted area .... 43
IN 3041 ..................
2951(T)/18 90 .......................... BANGLADESH: Obstruction............................................................................ 43
3911(P)/18 IN 2016, IN 2076 ... INDIA, West Coast: Works ................................................................................ 41
4087(P)/18 IN 211, IN 2001, INDIA, West Coast: Works; Buoyage................................................................ 41
IN 2015, IN 2016,
IN 2076 ..................
4348(P)/18 8166 ...................... BANGLADESH: Light; Radar beacons ............................................................ 43
4921(T)/18 90 .......................... BANGLADESH: Wreck .................................................................................... 43
5442(T)/18 1488, IN 207, INDIA, West Coast: Dredging areas .................................................................. 41
IN 253, IN 254 .......
5538(P)/18 90, 817 ................. BANGLADESH: Works; Buoyage; Anchorage area; Submarine pipeline........ 43
5548(P)/18 IN 206, IN 253 ....... INDIA, West Coast: Works ................................................................................ 41
5576(P)/18 920 ........................ INDIAN OCEAN, Chagos: Restricted areas; Anchorage areas; Depths ........... 38
6120(P)/18 3265, 3700 ........... SRI LANKA, South Coast: Depths; Rocks........................................................ 42
105(P)/19 319 ........................ INDIA, East Coast: Channel limit; Buoyage; Dredged depths; Berth; Floating 43
dock; Pilot boarding places ................................................................................
460(P)/19 IN 3001, IN 3039 ... INDIA, East Coast: Works ................................................................................. 43
1066(T)/19 84, 90 ................... BANGLADESH: Wrecks; Buoy........................................................................ 43
1168(P)/19 12, 15, 159, 164, INDIAN OCEAN: Submarine cable .................................................................. 32, 40, 41,
263, 264, 333, 818, 42, 43, 45,
830, 840, 2375, 46
2441, 2442, 2738,
2760, 2970, 3784,
3904, 3943, 4703,
4705, 4706, 4707,
IN 293, IN 2016 .....
1217(P)/19 IN 292 .................... INDIA, West Coast: Traffic separation scheme ................................................. 41
1600(T)/19 84, 90 ................... BANGLADESH: Wrecks................................................................................... 43
1943(P)/19 8180 ...................... PAKISTAN: Dredged depths; Quay; Channel; Leading line; Beacons; Dredged 41
area; Buoyage; Pier; Jetty; Anchorage area .......................................................
2070(P)/19 8180 ...................... PAKISTAN: Note............................................................................................... 41
2078(P)/19 IN 3012 .................. INDIA, East Coast: Works ................................................................................. 43
2106(P)/19 IN 211, IN 255, INDIA, West Coast: Works; Buoyage................................................................ 41
IN 292, IN 293,
IN 2016, IN 2076 ...
2421(P)/19 8166 ...................... BANGLADESH: Harbour limit; Legend........................................................... 43
2556(T)/19 732 ........................ BANGLADESH: Wreck .................................................................................... 43
2697(T)/19 38 .......................... PAKISTAN: Islets; Depths................................................................................. 41
2869(P)/19 IN 203, IN 2013, INDIA, West Coast: Works ................................................................................ 41
IN 2031 ..................
IN 2004, IN 2029,
IN 2045 ..................
IN 2083 ..................
1A.19
Wk27/20
IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
3743(P)/19 8032 ...................... PAKISTAN: Buoyage; Channel; Dredged area; Dredged depths; Leading lines; 41
Lights; Pilot boarding place; Port developments ...............................................
3861(T)/19 833 ........................ BURMA: Buoy .................................................................................................. 43
3897(T)/19 IN 2016, IN 2076 ... INDIA, West Coast: Buoy.................................................................................. 41
3934(T)/19 IN 211, IN 255, INDIA, West Coast: Light-vessel....................................................................... 41
IN 2016, IN 2076 ...
3935(T)/19 IN 2002, IN 2359 ... INDIA, West Coast: Buoy.................................................................................. 41
3986(T)/19 722 ........................ INDIAN OCEAN, Seychelles: Beacon.............................................................. 36
4184(T)/19 84, 90 ................... BANGLADESH: Wreck .................................................................................... 43
4257(T)/19 90, 817 ................. BANGLADESH: Wreck .................................................................................... 43
4267(T)/19 1885 ...................... BURMA: Buoy .................................................................................................. 43
4326(P)/19 1488, IN 207, INDIA, West Coast: Works ................................................................................ 41
IN 253, IN 254,
IN 292 ....................
4612(T)/19 84, 90 ................... BANGLADESH: Wrecks................................................................................... 43
4977(T)/19 84, 8166 ............... BANGLADESH: Works .................................................................................... 43
5223(T)/19 90 .......................... BANGLADESH: Obstruction............................................................................ 43
5331(T)/19 84, 90 ................... BANGLADESH: Wreck .................................................................................... 43
5363(T)/19 830 ........................ BURMA: Works................................................................................................. 45
5373(T)/19 3877, 3895, 4701, INDIAN OCEAN, Comores: Volcanic activity ................................................. 36, 38
4702 ......................
5465(T)/19 4723 ...................... INDIAN OCEAN: Buoy .................................................................................... 63
5624(T)/19 90, 732 ................. BANGLADESH: Buoyage ................................................................................ 43
5860(P)/19 732 ........................ BANGLADESH: Drying heights; Depths; Wrecks; Buoyage; Lights; Coastline 43
6326(T)/19 817, 818, 4706, BURMA: Offshore installations......................................................................... 42, 43
IN 31 ......................
6537(P)/19 8166 ...................... BANGLADESH: Anchor berths ........................................................................ 43
6550(P)/19 84, 90, 8166 ........ BANGLADESH: Submarine pipelines.............................................................. 43
304(P)/20 84, 90, 8166 ........ BANGLADESH: Depths; Drying heights; Islets; Wrecks; Platform; Restricted 43
areas; Buoyage; Submarine pipeline; Jetties; Signal station; Lights; Leading
lights; Beacons; Landmarks; Tide gauge; Pontoons; Piers; Automatic
Identification Systems; Virtual aids to navigation .............................................
468(T)/20 90, 817 ................. BANGLADESH: Wreck .................................................................................... 43
579(P)/20 IN 254, IN 292 ....... INDIA, West Coast: Depths ............................................................................... 41
1167(P)/20 IN 203 .................... INDIA, West Coast: Depths ............................................................................... 41
1168(P)/20 69, IN 262 ............. INDIA, East Coast: Depths; Recommended anchorage; Buoyage .................... 42
1380(T)/20 IN 223, IN 260, INDIA, West Coast: Buoyage ............................................................................ 41
IN 261 ....................
1802(P)/20 IN 211, IN 255, INDIA, West Coast: Bridge; Jetty...................................................................... 41
IN 2016, IN 2076 ...
1813(T)/20 707, IN 211, IN 212, INDIA, West Coast: Works; Submarine pipelines ............................................. 41
IN 255, IN 256,
IN 292, IN 293,
IN 2016 ..................
2164(P)/20 725, 727 ............... INDIAN OCEAN, Chagos: Rocks; Obstructions .............................................. 38
2174(T)/20 IN 3010, IN 3041 ... INDIA, East Coast: Buoyage ............................................................................. 43
2331(T)/20 39, 707, 709, 828, INDIA, West Coast: Obstructions; Scientific instruments................................. 41, 42
1465, 1587, 2738,
IN 22, IN 214,
IN 221, IN 253,
IN 258, IN 259,
IN 261, IN 292,
IN 293 ....................
2332(T)/20 IN 214, IN 215, INDIA, West Coast: Buoyage ............................................................................ 41
IN 2022 ..................
1A.20
Wk27/20
IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
2336(T)/20 707, 709, 2738, INDIA, West Coast: Data buoys ........................................................................ 32, 41, 42
4703, 4705, 4706,
4707, IN 22, IN 214,
IN 257, IN 292,
IN 293 ....................
2341(T)/20 317, 825, 828, 830, INDIA, East Coast: Buoyage ............................................................................. 42, 43, 45
840, 1398, 2069,
4706, 4707, IN 31,
IN 33, IN 3001,
IN 3004 ..................
2821(T)/20 2760, 4070, 4071, INDIAN OCEAN: Buoyage .............................................................................. 35, 42, 46
4073, 4707 ...........
2851(T)/20 317, 318, 319, 320, INDIA, East Coast: Obstructions ....................................................................... 42, 43
321, 828, 2069,
4706, IN 31, IN 33,
IN 308 ....................
2867(P)/20 2738 ...................... INDIA, West Coast: Depths; Wreck................................................................... 41
3103(P)/20 1495, 1497 ........... INDIAN OCEAN, La Réunion: Submarine cable; Restricted area ................... 38
3168(P)/20 IN 3037, IN 3038 ... INDIA, East Coast: Dredging area; Channel limits; Buoyage........................... 43
3175(T)/20 823, 826, 833 ...... BURMA: Wreck................................................................................................. 43
13. MALACCA STRAIT, SINGAPORE STRAIT AND SUMATERA
4112(T)/15 2403, 3833, 4039 SINGAPORE STRAIT: Buoy............................................................................ 45
6135(T)/15 2403, 3833, 4039, SINGAPORE STRAIT: Buoyage ...................................................................... 45
4040 ......................
1030(T)/16 1140, 3946............ MALAYSIA, Peninsular Malaysia, West Coast: Obstruction............................ 45
2679(T)/16 2139, 3902, 3946, MALACCA STRAIT: Wreck; Buoyage ............................................................ 45
8233 ......................
2152(T)/17 3831, 3833, 4041 SINGAPORE STRAIT: Buoy............................................................................ 45
4448(P)/17 8232, 8233 ........... MALAYSIA, Peninsular Malaysia, West Coast: Maintained channel............... 45
1401(P)/18 1312, 2422, 2435, INDONESIA, Sumatera: Submarine cables ...................................................... 45, 46, 47,
2436, 2470, 2868, 48
2870, 3902, 3947,
3948 ......................
4349(P)/18 8233 ...................... MALACCA STRAIT: Anchorage areas............................................................. 45
4527(P)/18 8233 ...................... MALACCA STRAIT: Note ............................................................................... 45
4673(P)/18 2470, 2797, 2873, INDONESIA, Sumatera: Submarine cable ........................................................ 45, 46, 60
3729, 3902, 3947
4930(P)/18 8284 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Pilot boarding place .............. 45
461(P)/19 8232, 8233 ........... MALAYSIA, Peninsular Malaysia, West Coast: Dredged depth....................... 45
637(T)/19 3471 ...................... INDONESIA, Sumatera: Buoy .......................................................................... 46
1082(P)/19 8175 ...................... SINGAPORE: Maritime limit............................................................................ 45
1335(T)/19 3949 ...................... INDONESIA, Sumatera: Wreck ........................................................................ 46
1939(P)/19 4035, 4036, 8176 SINGAPORE: Light........................................................................................... 45
2617(P)/19 8177 ...................... SINGAPORE: Light........................................................................................... 45
3166(P)/19 2139, 2153, 8232, MALACCA STRAIT: Berths; Dredged depths; Dredging areas; Pontoon ....... 45
8233 ......................
3628(P)/19 8232 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Note....................................... 45
4676(T)/19 2152, 2155 ........... MALAYSIA, Peninsular Malaysia, West Coast: Buoyage ................................ 45
4755(T)/19 4044 ...................... SINGAPORE: Submarine cable; Works; Buoyage............................................ 45
5772(P)/19 8175 ...................... SINGAPORE: Buoy........................................................................................... 45
5950(P)/19 1312, 2137, 2470, INDONESIA, Sumatera: Submarine cable ........................................................ 46, 48
2870, 2872, 2873,
3721, 3758 ...........
6060(P)/19 1146, 3902, 3946, MALAYSIA, Peninsular Malaysia, West Coast: Depths ................................... 45
3947 ......................
6429(P)/19 8107 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Note....................................... 45
6556(P)/19 8107 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Bridge.................................... 45
1225(P)/20 8177 ...................... SINGAPORE: Dredged depths .......................................................................... 45
1A.21
Wk27/20
IA
13. MALACCA STRAIT, SINGAPORE STRAIT AND SUMATERA - continued
1282(P)/20 8175 ...................... SINGAPORE: Dredged areas; Dredged depths; Jetty ....................................... 45
1558(P)/20 8175 ...................... SINGAPORE: Maritime limits; Buoy ............................................................... 45
1893(T)/20 4030, 4031, 4033, SINGAPORE: Dredging area; Fairway; Works................................................. 45
4038, 4040, 8175
2024(P)/20 3902, 3933, 3940, MALACCA STRAIT: Submarine cable ............................................................ 45
3946, 3947 ...........
2031(P)/20 3833, 4039, 4040, SINGAPORE STRAIT: Anchorage areas.......................................................... 45
5524 ......................
2218(P)/20 3833, 4030, 4031, SINGAPORE: Works ......................................................................................... 45
4033, 4038, 4039,
4040, 8175 ...........
2221(P)/20 3833, 4030, 4038, SINGAPORE: Submarine cables ....................................................................... 45
4039, 4040 ...........
2529(T)/20 3948 ...................... INDONESIA, Sumatera: Wreck ........................................................................ 46
2552(P)/20 4033 ...................... SINGAPORE: Submarine pipeline .................................................................... 45
2629(P)/20 8175, 8176 ........... SINGAPORE: Dredged depths .......................................................................... 45
2741(T)/20 2403, 3833, 3902, INDONESIA, Sumatera: Wreck ........................................................................ 45, 46
3948 ......................
2752(P)/20 8285 ...................... SINGAPORE: Automatic Identification System ............................................... 45
3077(P)/20 8284 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Anchorage area ..................... 45
3141(T)/20 4035, 4040, 4041 SINGAPORE: Obstruction ................................................................................ 45
3164(T)/20 3833, 4039, 4040, SINGAPORE STRAIT: Wrecks ........................................................................ 45
4041 ......................
3306(P)/20 3948 ...................... INDONESIA, Sumatera: Submarine cable ........................................................ 46
14. CHINA SEA WITH ITS WEST SHORE AND CHINA
2855(T)/06 1251 ...................... CHINA, Yellow Sea Coast: Restricted area ....................................................... 52
5172(T)/10 341, 937, 1555, CHINA, South Coast: Obstruction..................................................................... 47, 50
1962, 3026, 4127
3997(T)/12 341, 3026 ............. CHINA, South Coast: Light-beacons................................................................. 47, 50
5137(T)/13 2409 ...................... TAIWAN: Buoyage ............................................................................................ 50
5218(T)/14 67, 2414, 3965 .... THAILAND, Gulf of Thailand Coast: Platforms............................................... 47
650(T)/15 1286, 1287 ........... CHINA, Bo Hai: Restricted area........................................................................ 52
5355(T)/15 1059 ...................... VIETNAM: Dredged area.................................................................................. 47
6200(T)/15 1962, 1968 ........... CHINA, South Coast: Buoy............................................................................... 50
6242(T)/15 3026 ...................... CHINA, South Coast: Wreck ............................................................................. 50
6450(T)/15 1304 ...................... CHINA, East Coast: Wreck................................................................................ 50
6597(P)/15 1250, 1255, 1263, CHINA, Bo Hai: Recommended route .............................................................. 52
1294 ......................
877(P)/16 1254, 1256, 1289, CHINA, Yellow Sea Coast: Precautionary area ................................................. 52
3480 ......................
1407(T)/16 2103, 3879, 3967 GULF OF THAILAND: Platform...................................................................... 47
3206(T)/16 3883, 3987 ........... VIETNAM: Buoyage ......................................................................................... 47
3891(P)/16 8153 ...................... CHINA, Yellow Sea Coast: Note ....................................................................... 52
3897(T)/16 1555, 3488, 3892 CHINA, South Coast: Buoy............................................................................... 47
4494(T)/16 1968, 3489 ........... TAIWAN STRAIT: Buoy................................................................................... 48, 50
4630(T)/16 2103 ...................... GULF OF THAILAND: Buoy........................................................................... 47
4717(P)/16 8170 ...................... CHINA, Yellow Sea Coast: Buoy; Virtual aid to navigation ............................. 52
4948(P)/16 8170 ...................... CHINA, Yellow Sea Coast: Buoyage................................................................. 52
5212(P)/16 8170 ...................... CHINA, Yellow Sea Coast: Buoy; Automatic Identification System ................ 52
5329(P)/16 8159 ...................... CHINA, South Coast: Light-beacons; Lights; Leading lines............................. 47
5455(P)/16 8153 ...................... CHINA, Yellow Sea Coast: Buoyage; Radar beacons ....................................... 52
5686(T)/16 3359 ...................... CHINA, South Coast: Buoyage; Light-beacons ................................................ 47
5927(P)/16 2103 ...................... GULF OF THAILAND: Depths ........................................................................ 47
6043(P)/16 8193 ...................... CHINA, Yellow Sea Coast: Buoy ...................................................................... 52
165(P)/17 8159 ...................... CHINA, South Coast: Lights ............................................................................. 47
1A.22
Wk27/20
IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
491(T)/17 1046, 3727, 3965, THAILAND, Gulf of Thailand Coast: Restricted areas..................................... 47
3966 ......................
1676(T)/17 3893 ...................... CHINA, South Coast: Works ............................................................................. 47
2228(P)/17 8258 ...................... VIETNAM: Wreck............................................................................................. 47
2530(P)/17 8151 ...................... CHINA, Yellow Sea Coast: Channel limits ....................................................... 52
2983(P)/17 8073 ...................... TAIWAN: Note .................................................................................................. 50
3865(T)/17 1144, 1303, 1306. CHINA, East Coast: Works; Breakwater ........................................................... 50
4123(P)/17 2641, 2642, 8142 CHINA, Bo Hai: Works ..................................................................................... 52
4125(P)/17 1130....................... CHINA, East Coast: Works................................................................................ 50
4938(P)/17 8151 ...................... CHINA, Yellow Sea Coast: Notes...................................................................... 52
5746(P)/17 8131 ...................... CHINA, Yellow Sea Coast: Pilot boarding place............................................... 52
5848(P)/17 8167, 8169 ........... CHINA, Yellow Sea Coast: Pilot boarding place............................................... 52
580(T)/18 2422, 3445 ........... MALAYSIA, Peninsular Malaysia, East Coast: Wreck ..................................... 47
1146(P)/18 8131 ...................... CHINA, Yellow Sea Coast: Obstruction; Radio reporting line; Legend............ 52
1180(T)/18 3874 ...................... VIETNAM: Obstruction .................................................................................... 47
1219(P)/18 3875, 3888 ........... VIETNAM: Harbour limit ................................................................................. 47
1600(P)/18 8142 ...................... CHINA, Bo Hai: Pilot boarding place ............................................................... 52
1971(P)/18 8259 ...................... VIETNAM: Note ............................................................................................... 47
1997(P)/18 8155 ...................... CHINA, Bo Hai: Obstructions; Wreck............................................................... 52
2054(T)/18 2410 ...................... CHINA, East Coast: Restricted area; Anchorage area; Channel limits ............. 50
2134(P)/18 3449 ...................... CHINA, East Coast: Fairway; Works................................................................. 50
2358(P)/18 1036, 8258 ........... VIETNAM: Works; Buoyage............................................................................. 47
2361(P)/18 8185 ...................... CHINA, Yellow Sea Coast: Wreck .................................................................... 52
2362(P)/18 8183, 8185 ........... CHINA, Yellow Sea Coast: Note ....................................................................... 52
2725(P)/18 8167 ...................... CHINA, Yellow Sea Coast: Wrecks; Virtual aid to navigation.......................... 52
2765(P)/18 8084 ...................... TAIWAN: Foul................................................................................................... 50
2865(P)/18 8169 ...................... CHINA, Yellow Sea Coast: Fairways ................................................................ 52
3056(T)/18 3875 ...................... VIETNAM: Wreck............................................................................................. 47
3197(P)/18 8170 ...................... CHINA, Yellow Sea Coast: Light-beacons; Leading lines ................................ 52
3200(P)/18 8084 ...................... TAIWAN: Note .................................................................................................. 50
3255(P)/18 8259 ...................... VIETNAM: Note ............................................................................................... 47
3379(P)/18 8155 ...................... CHINA, Bo Hai: Radar beacon.......................................................................... 52
3477(P)/18 8053 ...................... TAIWAN: Lights; Legend.................................................................................. 50
3897(T)/18 3882 ...................... VIETNAM: Wreck............................................................................................. 47
4061(P)/18 2416, 2431 ........... CHINA, East Coast: Vessel traffic service......................................................... 50
4328(T)/18 1281, 1283 ........... CHINA, East Coast: Works................................................................................ 52
4337(T)/18 1249, 1255, 3697 CHINA, Yellow Sea Coast: Buoy ...................................................................... 52
4386(P)/18 1100, 1261, 3986, VIETNAM: Works ............................................................................................. 47
8260 ......................
4935(P)/18 8062 ...................... TAIWAN: Foul................................................................................................... 50
5017(T)/18 1760 ...................... TAIWAN: Buoy.................................................................................................. 50
5121(P)/18 8062 ...................... TAIWAN: Note .................................................................................................. 50
5260(T)/18 2422, 3446, 3482 MALAYSIA, Peninsular Malaysia, East Coast: Wreck ..................................... 47
5372(P)/18 3884 ...................... VIETNAM: Channel; Reclamation area; Lights; Depths; Buoyage; Port 47
development .......................................................................................................
5436(T)/18 3831, 4042, 4043 MALAYSIA, Peninsular Malaysia, East Coast: Buoy; Wreck .......................... 45
5631(P)/18 1965, 3875, 3888, VIETNAM: Dredged areas; Depths; Anchor berths; Buoyage; Pilot boarding 47
3889 ...................... place; Overhead cable; Swept area; Restricted area; Jetties; Harbour limit;
Reclamation areas; Channels .............................................................................
6128(P)/18 8167 ...................... CHINA, Yellow Sea Coast: Buoy; Radar beacon; Automatic Identification 52
System ................................................................................................................
75(T)/19 1965 ...................... VIETNAM: Wreck............................................................................................. 47
1A.23
Wk27/20
IA
433(P)/19 8124 ...................... CHINA, East Coast: Light ................................................................................. 50
506(T)/19 3882 ...................... VIETNAM: Wreck............................................................................................. 47
649(P)/19 8108 ...................... CHINA, Bo Hai: Depths; Pilot boarding places; Works; Coastline; Breakwater; 52
Anchorage areas .................................................................................................
660(P)/19 8219 ...................... CHINA, East Coast: Legend .............................................................................. 50
830(T)/19 2403, 2422, 2869, MALAYSIA, Peninsular Malaysia, East Coast: Buoy; Wreck .......................... 45, 47
3831 ......................
835(P)/19 3879 ...................... VIETNAM: Buoyage ......................................................................................... 47
1028(P)/19 1379 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Breakwater; Lights; Quay; 47
Depths; Maintained channels .............................................................................
1359(P)/19 8193 ...................... CHINA, Yellow Sea Coast: Wrecks ................................................................... 52
1370(P)/19 8143 ...................... CHINA, Bo Hai: Coastline; Legend .................................................................. 52
1488(P)/19 8144 ...................... CHINA, Bo Hai: Channel limits ........................................................................ 52
1528(P)/19 8131 ...................... CHINA, Yellow Sea Coast: Breakwaters; Legends; Coastline; Channel limits 52
1536(T)/19 4117, 4126............ CHINA, South Coast: Works; Channel; Buoyage.............................................. 47
1656(T)/19 2412 ...................... EASTERN CHINA SEA: Buoy ......................................................................... 53
1948(P)/19 341, 343, 4123, CHINA, South Coast: Works; Buoyage; Automatic Identification Systems ..... 47, 50
4129 ......................
1951(P)/19 3026 ...................... CHINA, South Coast: Buoyage; Works; Depths; Automatic Identification 50
Systems; Anchorage area; Channels; Vertical clearances; Restricted areas.......
2128(P)/19 8159 ...................... CHINA, South Coast: Automatic Identification System.................................... 47
2135(P)/19 4128 ...................... CHINA, South Coast: Fairway; Swinging circle; Depths.................................. 50
2178(T)/19 1736 ...................... CHINA, East Coast: Works................................................................................ 50
2624(P)/19 8127 ...................... CHINA, East Coast: Anchorage area ................................................................. 50
2627(P)/19 8259 ...................... VIETNAM: Legend; Maritime limit.................................................................. 47
2660(T)/19 3875, 3888 ........... VIETNAM: Wreck............................................................................................. 47
2690(T)/19 1965, 3875 ........... VIETNAM: Wreck............................................................................................. 47
2723(P)/19 8167, 8170, 8171 CHINA, Yellow Sea Coast: Depths; Works; Fairway ........................................ 52
3109(T)/19 1199, 2412, 3480. CHINA, East Coast: Buoy ................................................................................. 50, 52, 53
3132(P)/19 8145 ...................... CHINA, Bo Hai: Note........................................................................................ 52
3365(P)/19 8217 ...................... CHINA, East Coast: Note .................................................................................. 50
3366(P)/19 8259 ...................... VIETNAM: Note ............................................................................................... 47
3567(T)/19 3882 ...................... VIETNAM: Wreck............................................................................................. 47
3633(P)/19 8073 ...................... TAIWAN: Harbour limits; Legends ................................................................... 50
3797(P)/19 8143 ...................... CHINA, Bo Hai: Maritime limits; Legends ....................................................... 52
3798(P)/19 8155 ...................... CHINA, Bo Hai: Pilot boarding places.............................................................. 52
3880(P)/19 1305 ...................... CHINA, East Coast: Buoyage; Virtual aid to navigation................................... 50
3987(P)/19 1130....................... CHINA, East Coast: Bridge; Vertical clearance................................................. 50
4141(T)/19 3232 ...................... TAIWAN: Works ................................................................................................ 50
4155(T)/19 3889 ...................... VIETNAM: Wrecks ........................................................................................... 47
4195(T)/19 3874 ...................... VIETNAM: Wrecks; Buoyage ........................................................................... 47
4227(P)/19 8193 ...................... CHINA, Yellow Sea Coast: Pilot boarding places ............................................. 52
4270(T)/19 2376 ...................... TAIWAN: Breakwater........................................................................................ 50
4294(P)/19 8258 ...................... VIETNAM: Note ............................................................................................... 47
4524(P)/19 8142 ...................... CHINA, Bo Hai: Works ..................................................................................... 52
4562(T)/19 2426, 3985 ........... GULF OF THAILAND: Wreck ......................................................................... 47
4699(P)/19 8084 ...................... TAIWAN: Depths; Scientific instruments; Foul; Works .................................... 50
4737(P)/19 1304 ...................... CHINA, East Coast: Submarine pipeline........................................................... 50
1A.24
Wk27/20
IA
4796(P)/19 8159 ...................... CHINA, South Coast: Pier ................................................................................. 47
4823(P)/19 8169 ...................... CHINA, Yellow Sea Coast: Jetties; Breakwaters; Depths; Reclamation area ... 52
5019(T)/19 3989, 3990 ........... VIETNAM: Buoy............................................................................................... 47
5101(T)/19 1760, 1968, 2409, TAIWAN: Obstruction ....................................................................................... 48, 50, 53
2412, 3489 ...........
5114(P)/19 8167 ...................... CHINA, Yellow Sea Coast: Virtual aid to navigation ........................................ 52
5171(T)/19 341, 3026, 4129 .. CHINA, South Coast: Works; Buoyage; Reclamation area; Automatic 47, 50
Identification Systems; Depths ..........................................................................
5304(T)/19 1716, 1761, 2401 CHINA, South Coast: Works ............................................................................. 50
5361(P)/19 8124 ...................... CHINA, East Coast: Depths............................................................................... 50
5381(T)/19 343 ........................ CHINA, South Coast: Works ............................................................................. 47
5385(T)/19 2657 ...................... CHINA, Bo Hai: Depth...................................................................................... 52
5571(T)/19 1221 ...................... CHINA, Bo Hai: Dredging area......................................................................... 52
5627(T)/19 1716, 1723, 2401 CHINA, South Coast: Works ............................................................................. 50
5728(T)/19 3889 ...................... VIETNAM: Buoy............................................................................................... 47
6032(P)/19 8062 ...................... TAIWAN: Legends............................................................................................. 50
6149(P)/19 8167, 8168 ........... CHINA, Yellow Sea Coast: Anchorage areas; Buoyage .................................... 52
6157(T)/19 1505, 1506, 8152 CHINA, Yellow Sea Coast: Buoyage; Virtual aid to navigation........................ 52
6180(P)/19 8114....................... CHINA, South Coast: Buoyage ......................................................................... 47
6223(T)/19 3989 ...................... VIETNAM: Buoy............................................................................................... 47
6237(P)/19 8053 ...................... TAIWAN: Depths; Restricted areas; Anchorage area; Wrecks; Virtual aids to 50
navigation; Buoyage; Breakwater ......................................................................
6301(T)/19 3882 ...................... VIETNAM: Wreck; Buoy .................................................................................. 47
6488(T)/19 1505, 1506 ........... CHINA, Yellow Sea Coast: Works; Channel; Restricted area ........................... 52
77(T)/20 2409, 3231 ........... TAIWAN: Spoil ground; Works ......................................................................... 50
121(T)/20 4118....................... CHINA, South Coast: Works ............................................................................. 50
152(T)/20 2403 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Maritime limit ........................ 45
218(T)/20 3882 ...................... VIETNAM: Buoy............................................................................................... 47
337(T)/20 3989, 3990 ........... VIETNAM: Wreck............................................................................................. 47
343(P)/20 8185 ...................... CHINA, Bo Hai: Radio reporting lines; Notes .................................................. 52
344(P)/20 8258, 8259, 8260 VIETNAM: Buoyage; Beacons; Depths; Light; Automatic Identification 47
Systems; Virtual aids to navigation; Wrecks; Overhead cables; Vertical
clearances; Harbour limits..................................................................................
361(T)/20 1059, 1100............ VIETNAM: Wreck............................................................................................. 47
364(T)/20 3658 ...................... TAIWAN: Obstruction; Buoyage ....................................................................... 50
393(T)/20 3875, 3881 ........... VIETNAM: Wreck............................................................................................. 47
433(P)/20 1304, 1305 ........... CHINA, East Coast: Jetty .................................................................................. 50
508(P)/20 8114....................... CHINA, South Coast: Radio reporting lines...................................................... 47
512(P)/20 8111....................... CHINA, Bo Hai: Note........................................................................................ 52
514(T)/20 3232, 4410 ........... TAIWAN: Buoy.................................................................................................. 48, 50
624(T)/20 2376, 8053 ........... TAIWAN: Works ................................................................................................ 50
629(P)/20 1304 ...................... CHINA, East Coast: Pier.................................................................................... 50
668(T)/20 1760, 2409 ........... TAIWAN: Buoyage; Restricted area; Wreck; Works ......................................... 50
726(P)/20 1312, 2403, 2414, MALAYSIA, Peninsular Malaysia, East Coast: Submarine cable..................... 45, 46, 47
2422, 2470, 2869,
3482, 3831 ...........
749(P)/20 1289 ...................... CHINA, Yellow Sea Coast: Light ...................................................................... 52
818(P)/20 1249 ...................... CHINA, Bo Hai: Buoyage ................................................................................. 52
878(T)/20 1374 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Buoy....................................... 47
966(T)/20 1736 ...................... CHINA, South Coast: Bridge; Works ................................................................ 50
980(T)/20 1537, 1555 ........... CHINA, South Coast: Submarine cables ........................................................... 47
1096(T)/20 1537, 1555, 3892 CHINA, South Coast: Submarine cable............................................................. 47
1A.25
Wk27/20
IA
1100(T)/20 1537, 1555 ........... CHINA, South Coast: Works ............................................................................. 47
1188(P)/20 1303, 1304 ........... CHINA, East Coast: Submarine cable ............................................................... 50
1209(P)/20 1130....................... CHINA, East Coast: Works................................................................................ 50
1263(T)/20 3724, 3727, 8273 THAILAND, Gulf of Thailand Coast: Buoyage ................................................ 47
1277(T)/20 2619 ...................... TAIWAN: Works ................................................................................................ 50
1293(P)/20 8141 ...................... CHINA, Bo Hai: Buoy....................................................................................... 52
1509(T)/20 1134....................... CHINA, East Coast: Works................................................................................ 50
1525(P)/20 1059, 1100............ VIETNAM: Works; Jetty ................................................................................... 47
1545(T)/20 4121, 4129 ........... CHINA, South Coast: Dredging area................................................................. 47
1566(P)/20 1199, 1602, 8127. CHINA, East Coast: Vessel traffic service......................................................... 50
1571(P)/20 8108 ...................... CHINA, Bo Hai: Notes ...................................................................................... 52
1602(P)/20 343 ........................ CHINA, South Coast: Depths ............................................................................ 47
1608(P)/20 4124 ...................... CHINA, South Coast: Depths; Reclamation area .............................................. 50
1660(T)/20 1046, 3724, 3727 THAILAND, Gulf of Thailand Coast: Buoyage ................................................ 47
1662(P)/20 8259, 8260 ........... VIETNAM: Radar beacon ................................................................................. 47
1758(P)/20 8193 ...................... CHINA, Yellow Sea Coast: Restricted areas ..................................................... 52
1759(T)/20 3884 ...................... VIETNAM: Buoyage ......................................................................................... 47
1827(T)/20 1199, 2412............ CHINA, East Coast: Buoy ................................................................................. 50, 53
2025(P)/20 3231 ...................... TAIWAN: Depths ............................................................................................... 50
2054(P)/20 8169 ...................... CHINA, Yellow Sea Coast: Lights..................................................................... 52
2075(T)/20 1306 ...................... CHINA, East Coast: Works; Restricted area...................................................... 50
2115(P)/20 8183 ...................... CHINA, Yellow Sea Coast: Berth ...................................................................... 52
2116(P)/20 8141 ...................... CHINA, Bo Hai: Pilot boarding place ............................................................... 52
2216(P)/20 1965, 3875, 3881, VIETNAM: Channels; Buoyage; Depths; Drying heights; Port developments; 47
3882 ...................... Bridges; Works; Harbour limits; Swinging circle; Anchorage areas; Overhead
cables; Light-beacon; Vertical clearances ..........................................................
2225(P)/20 1604, 8124 ........... CHINA, East Coast: Vertical clearance.............................................................. 50
2425(T)/20 1100, 1261, 2414, VIETNAM: Submarine pipeline ........................................................................ 47
3482, 3488, 3986,
3987 ......................
2516(P)/20 8141 ...................... CHINA, Bo Hai: Pilot boarding places.............................................................. 52
2531(T)/20 1505, 1506 ........... CHINA, Yellow Sea Coast: Works..................................................................... 52
2605(T)/20 1039 ...................... VIETNAM: Works; Buoyage............................................................................. 47
2620(T)/20 1505, 1506, 8152 CHINA, Yellow Sea Coast: Pier ........................................................................ 52
2633(T)/20 1505, 1506, 8152 CHINA, Yellow Sea Coast: Works..................................................................... 52
2636(T)/20 3348, 3351, 3892, CHINA, South Coast: Virtual aids to navigation; Buoyage............................... 47
8159 ......................
2676(T)/20 3488, 3989, 3990 CHINA: Works................................................................................................... 47
2677(P)/20 343 ........................ CHINA, South Coast: Depths ............................................................................ 47
2753(P)/20 8183, 8185 ........... CHINA, Yellow Sea Coast: Pilot boarding places ............................................. 52
2764(P)/20 8167 ...................... CHINA, Yellow Sea Coast: Virtual aid to navigation ........................................ 52
2817(P)/20 8053 ...................... TAIWAN: Works ................................................................................................ 50
2819(T)/20 1199, 1304, 1305, CHINA, East Coast: Submarine pipeline........................................................... 50
1759 ......................
2911(P)/20 1221 ...................... CHINA, Bo Hai: Buoyage ................................................................................. 52
3008(P)/20 1761, 3231 ........... TAIWAN: Works ................................................................................................ 50
3016(P)/20 8141, 8145 ........... CHINA, Bo Hai: Pilot boarding places.............................................................. 52
3028(T)/20 1059, 8259 ........... VIETNAM: Works ............................................................................................. 47
3029(P)/20 8167, 8170 ........... CHINA, Yellow Sea Coast: Pilot boarding places ............................................. 52
3030(P)/20 8114....................... CHINA, South Coast: Pilot boarding places...................................................... 47
3063(T)/20 4121, 4129 ........... CHINA, South Coast: Works ............................................................................. 47
3073(P)/20 8218 ...................... CHINA, East Coast: Pilot boarding places ........................................................ 50
1A.26
Wk27/20
IA
3091(P)/20 8216 ...................... CHINA, East Coast: Pilot boarding places ........................................................ 50
3094(P)/20 8111....................... CHINA, Bo Hai: Obstructions; Wreck............................................................... 52
3108(P)/20 8111....................... CHINA, Bo Hai: Obstructions ........................................................................... 52
3122(P)/20 341, 4129 ............. CHINA, South Coast: Marine Reserve; Buoyage; Depths; Obstruction ........... 47
3167(P)/20 2619 ...................... TAIWAN: Depths ............................................................................................... 50
3222(P)/20 1760, 2409, 3231 TAIWAN: Buoyage; Anchorage areas; Works ................................................... 50
3253(P)/20 2618 ...................... TAIWAN: Lights; Buoyage................................................................................ 50
3300(T)/20 344 ........................ CHINA, South Coast: Buoyage ......................................................................... 47
3311(P)/20 4127 ...................... CHINA, South Coast: Submarine cables ........................................................... 50
3331(P)/20 1602 ...................... CHINA, East Coast: Buoyage............................................................................ 50
15. JAPAN
2962(T)/07 JP 1087................... JAPAN, Honshū: Depths.................................................................................... 53
3852(T)/07 JP 87....................... JAPAN, Honshū: Depths.................................................................................... 53
2050(T)/09 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
3781(T)/09 2024, JP 226.......... JAPAN, Nansei Shotō: Depth; Rock.................................................................. 53
4060(T)/09 JP 107..................... JAPAN, Seto Naikai: Obstruction ...................................................................... 54
4209(T)/09 JP 226..................... JAPAN, Nansei Shotō: Depths........................................................................... 53
4523(T)/09 JP 179, JP 187 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
5182(T)/09 JP 1062, JP 1067 .... JAPAN, Honshū: Depths.................................................................................... 53
5469(T)/09 JP 213, JP 1222 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
6128(T)/09 JP 213, JP 1222 ...... JAPAN, Kyūshū: Depth ..................................................................................... 53
803(T)/10 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
2781(T)/10 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 1228...................
3116(T)/10 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
JP 1228...................
3873(T)/10 JP 1101................... JAPAN, Seto Naikai: Depths ............................................................................. 54
5507(T)/10 JP 213..................... JAPAN, Kyūshū: Rock....................................................................................... 53
526(T)/11 JP 153..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
785(T)/11 JP 137A, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
1866(T)/11 JP 104, JP 132 ........ JAPAN, Seto Naikai: Depth ............................................................................... 54
4930(T)/11 JP 131..................... JAPAN, Seto Naikai: Wreck .............................................................................. 54
4931(T)/11 JP 106, JP 131 ........ JAPAN, Seto Naikai: Wreck .............................................................................. 54
5883(T)/11 JP 137A.................. JAPAN, Seto Naikai: Depth ............................................................................... 54
538(T)/12 JP 131..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
640(T)/12 JP 106, JP 137A, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 153.....................
1861(T)/12 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Depths; Drying patch ...................................................... 54
2143(T)/12 JP 1106................... JAPAN, Seto Naikai: Drying patch.................................................................... 54
5697(T)/12 JP 151, JP 1102 ...... JAPAN, Seto Naikai: Depths ............................................................................. 53, 54
981(T)/13 JP 54, JP 1098 ........ JAPAN, Honshū: Obstruction ............................................................................ 55
1029(T)/13 JP 187..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
1909(T)/13 JP 137A.................. JAPAN, Seto Naikai: Rock ................................................................................ 54
2230(T)/13 JP 141..................... JAPAN, Seto Naikai: Rock ................................................................................ 54
2368(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2692(T)/13 JP 151, JP 1102 ...... JAPAN, Shikoku: Depths ................................................................................... 53, 54
1A.27
Wk27/20
IA
15. JAPAN - continued
3042(T)/13 JP 1267................... JAPAN, Kyūshū: Depths.................................................................................... 54
3137(T)/13 JP 106, JP 150A, JAPAN, Seto Naikai: Wreck .............................................................................. 54
JP 150C ..................
3833(T)/13 JP 151, JP 1102 ...... JAPAN, Shikoku: Depths ................................................................................... 53, 54
3834(T)/13 JP 198, JP 1228 ...... JAPAN, Kyūshū: Depth ..................................................................................... 53
4134(T)/13 JP 1222................... JAPAN, Nansei Shotō: Depths........................................................................... 53
5219(T)/13 JP 137A, JP 153 ..... JAPAN, Seto Naikai: Depth ............................................................................... 54
196(T)/14 996, 1648, JP 77, JAPAN, Seto Naikai: Wreck .............................................................................. 53, 54
JP 150C ..................
2751(T)/14 JP 179..................... JAPAN, Honshū: Depths.................................................................................... 53
2916(T)/14 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Depth ............................................................................... 54
3693(T)/14 JP 1169................... JAPAN, Honshū: Depth ..................................................................................... 55
5209(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depth ..................................................................................... 53
33(T)/15 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
1444(T)/15 JP 151, JP 1102 ...... JAPAN, Seto Naikai: Depths ............................................................................. 53, 54
1698(T)/15 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
2083(T)/15 JP 1220................... JAPAN, Kyūshū: Depths.................................................................................... 53
3163(T)/15 JP 108..................... JAPAN, Shikoku: Depth .................................................................................... 53
3552(T)/15 JP 179, JP 187, JAPAN, Kyūshū: Obstruction ............................................................................ 53
JP 1228...................
3553(T)/15 JP 179, JP 198 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
3806(T)/15 JP 93, JP 1051 ........ JAPAN, Honshū: Depth ..................................................................................... 53
4410(T)/15 JP 214B .................. JAPAN, Kyūshū: Obstruction ............................................................................ 53
4924(T)/15 JP 1112A ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
1540(T)/16 JP 145..................... JAPAN, Honshū: Depth ..................................................................................... 55
1773(T)/16 JP 1102................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2705(T)/16 JP 93, JP 1051 ........ JAPAN, Honshū: Depths.................................................................................... 53
3157(T)/16 JP 141, JP 142 ........ JAPAN, Seto Naikai: Depths ............................................................................. 54
3282(T)/16 JP 131, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
4045(T)/16 JP 1192................... JAPAN, Honshū: Obstruction ............................................................................ 55
1A.28
Wk27/20
IA
782(T)/17 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Depths ............................................................................. 54
784(T)/17 JP 187..................... JAPAN, Kyūshū: Wreck..................................................................................... 53
899(T)/17 JP 79....................... JAPAN, Honshū: Obstruction ............................................................................ 55
2162(T)/17 JP 79....................... JAPAN, Honshū: Islets....................................................................................... 55
3351(T)/17 JP 137B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 213.....................
4209(T)/17 JP 127, JP 1101 ...... JAPAN, Seto Naikai: Depths ............................................................................. 54
4214(T)/17 JP 187, JP 213, JAPAN, Kyūshū: Depth ..................................................................................... 53
JP 1222...................
4482(T)/17 JP 179, JP 187, JAPAN, Kyūshū: Wreck..................................................................................... 53
JP 198, JP 213 ........
5216(T)/17 JP 70, JP 1051, JAPAN, Honshū: Depths.................................................................................... 53
JP 1053...................
362(T)/18 JP 1036................... JAPAN, Hokkaidō: Depths ................................................................................ 55
768(T)/18 JP 63....................... JAPAN, Honshū: Obstructions........................................................................... 55
1083(T)/18 JP 79....................... JAPAN, Honshū: Obstructions........................................................................... 55
1507(T)/18 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Obstructions .................................................................... 54
JP 1053, JP 1064 ....
3153(T)/18 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
4745(T)/18 JP 90, JP 1062, JAPAN, Honshū: Drying heights ....................................................................... 53
JP 1081...................
4747(T)/18 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
4869(T)/18 1648, JP 77, JP 108 JAPAN, Honshū: Buoy ...................................................................................... 53
1A.29
Wk27/20
IA
JP 1052, JP 1053,
JP 1064...................
5221(T)/18 JP 137B, JP 153, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 1121...................
5368(T)/18 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
5485(T)/18 JP 1112A, JP 1112B JAPAN, Seto Naikai: Depths ............................................................................. 54
5699(T)/18 JP 149..................... JAPAN, Honshū: Fish trap ................................................................................. 55
5701(T)/18 JP 153, JP 1108 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54
559(T)/19 JP 104, JP 153, JAPAN, Seto Naikai: Depth ............................................................................... 54
JP 1108...................
858(T)/19 JP 31....................... JAPAN, Hokkaidō: Depths ................................................................................ 55
859(T)/19 JP 139..................... JAPAN, Honshū: Depth ..................................................................................... 55
1012(T)/19 JP 1055A................ JAPAN, Honshū: Depths.................................................................................... 53
1208(T)/19 JP 1102, JP 1108 .... JAPAN, Seto Naikai: Depths ............................................................................. 54
2267(T)/19 JP 1033A................ JAPAN, Hokkaidō: Depth .................................................................................. 55
2891(T)/19 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
3255(T)/19 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
3328(T)/19 JP 87, JP 1097 ........ JAPAN, Honshū: Wreck..................................................................................... 53, 55
JP 1081...................
4033(T)/19 JP 1033A................ JAPAN, Hokkaidō: Depths ................................................................................ 55
4399(T)/19 JP 1120................... JAPAN, Seto Naikai: Works............................................................................... 54
4608(T)/19 JP 142, JP 1108 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54
5753(T)/19 JP 148..................... JAPAN, Honshū: Obstructions........................................................................... 55
5880(T)/19 JP 226..................... JAPAN, Nansei Shotō: Depths........................................................................... 53
6045(T)/19 JP 150A.................. JAPAN: Depths .................................................................................................. 54
6048(T)/19 JP 150A.................. JAPAN: Depths .................................................................................................. 54
37(P)/20 JP 90, JP 1061 ........ JAPAN, Honshū: Restricted area ....................................................................... 53
179(T)/20 JP 1088................... JAPAN, Honshū: Buoyage ................................................................................. 53
1A.30
Wk27/20
IA
318(T)/20 JP 70, JP 1051, JAPAN, Honshū: Obstruction ............................................................................ 53
JP 1052...................
319(T)/20 JP 1146................... JAPAN, Seto Naikai: Obstruction ...................................................................... 54
700(T)/20 JP 1030................... JAPAN, Hokkaidō: Firing practice area............................................................. 55
1124(T)/20 JP 5......................... JAPAN, Hokkaidō: Obstruction......................................................................... 55
1125(T)/20 1648, JP 108, JAPAN, Shikoku: Buoy...................................................................................... 53
JP 1220...................
1127(T)/20 JP 1227................... JAPAN, Kyūshū: Depth ..................................................................................... 53
JP 1081...................
1477(T)/20 JP 1265................... JAPAN, Seto Naikai: Depth; Rock .................................................................... 54
1649(T)/20 JP 135, JP 1262, JAPAN, Seto Naikai: Works; Vertical clearance ................................................ 54
JP 1263...................
1784(T)/20 JP 1150................... JAPAN, Seto Naikai: Obstructions .................................................................... 54
1786(T)/20 JP 190, JP 1227 ...... JAPAN, Kyūshū: Drying heights ....................................................................... 53
2014(T)/20 JP 90, JP 1061, JAPAN, Honshū: Light-beacon.......................................................................... 53
JP 1065...................
2015(T)/20 JP 1110 ................... JAPAN, Seto Naikai: Vertical clearance ............................................................ 54
2017(T)/20 JP 101A.................. JAPAN, Seto Naikai: Works............................................................................... 54
2204(T)/20 JP 1030, JP 1034, JAPAN, Hokkaidō: Obstruction......................................................................... 55
JP 1036...................
2205(T)/20 JP 1057A................ JAPAN, Honshū: Works..................................................................................... 53
2207(T)/20 JP 1051, JP 1052, JAPAN, Honshū: Submarine pipeline; Works.................................................... 53
JP 1053...................
2208(T)/20 JP 123, JP 1103, JAPAN, Seto Naikai: Restricted area ................................................................. 54
JP 1146...................
2277(T)/20 JP 1055A................ JAPAN, Honshū: Works..................................................................................... 53
2279(T)/20 JP 127, JP 128 ........ JAPAN, Seto Naikai: Works............................................................................... 54
2280(T)/20 JP 127, JP 1101 ...... JAPAN, Seto Naikai: Works............................................................................... 54
2407(T)/20 2347, 3480, JP 149 JAPAN, Honshū: Works..................................................................................... 52, 53, 55
2592(T)/20 JP 31....................... JAPAN, Hokkaidō: Works.................................................................................. 55
2594(T)/20 JP 1065................... JAPAN, Honshū: Restricted area; Works; Beacons; Buoyage ........................... 53
2699(T)/20 JP 1155B ................ JAPAN, Honshū: Depths.................................................................................... 55
2700(T)/20 JP 53....................... JAPAN, Honshū: Buoy ...................................................................................... 55
2701(P)/20 JP 1100................... JAPAN, Honshū: Leading lights ........................................................................ 55
2801(T)/20 JP 148, JP 1192 ...... JAPAN, Honshū: Works..................................................................................... 55
1A.31
Wk27/20
IA
2802(T)/20 JP 1097, JP 1098 .... JAPAN, Honshū: Works..................................................................................... 55
2803(P)/20 JP 66, JP 90, JP 1061, JAPAN, Honshū: Restricted area; Works; Beacons; Buoyage ........................... 53
JP 1062, JP 1085 ....
2804(T)/20 JP 70, JP 1051, JAPAN, Honshū: Buoy; Virtual aid to navigation ............................................. 53
JP 1052, JP 1053,
JP 1064...................
2805(P)/20 996, 1648, JP 93... JAPAN, Honshū: Buoyage ................................................................................. 53
2808(T)/20 JP 134B .................. JAPAN, Seto Naikai: Works............................................................................... 54
2937(P)/20 JP 28....................... JAPAN, Hokkaidō: Submarine cable ................................................................. 55
2938(P)/20 JP 66, JP 90, JP 1061, JAPAN, Honshū: Buoyage; Beacons ................................................................. 53
JP 1062, JP 1085,
JP 5510...................
2939(P)/20 JP 1107................... JAPAN, Seto Naikai: Jetty ................................................................................. 54
2944(T)/20 JP 126, JP 1106 ...... JAPAN, Seto Naikai: Dredging area .................................................................. 54
2945(T)/20 JP 135, JP 1262, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1263...................
2946(T)/20 JP 190, JP 1227 ...... JAPAN, Kyūshū: Works..................................................................................... 53
3045(T)/20 1800, 1803, 2293, JAPAN, Hokkaidō: General information ........................................................... 55
JP 1030, JP 1032 ....
3046(P)/20 JP 1195................... JAPAN, Honshū: Buoyage; Landmark .............................................................. 55
3047(T)/20 JP 1100................... JAPAN, Honshū: Works..................................................................................... 55
3049(P)/20 JP 1065................... JAPAN, Honshū: Lights; Dolphins; Piles; Buoyage .......................................... 53
3201(T)/20 JP 10, JP 1195 ........ JAPAN, Hokkaidō: Works.................................................................................. 55
3202(P)/20 JP 179, JP 201, JAPAN, Honshū: Submarine power cable ......................................................... 53, 54
JP 1266...................
3203(T)/20 JP 1162B ................ JAPAN, Honshū: Works..................................................................................... 55
3204(T)/20 JP 1155A ................ JAPAN, Honshū: Works..................................................................................... 55
3206(T)/20 JP 1103, JP 1141 .... JAPAN, Seto Naikai: Works............................................................................... 54
3207(T)/20 JP 1103, JP 1110..... JAPAN, Seto Naikai: Works............................................................................... 54
3209(T)/20 JP 214A, JP 214B... JAPAN, Kyūshū: Works..................................................................................... 53
3290(T)/20 JP 142, JP 1112A.... JAPAN, Seto Naikai: Obstructions .................................................................... 54
3291(T)/20 JP 126, JP 1106, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1133C ................
3292(T)/20 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
3293(T)/20 JP 1227................... JAPAN, Kyūshū: Works..................................................................................... 53
16. KOREA AND THE PACIFIC COASTS OF RUSSIA
2427(T)/13 1802, 1803 ........... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 55
1933(T)/14 1230 ...................... RUSSIA, Pacific Ocean Coast: Wreck............................................................... 56
2746(T)/14 3340 ...................... RUSSIA, Pacific Ocean Coast: Restricted area ................................................. 56
5489(P)/15 8093 ...................... RUSSIA, Pacific Ocean Coast: Restricted area; Anchorage area; Legend ........ 56
5747(T)/15 3045, 3046 ........... RUSSIA, Pacific Ocean Coast: Beacon ............................................................. 56
6652(P)/15 8093 ...................... RUSSIA, Pacific Ocean Coast: Radar beacon ................................................... 56
3546(T)/16 2432 ...................... RUSSIA, Pacific Ocean Coast: Mooring buoy .................................................. 56
3868(P)/16 8238 ...................... RUSSIA, Pacific Ocean Coast: Pilot boarding places; Precautionary area; 56
Pilotage...............................................................................................................
1A.32
Wk27/20
IA
16. KOREA AND THE PACIFIC COASTS OF RUSSIA - continued
955(T)/17 4512 ...................... RUSSIA, Pacific Ocean Coast: Obstructions; Area to be avoided .................... 56
1295(T)/17 3044 ...................... RUSSIA, Pacific Ocean Coast: Mooring buoy .................................................. 56
2109(T)/17 3391 ...................... KOREA, South Coast: Buoyage ........................................................................ 52
2551(P)/17 8238 ...................... RUSSIA, Pacific Ocean Coast: Note ................................................................. 56
4051(P)/17 8093 ...................... RUSSIA, Pacific Ocean Coast: Obstruction ...................................................... 56
5205(P)/17 8238 ...................... RUSSIA, Pacific Ocean Coast: Restricted area; Legend ................................... 56
1076(T)/18 3041, 8063 ........... RUSSIA, Pacific Ocean Coast: Works............................................................... 56
3252(T)/18 3041 ...................... RUSSIA, Pacific Ocean Coast: Buoyage........................................................... 56
4188(T)/18 3044, 8093 ........... RUSSIA, Pacific Ocean Coast: Restricted areas................................................ 56
4192(T)/18 3044, 8093 ........... RUSSIA, Pacific Ocean Coast: Wrecks ............................................................. 56
4193(T)/18 3044, 8093 ........... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 56
5202(P)/18 8063 ...................... RUSSIA, Pacific Ocean Coast: Anchorage area; Maritime limit ...................... 56
5468(P)/18 8063 ...................... RUSSIA, Pacific Ocean Coast: Notes................................................................ 56
6031(T)/18 4511, 4512............ RUSSIA, Pacific Ocean Coast: Measuring instruments .................................... 55, 56
212(T)/19 2128 ...................... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 56
867(T)/19 3039 ...................... RUSSIA, Pacific Ocean Coast: Floating dock................................................... 56
1027(T)/19 1259 ...................... KOREA, South Coast: Buoy.............................................................................. 52
2344(T)/19 4511, 4512............ RUSSIA, Pacific Ocean Coast: Measuring instruments .................................... 55, 56
2345(T)/19 3044, 8093 ........... RUSSIA, Pacific Ocean Coast: Works............................................................... 56
3371(P)/19 8093 ...................... RUSSIA, Pacific Ocean Coast: Legend; Quarantine anchorages ...................... 56
3765(P)/19 1065 ...................... KOREA, South Coast: Radar beacons; Beacon; Light-beacons ........................ 52
4819(T)/19 127, 3666 ............. KOREA, East Coast: Buoy ................................................................................ 52, 53
5630(T)/19 1271 ...................... KOREA, West Coast: Buoyage.......................................................................... 52
6063(T)/19 3044, 8093 ........... RUSSIA, Pacific Ocean Coast: Buoyage........................................................... 56
6200(P)/19 8063 ...................... RUSSIA, Pacific Ocean Coast: Coastline; Legend............................................ 56
507(T)/20 3928 ...................... KOREA, West Coast: Buoy ............................................................................... 52
636(T)/20 1163....................... KOREA, South Coast: Buoyage ........................................................................ 52
748(P)/20 127, 1065, 1259, KOREA, West Coast: Submarine cable ............................................................. 52, 53
3480, 3666 ...........
2109(P)/20 1271 ...................... KOREA, West Coast: Buoyage.......................................................................... 52
2540(T)/20 3666 ...................... KOREA, East Coast: Buoy ................................................................................ 52
2783(P)/20 8238 ...................... RUSSIA, Pacific Ocean Coast: Harbour limits; Legend ................................... 56
2813(T)/20 127, 913, 1256, KOREA, West Coast: Scientific instruments ..................................................... 52, 53
1258, 1270, 3365,
3391, 3928 ...........
2982(P)/20 3391 ...................... KOREA, South Coast: Radio reporting line ...................................................... 52
3006(P)/20 127, 1065 ............. KOREA, South Coast: Quarantine anchorage ................................................... 52, 53
3013(T)/20 127, 896, 3666 .... KOREA, East Coast: Buoy ................................................................................ 52, 53
3032(T)/20 127, 1065, 1259 .. KOREA, South Coast: Buoyage ........................................................................ 52, 53
3133(T)/20 1270 ...................... KOREA, West Coast: Buoyage.......................................................................... 52
3279(T)/20 1256, 1258 ........... KOREA, West Coast: Buoy ............................................................................... 52
3323(T)/20 127, 896, 898, KOREA, East Coast: Automatic Identification System; Buoyage..................... 52, 53
3480, 3666 ...........
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA
2773(T)/15 1748 ...................... MALAYSIA, Sarawak: Works........................................................................... 48
4102(P)/15 1338, 2109, 2111. BRUNEI: Submarine pipeline; Works ............................................................... 48
1103(T)/16 2134 ...................... BRUNEI: Beacon; Buoy .................................................................................... 48
4195(P)/16 1420, 2786, 3751 INDONESIA, Molucca Sea: Submarine cables................................................. 58
5926(P)/16 8068 ...................... PHILIPPINE ISLANDS, Luzon: Buoy; Wreck ................................................. 48
1256(T)/17 2109 ...................... BRUNEI: Buoy .................................................................................................. 48
3651(P)/17 1293, 2471 ........... INDONESIA, Molucca Sea: Submarine cables................................................. 59
4085(T)/17 2056, 2797, 2862, INDONESIA, Java Sea: Buoy ........................................................................... 46, 60
3729 ......................
4408(P)/17 8068 ...................... PHILIPPINE ISLANDS, Luzon: Buoyage ........................................................ 48
1A.33
Wk27/20
IA
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA - continued
4899(T)/17 3931, 3932 ........... PHILIPPINE ISLANDS, Luzon: Buoy.............................................................. 48
5479(P)/17 8068 ...................... PHILIPPINE ISLANDS, Luzon: Anchor berths................................................ 48
5784(P)/17 8068 ...................... PHILIPPINE ISLANDS, Luzon: Restricted area .............................................. 48
5867(P)/17 8068 ...................... PHILIPPINE ISLANDS, Luzon: Note .............................................................. 48
711(T)/18 921 ........................ INDONESIA, Jawa: Light-beacon..................................................................... 60
2954(P)/18 1338, 1844, 2109, BRUNEI: Works; Submarine cable.................................................................... 48
3483 ......................
3280(P)/18 3747, 3749 ........... INDONESIA, Papua: Works; Dredging area; Platforms; Submarine pipeline .. 58
3510(T)/18 3626 ...................... MALAYSIA, Sabah: Works............................................................................... 48
4195(T)/18 945, 2796, 2876 .. INDONESIA, Java Sea: Buoy ........................................................................... 60
4332(P)/18 3931, 3932 ........... PHILIPPINE ISLANDS, Luzon: Fish haven..................................................... 48
5212(P)/18 8068 ...................... PHILIPPINE ISLANDS, Luzon: Coastline; Legends; Wreck ........................... 48
5227(T)/18 2638, 2893, 2894 INDONESIA, Sulawesi: General information................................................... 58, 59
5672(T)/18 975, 977, 978 ...... INDONESIA, Jawa: Buoy ................................................................................. 60
905(P)/19 8068 ...................... PHILIPPINE ISLANDS, Luzon: Note .............................................................. 48
1489(T)/19 2470, 2797, 2862 INDONESIA, Java Sea: Buoy ........................................................................... 46, 60
1567(T)/19 1338, 2111, 2112. MALAYSIA, Sabah: Buoy ................................................................................ 48
2217(P)/19 1844, 2134 ........... BRUNEI: Works; Lights; Channel; Piles; Restricted areas ............................... 48
2861(T)/19 1338, 2109, 3483, BRUNEI: Scientific instruments........................................................................ 48
3838 ......................
3427(T)/19 3482, 3483 ........... MALAYSIA, Sarawak: Offshore installations................................................... 47, 48
3465(P)/19 983 ........................ PHILIPPINE ISLANDS, Luzon: Buoyage ........................................................ 48
4255(T)/19 3931, 3932 ........... PHILIPPINE ISLANDS, Luzon: Scientific instrument..................................... 48
5307(P)/19 921, 979 ............... INDONESIA, Jawa: Buoyage............................................................................ 60
5696(P)/19 918 ........................ INDONESIA, Jawa: Works; Spoil ground......................................................... 60
5957(P)/19 8056 ...................... INDONESIA, Jawa: Anchorage areas ............................................................... 60
6173(T)/19 1844, 2134 ........... BRUNEI: Buoy; Light-beacons ......................................................................... 48
6188(T)/19 1066, 1312, 2470, INDONESIA, Kalimantan: Wreck..................................................................... 46, 60
2872, 3757, 3758
6398(T)/19 1822 ...................... MALAYSIA, Sarawak: Buoy ............................................................................ 48
950(T)/20 2137, 2873 ........... INDONESIA, Java Sea: Wreck.......................................................................... 46
1276(T)/20 1338, 2109 ........... BRUNEI: Jetty; Works....................................................................................... 48
1542(P)/20 2471, 2893 ........... INDONESIA, Kalimantan: Works; Offshore installation; Pipe......................... 59
1543(T)/20 2099 ...................... INDONESIA, Kalimantan: Obstruction ............................................................ 59
1992(T)/20 2473, 2791, 2916, INDONESIA, Banda Sea: Scientific instruments .............................................. 60, 63
4721, Aus 310 .......
2044(T)/20 162 ........................ MALAYSIA, Sarawak: Buoy ............................................................................ 48
2630(P)/20 8068 ...................... PHILIPPINE ISLANDS, Luzon: Lights; Landmark ......................................... 48
2770(P)/20 909, 918 ............... INDONESIA, Jawa: Works; Spoil ground......................................................... 46, 60
2779(T)/20 1338, 2109 ........... BRUNEI: Extraction area; Buoyage .................................................................. 48
3065(P)/20 1066, 2470, 2797, INDONESIA, Jawa: Submarine cables.............................................................. 46, 60
3730 ......................
18. AUSTRALIA AND PAPUA NEW GUINEA
3900(T)/11 Aus 252 .................. AUSTRALIA, Queensland: Depths................................................................... 66
1977(T)/14 Aus 256 .................. AUSTRALIA, Queensland: Scientific instrument; Buoy.................................. 66
5328(P)/15 Aus 318, Aus 319... AUSTRALIA, Western Australia: Depths ......................................................... 63
929(T)/16 Aus 170, Aus 766... AUSTRALIA, Tasmania: Scientific instruments............................................... 65
1776(T)/16 Aus 252, Aus 824... AUSTRALIA, Queensland: Wreck.................................................................... 66
2369(T)/16 Aus 194 .................. AUSTRALIA, New South Wales: Restricted area............................................. 65
3414(T)/16 Aus 242 .................. AUSTRALIA, Queensland: Depth .................................................................... 66
3415(T)/16 Aus 136 .................. AUSTRALIA, South Australia: Works .............................................................. 65
3614(T)/16 Aus 255, Aus 825, AUSTRALIA, Queensland: Scientific instruments ........................................... 66
Aus 826 ..................
3938(T)/16 Aus 813 .................. AUSTRALIA, New South Wales: Obstructions ................................................ 66
3946(T)/16 Aus 327, Aus 328... AUSTRALIA, Western Australia: Scientific instruments.................................. 63
5477(T)/16 Aus 130, Aus 485, AUSTRALIA, South Australia: Obstruction ..................................................... 65
Aus 781 ..................
1A.34
Wk27/20
IA
18. AUSTRALIA AND PAPUA NEW GUINEA - continued
5541(P)/16 Aus 320, Aus 323... AUSTRALIA, Western Australia: Depths ......................................................... 63
1606(T)/17 Aus 238 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
1609(T)/17 Aus 4 ...................... AUSTRALIA, Queensland: Buoy ..................................................................... 63
1993(T)/17 Aus 242 .................. AUSTRALIA, Queensland: Buoyage; Light-beacons ....................................... 66
1998(T)/17 Aus 154 .................. AUSTRALIA, Victoria: Works; Buoyage.......................................................... 65
2760(T)/17 Aus 255, Aus 826... AUSTRALIA, Queensland: Depths; Obstructions; Buoyage; Light-beacons ... 66
3038(P)/17 Aus 778 .................. AUSTRALIA, South Australia: Depths............................................................. 65
3039(T)/17 Aus 139, Aus 781... AUSTRALIA, South Australia: Works .............................................................. 65
3041(T)/17 Aus 485, Aus 780... AUSTRALIA, South Australia: Restricted area; Hulk ...................................... 65
3517(T)/17 Aus 81 .................... AUSTRALIA, Western Australia: Marine farm; Buoyage; Works.................... 64
3534(P)/17 Aus 821, Aus 824, AUSTRALIA, Queensland: Depths................................................................... 66
Aus 825 ..................
3540(T)/17 Aus 237 .................. AUSTRALIA, Queensland: Virtual aid to navigation ....................................... 66
3980(T)/17 Aus 754 .................. AUSTRALIA, Western Australia: Scientific instrument; Buoy ........................ 64
4467(P)/17 Aus 270 .................. AUSTRALIA, Queensland: Depths................................................................... 66
4470(T)/17 Aus 242 .................. AUSTRALIA, Queensland: Restricted area ...................................................... 66
4738(T)/17 Aus 110 .................. AUSTRALIA, Western Australia: Scientific instrument ................................... 64
5441(P)/17 Aus 270, Aus 280, AUSTRALIA, Queensland: Depths................................................................... 66
Aus 281, Aus 833,
Aus 834 ..................
5635(T)/17 Aus 197, Aus 200, AUSTRALIA, New South Wales: Scientific instruments.................................. 65, 66
Aus 808 ..................
5856(T)/17 Aus 255 .................. AUSTRALIA, Queensland: Buoyage ................................................................ 66
5857(P)/17 Aus 377 .................. AUSTRALIA, Queensland: Reefs ..................................................................... 66
1358(T)/18 Aus 153, Aus 157... AUSTRALIA, Victoria: Buoyage; Virtual aids to navigation ........................... 65
1802(T)/18 Aus 242 .................. AUSTRALIA, Queensland: Wreck.................................................................... 66
2708(T)/18 Aus 235, Aus 236, AUSTRALIA, Queensland: Scientific instruments; Buoyage........................... 66
Aus 814, Aus 815...
3004(T)/18 Aus 235, Aus 236... AUSTRALIA, Queensland: Buoy ..................................................................... 66
3215(T)/18 Aus 238 .................. AUSTRALIA, Queensland: Works.................................................................... 66
3217(T)/18 Aus 172 .................. AUSTRALIA, Tasmania: Wreck ....................................................................... 65
3220(P)/18 Aus 621 .................. PAPUA NEW GUINEA: Depths ....................................................................... 66
3494(T)/18 Aus 236 .................. AUSTRALIA, Queensland: Scientific instrument............................................. 66
4215(T)/18 Aus 130, Aus 137... AUSTRALIA, South Australia: Works .............................................................. 65
4509(P)/18 Aus 270 .................. AUSTRALIA, Queensland: Depths................................................................... 66
4510(T)/18 Aus 795, Aus 796... AUSTRALIA, Tasmania: Buoy ......................................................................... 65
4719(T)/18 4620, 4621, 4622, PAPUA NEW GUINEA: Fish traps ................................................................... 66, 67
Aus 386, Aus 521,
Aus 522, Aus 523...
4723(T)/18 4622 ...................... PAPUA NEW GUINEA: Fish traps ................................................................... 67
5732(T)/18 Aus 238 .................. AUSTRALIA, Queensland: Obstruction ........................................................... 66
6175(T)/18 Aus 171, Aus 173, AUSTRALIA, Tasmania: Scientific instruments............................................... 65
Aus 795, Aus 796...
340(T)/19 Aus 715 .................. AUSTRALIA, Northern Territory: Scientific instruments ................................ 63
343(T)/19 Aus 236 .................. AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
771(T)/19 Aus 163 .................. AUSTRALIA, Tasmania: Works........................................................................ 65
950(T)/19 Aus 257 .................. AUSTRALIA, Queensland: Obstruction; Buoy ................................................ 66
1191(P)/19 Aus 367, Aus 822... AUSTRALIA, Queensland: Depths................................................................... 66
1223(T)/19 Aus 171, Aus 796... AUSTRALIA, Tasmania: Scientific instruments............................................... 65
1224(T)/19 Aus 237 .................. AUSTRALIA, Queensland: Works; Restricted area; Buoyage.......................... 66
1228(T)/19 Aus 257 .................. AUSTRALIA, Queensland: Obstruction; Buoyage ........................................... 66
1506(P)/19 Aus 389 .................. PAPUA NEW GUINEA: Depths ....................................................................... 67
1A.35
Wk27/20
IA
2363(P)/19 PNG 646 ................ PAPUA NEW GUINEA: Depths ....................................................................... 67
2526(T)/19 Aus 256, Aus 257... AUSTRALIA, Queensland: Obstruction; Buoy ................................................ 66
2529(T)/19 Aus 328 .................. AUSTRALIA, Western Australia: Buoyage ...................................................... 63
2533(T)/19 Aus 26, Aus 28....... AUSTRALIA, Northern Territory: Scientific instruments ................................ 63
2534(T)/19 Aus 4 ...................... AUSTRALIA, Queensland: Works.................................................................... 63
2626(T)/19 PNG 643 ................ PAPUA NEW GUINEA: Buoy .......................................................................... 67
3035(T)/19 Aus 238 .................. AUSTRALIA, Queensland: Buoy; Jetty............................................................ 66
3038(T)/19 Aus 777 .................. AUSTRALIA, South Australia: Works .............................................................. 65
3040(T)/19 Aus 238 .................. AUSTRALIA, Queensland: Works; Buoyage.................................................... 66
3490(P)/19 Aus 115 .................. AUSTRALIA, Western Australia: Depths ......................................................... 64
3499(T)/19 Aus 4 ...................... AUSTRALIA, Queensland: Scientific instruments ........................................... 63
3507(T)/19 Aus 53 .................... AUSTRALIA, Western Australia: Scientific instruments.................................. 63
3790(T)/19 Aus 249, Aus 250... AUSTRALIA, Queensland: Restricted area ...................................................... 66
3794(T)/19 Aus 262 .................. AUSTRALIA, Queensland: Dredging area ....................................................... 66
4070(T)/19 Aus 173, Aus 795, AUSTRALIA, Tasmania: Buoyage.................................................................... 65
Aus 796 ..................
4072(T)/19 Aus 4, Aus 301....... AUSTRALIA, Queensland: Tidal gauge; Buoy................................................. 63
4074(T)/19 Aus 262, Aus 263, AUSTRALIA, Queensland: Scientific instruments; Buoyage; Light-beacons.. 66
Aus 830 ..................
4076(T)/19 Aus 15 .................... AUSTRALIA, Northern Territory: Buoy........................................................... 66
4078(T)/19 Aus 347 .................. AUSTRALIA, South Australia: Wreck.............................................................. 65
4080(T)/19 Aus 140, Aus 348, AUSTRALIA, Victoria: Scientific instruments ................................................. 65
Aus 349 ..................
4527(T)/19 Aus 244, Aus 271... AUSTRALIA, Queensland: Dolphin ................................................................. 66
4888(P)/19 Aus 32 .................... AUSTRALIA, Western Australia: Depths; Drying height................................. 63
5106(T)/19 2472, 4721, Aus 312 AUSTRALIA, Western Australia: Tanker mooring buoy; Radar beacon .......... 58, 60, 63
5154(T)/19 Aus 151, Aus 152... AUSTRALIA, Victoria: Depths......................................................................... 65
5495(T)/19 Aus 328 .................. AUSTRALIA, Western Australia: Buoyage ...................................................... 63
5512(T)/19 Aus 379, PNG 378. PAPUA NEW GUINEA: Works......................................................................... 67
5893(T)/19 Aus 59 .................... AUSTRALIA, Western Australia: Buoy ............................................................ 63
6087(T)/19 Aus 117 .................. AUSTRALIA, Western Australia: Obstruction; Buoy ....................................... 64
6152(P)/19 Aus 262, Aus 263... AUSTRALIA, Queensland: Works.................................................................... 66
6448(T)/19 Aus 153 .................. AUSTRALIA, Victoria: Works .......................................................................... 65
47(P)/20 Aus 255 .................. AUSTRALIA, Queensland: Depth .................................................................... 66
48(T)/20 Aus 242 .................. AUSTRALIA, Queensland: Obstruction; Buoy ................................................ 66
59(T)/20 Aus 55, Aus 326..... AUSTRALIA, Western Australia: Measuring instrument ................................. 63
63(T)/20 Aus 110 .................. AUSTRALIA, Western Australia: Works; Buoyage .......................................... 64
67(T)/20 Aus 57, Aus 327, AUSTRALIA, Western Australia: Obstruction.................................................. 63
Aus 742 ..................
70(P)/20 Aus 197, Aus 200, AUSTRALIA, New South Wales: Submarine cables ........................................ 65, 66, 67,
Aus 379, Aus 621, 68
Aus 808, SLB 101,
SLB 102, SLB 106,
SLB 201, SLB 301,
SLB 302, SLB 303,
SLB 304 .................
73(P)/20 Aus 332 .................. AUSTRALIA, Western Australia: Depths ......................................................... 64
1A.36
Wk27/20
IA
311(T)/20 Aus 171, Aus 795, AUSTRALIA, Tasmania: Scientific instruments............................................... 65
Aus 796 ..................
730(T)/20 Aus 357, Aus 487, AUSTRALIA, Victoria: Buoyage ...................................................................... 65
Aus 802 ..................
732(T)/20 Aus 153 .................. AUSTRALIA, Victoria: Scientific instrument; Buoy ........................................ 65
819(T)/20 4620, 4621, PAPUA NEW GUINEA: Submarine cable ........................................................ 66, 67
Aus 379, Aus 621,
PNG 622 ................
1201(T)/20 Aus 357, Aus 487... AUSTRALIA, Victoria: Buoy............................................................................ 65
1521(T)/20 Aus 244, Aus 271... AUSTRALIA, Queensland: Works.................................................................... 66
1719(T)/20 Aus 754 .................. AUSTRALIA, Western Australia: Scientific instruments.................................. 64
1726(T)/20 Aus 140, Aus 349... AUSTRALIA, Victoria: Scientific instruments ................................................. 65
1733(T)/20 4723, Aus 328 ....... AUSTRALIA, Western Australia: Works .......................................................... 63
1734(T)/20 Aus 256, Aus 257, AUSTRALIA, Queensland: Works; Light-beacon; Buoyage ............................ 66
Aus 827 ..................
1735(T)/20 Aus 244, Aus 245, AUSTRALIA, Queensland: Works; Pontoon; Lights ........................................ 66
Aus 271, Aus 272,
Aus 819 ..................
1982(T)/20 Aus 819 .................. AUSTRALIA, Queensland: Buoyage ................................................................ 66
1987(T)/20 Aus 200, Aus 202... AUSTRALIA, New South Wales: Light-beacon; Obstructions......................... 65
1988(T)/20 Aus 839 .................. AUSTRALIA, Queensland: Scientific instruments ........................................... 66
2003(T)/20 Aus 293, Aus 299... AUSTRALIA, Queensland: Works.................................................................... 66
2224(P)/20 PNG 554, PNG 680 PAPUA NEW GUINEA: Depths ....................................................................... 67
2227(P)/20 PNG 512 ................ PAPUA NEW GUINEA: Depths ....................................................................... 67
2263(T)/20 4601, 4644, AUSTRALIA, Victoria: Scientific instruments ................................................. 65, 71
Aus 357, Aus 487,
Aus 802 ..................
2288(P)/20 Aus 130, Aus 137, AUSTRALIA, South Australia: Works; Light-beacons; Automatic 65
Aus 138, Aus 781... Identification Systems; Virtual aids to navigation .............................................
2498(P)/20 Aus 53, Aus 326..... AUSTRALIA, Western Australia: Anchor berths .............................................. 63
2504(T)/20 Aus 238 .................. AUSTRALIA, Queensland: Vertical clearance; Lights ..................................... 66
2711(T)/20 Aus 327, Aus 328... AUSTRALIA, Western Australia: Buoy ............................................................ 63
2712(T)/20 Aus 257 .................. AUSTRALIA, Queensland: Berths.................................................................... 66
2719(T)/20 Aus 349 .................. AUSTRALIA, Victoria: Buoyage ...................................................................... 65
2723(T)/20 4723, 4725, AUSTRALIA, Western Australia: Moored storage tanker ................................ 63, 64
Aus 328, Aus 329...
2899(T)/20 Aus 154 .................. AUSTRALIA, Victoria: Works .......................................................................... 65
2902(T)/20 Aus 244, Aus 245, AUSTRALIA, Queensland: Buoyage ................................................................ 66
Aus 271 ..................
3166(T)/20 Aus 172 .................. AUSTRALIA, Tasmania: Pipe; Buoyage .......................................................... 65
3213(T)/20 Aus 143, Aus 155... AUSTRALIA, Western Australia: Platform....................................................... 65
3215(T)/20 Aus 172 .................. AUSTRALIA, Tasmania: Works........................................................................ 65
19. NEW ZEALAND
4775(P)/17 NZ 6612 ................. NEW ZEALAND, South Island: Depths ........................................................... 72
350(T)/19 NZ 5322, NZ 5323. NEW ZEALAND, North Island: Works ............................................................ 71
3737(T)/19 NZ 5322, NZ 5323. NEW ZEALAND, North Island: Works; Buoyage ............................................ 71
20. PACIFIC OCEAN
5211(T)/11 4510 ...................... NORTH PACIFIC OCEAN: Buoy..................................................................... 53
3021(T)/12 4621, 4623, 4634 SOUTH PACIFIC OCEAN: Fish havens........................................................... 66, 68
679(T)/14 1494, 1570, 1576 SOUTH PACIFIC OCEAN, Vanuatu: Buoyage ................................................ 68
681(T)/14 2462, 2463 ........... SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Scientific instruments ........ 68
1A.37
Wk27/20
IA
20. PACIFIC OCEAN - continued
2385(T)/15 2293, 4510, 4511. NORTH PACIFIC OCEAN: Buoyage ............................................................... 53, 55
249(T)/17 1436 ...................... SOUTH PACIFIC OCEAN, Polynésie Française: Marine farms; Buoyage...... 73
3562(T)/17 1103, 1107............ SOUTH PACIFIC OCEAN, Îles de la Société: Wreck ...................................... 73
4785(T)/17 1494 ...................... SOUTH PACIFIC OCEAN, Vanuatu: Buoy...................................................... 68
935(P)/18 SLB 301, SLB 302. SOUTH PACIFIC OCEAN, Solomon Islands: Depths ..................................... 68
2427(T)/18 2462, 2463 ........... SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Wreck................................. 68
4792(T)/18 378 ........................ SOUTH PACIFIC OCEAN, Fiji Islands: Beacons ............................................ 70
5448(T)/18 1107....................... SOUTH PACIFIC OCEAN, Polynésie Française: Wreck ................................. 73
1735(P)/19 1494 ...................... SOUTH PACIFIC OCEAN, Vanuatu: Works; Buoyage .................................... 68
5029(P)/19 1107....................... SOUTH PACIFIC OCEAN, Polynésie Française: Outfall; Restricted areas..... 73
5069(T)/19 1244 ...................... SOUTH PACIFIC OCEAN, Fiji Islands: Buoy ................................................. 70
6384(T)/19 761, 4051, 4052, NORTH PACIFIC OCEAN: Data buoys ........................................................... 57, 63, 68,
4060, 4061, 4062, 70, 73, 74,
4506, 4604, 4605, 88, 89
4606, 4607, 4615,
4617, 4618, 4619,
4623, 4624, 4625,
4626, 4629, 4632,
4653, 4802, 4808,
4811.......................
182(T)/20 2347, 2412, 4509 NORTH PACIFIC OCEAN: General information............................................. 53, 57
448(T)/20 1103....................... SOUTH PACIFIC OCEAN, Polynésie Française: Buoy ................................... 73
1534(P)/20 SLB 102 ................. SOUTH PACIFIC OCEAN, Solomon Islands: Depths ..................................... 68
1730(P)/20 4622, 4623, 4634, SOUTH PACIFIC OCEAN: Submarine cable................................................... 65, 66, 67,
4635, 4643, 68
Aus 197, Aus 235,
Aus 809, Aus 815,
SLB 305 .................
2089(T)/20 3664 ...................... SOUTH PACIFIC OCEAN, Archipel des Tuamotu: Obstructions.................... 73
2356(T)/20 763, 4506, 4507, NORTH PACIFIC OCEAN: Buoyage ............................................................... 57, 59, 67,
4604, 4622 ........... 68
2386(P)/20 747, 1670 ............. SOUTH PACIFIC OCEAN, Fiji Islands: Depths; Coastline; Beacons ............. 70
3066(T)/20 729 ........................ SOUTH PACIFIC OCEAN, Kiribati: Buoy ...................................................... 70
3294(T)/20 2347, 2412, 3237, NORTH PACIFIC OCEAN: General information............................................. 53, 57, 74
3551, 4509, 4510,
4521, JP 1221........
21. ALEUTIAN ISLANDS, ALASKA AND WEST COAST OF NORTH AMERICA INCLUDING MEXICO
4279(P)/15 8051 ...................... UNITED STATES OF AMERICA, West Coast: Note....................................... 89
6663(P)/15 8050 ...................... UNITED STATES OF AMERICA, West Coast: Anchor berths; Swinging 89
circles .................................................................................................................
6664(P)/15 8051 ...................... UNITED STATES OF AMERICA, West Coast: Anchor berths ........................ 89
2077(P)/16 8051 ...................... UNITED STATES OF AMERICA, West Coast: Automatic Identification 89
System ................................................................................................................
3881(P)/18 8150 ...................... UNITED STATES OF AMERICA, West Coast: Maritime limit; Legend ......... 90
5379(P)/18 8004 ...................... UNITED STATES OF AMERICA, West Coast: Bridges; Legends................... 89
2211(P)/19 8050 ...................... UNITED STATES OF AMERICA, West Coast: Works; Bridges; Vertical 89
clearances ...........................................................................................................
3368(P)/19 8050 ...................... UNITED STATES OF AMERICA, West Coast: Note....................................... 89
22. WEST COASTS OF CENTRAL AND SOUTH AMERICA
3467(T)/15 3084 ...................... PERU: Precautionary area.................................................................................. 98
6453(T)/15 656 ........................ MEXICO, Pacific Ocean Coast: Light; Buoy .................................................... 89
720(P)/17 1938 ...................... MEXICO, Pacific Ocean Coast: Works ............................................................. 89
579(P)/18 8007 ...................... PANAMA, Pacific Ocean Coast: Legend .......................................................... 88
2263(T)/18 1938 ...................... MEXICO, Pacific Ocean Coast: Buoy; Radar beacon....................................... 89
2716(P)/18 8007 ...................... PANAMA, Pacific Ocean Coast: Notes ............................................................. 88
2630(P)/19 1938 ...................... MEXICO, Pacific Ocean Coast: Wreck ............................................................. 89
1A.38
Wk27/20
IA
22. WEST COASTS OF CENTRAL AND SOUTH AMERICA - continued
2867(P)/19 8007, CP 5............. PANAMA, Pacific Ocean Coast: Works; Channel depth; Buoyage; Swinging 88
circle; Jetty; Breakwater; Lights; Alongside depths...........................................
3018(P)/19 8211....................... COLOMBIA, Pacific Ocean Coast: Note .......................................................... 88
3610(P)/19 8007 ...................... PANAMA, Pacific Ocean Coast: Note............................................................... 88
4504(T)/19 3089 ...................... PERU: Buoyage ................................................................................................. 98
5102(T)/19 2318 ...................... COLOMBIA, Pacific Ocean Coast: Buoy ......................................................... 98
6568(P)/19 512 ........................ ECUADOR: Overhead cable; Safe overhead clearances................................... 98
758(P)/20 1946 ...................... EL SALVADOR: Depths; Obstructions; Pilot boarding place; Anchorage area; 89
Buoy ...................................................................................................................
1303(T)/20 3087 ...................... PERU: Buoy....................................................................................................... 98
1792(T)/20 3090 ...................... PERU: Buoy....................................................................................................... 98
23. ANTARCTICA
4399(P)/14 1776 ...................... ANTARCTICA: Coastline; Rocks; Depths........................................................ 97
24. EAST COAST OF SOUTH AMERICA AND THE FALKLAND ISLANDS
1309(T)/13 529, 530, 3971 .... BRAZIL, South Coast: Mooring buoys ............................................................. 95
469(T)/16 587 ........................ BRAZIL, South Coast: Alongside depths .......................................................... 95
884(T)/16 2506 ...................... SOUTH ATLANTIC OCEAN, Falkland Islands: Light-beacon; Leading line . 96
2651(P)/16 8033 ...................... BRAZIL, South Coast: Notes; Anchorage area; Legend ................................... 10
4730(P)/16 8049 ...................... BRAZIL, South Coast: Submarine cable; Obstruction; Landmark; Power 95
transmission line; Safe vertical clearance ..........................................................
1015(T)/17 545, 8048 ............. BRAZIL, East Coast: Works; Buoyage.............................................................. 95
2913(P)/17 8129 ...................... BRAZIL, North Coast: Note .............................................................................. 95
4588(P)/17 8261 ...................... BRAZIL, East Coast: Radio reporting points .................................................... 95
5463(P)/17 566 ........................ BRAZIL, South Coast: Automatic Identification Systems ................................ 95
5498(P)/17 8129 ...................... BRAZIL, North Coast: Tidal streams ................................................................ 95
5978(P)/17 8076 ...................... URUGUAY: Anchorage areas............................................................................ 95
226(P)/18 8013 ...................... BRAZIL, South Coast: Note .............................................................................. 95
606(P)/18 3703 ...................... URUGUAY: Restricted areas ............................................................................. 95
1244(T)/18 579, 589 ............... BRAZIL, South Coast: Buoyage........................................................................ 95
1268(T)/18 3561 ...................... URUGUAY: Depths ........................................................................................... 95
1316(P)/18 8076 ...................... URUGUAY: Maintained channel....................................................................... 95
2509(T)/18 566 ........................ BRAZIL, South Coast: Obstruction................................................................... 95
2657(P)/18 8033 ...................... BRAZIL, South Coast: Dredged areas............................................................... 10
2855(P)/18 8261 ...................... BRAZIL, East Coast: Channel; Channel depths; Light-beacons ....................... 95
3315(T)/18 566 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
3655(P)/18 329, 330, 331, 520, BRAZIL, North Coast: Lights; Radar beacon; Automatic Identification 95
2204, 3959 ........... Systems; Buoyage; Virtual aids to navigation....................................................
3679(P)/18 541 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
3929(P)/18 8261 ...................... BRAZIL, East Coast: Note ................................................................................ 95
4726(P)/18 8076 ...................... URUGUAY: Restricted areas; Depths; Rocks; Pilot boarding place ................. 95
4956(P)/18 566 ........................ BRAZIL, South Coast: Obstructions ................................................................. 95
4967(P)/18 8129 ...................... BRAZIL, North Coast: Jetties............................................................................ 95
5543(P)/18 8013 ...................... BRAZIL, South Coast: Dredged depth .............................................................. 95
6114(P)/18 8014 ...................... BRAZIL, South Coast: Dredged depths; Depths; Works................................... 95
175(P)/19 3977 ...................... BRAZIL, East Coast: Depths ............................................................................. 95
393(T)/19 2001, 8076 ........... URUGUAY: Works; Buoyage; Restricted area.................................................. 95
458(P)/19 8076 ...................... URUGUAY: Radar beacon................................................................................. 95
541(P)/19 579 ........................ BRAZIL, South Coast: Buoyage; Beacon ......................................................... 95
961(T)/19 545 ........................ BRAZIL, East Coast: Buoy................................................................................ 95
1144(P)/19 29, 8014 ............... BRAZIL, South Coast: Obstructions ................................................................. 95
2025(T)/19 2189 ...................... BRAZIL, East Coast: Wreck.............................................................................. 95
2578(P)/19 566 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
2582(P)/19 495 ........................ BRAZIL, East Coast: Obstructions.................................................................... 95
2669(P)/19 8036 ...................... BRAZIL, East Coast: Dredged areas ................................................................. 95
3411(T)/19 529, 3972, 3973 .. BRAZIL, East Coast: Buoyage .......................................................................... 95
1A.39
Wk27/20
IA
24. EAST COAST OF SOUTH AMERICA AND THE FALKLAND ISLANDS - continued
3653(T)/19 555, 3981 ............. BRAZIL, South Coast: Automatic Identification System; Virtual aids to 95
navigation ...........................................................................................................
4952(T)/19 2012, 3984 ........... BRAZIL, South Coast: Buoy ............................................................................. 95
5044(P)/19 8094 ...................... ARGENTINA: Note........................................................................................... 96
5230(P)/19 8076 ...................... URUGUAY: Virtual aid to navigation................................................................ 95
5240(T)/19 2001 ...................... URUGUAY: Mooring buoys.............................................................................. 95
5269(P)/19 8076 ...................... URUGUAY: Light-beacon; Automatic Identification System ........................... 95
5376(P)/19 29, 191, 3980, 8014 BRAZIL, South Coast: Anchorage areas; Spoil ground .................................... 95
5570(P)/19 432, 433 ............... BRAZIL, South Coast: Depths .......................................................................... 95
5643(T)/19 553, 566, 8013 .... BRAZIL, South Coast: Restricted area.............................................................. 95
5688(P)/19 8049 ...................... BRAZIL, South Coast: Depths; Dredged areas; Alongside depths; Wreck; 95
Rocks..................................................................................................................
5918(P)/19 8223 ...................... BRAZIL, South Coast: Spoil ground; Legend................................................... 95
6336(P)/19 8014 ...................... BRAZIL, South Coast: Spoil ground; Legend................................................... 95
131(P)/20 2002 ...................... BRAZIL, South Coast: Depth ............................................................................ 95
627(P)/20 330 ........................ BRAZIL, North Coast: Wreck ........................................................................... 95
987(P)/20 329, 330, 3959 .... BRAZIL, North Coast: Depths .......................................................................... 95
998(P)/20 555 ........................ BRAZIL, South Coast: Beacon.......................................................................... 95
1021(T)/20 555 ........................ BRAZIL, South Coast: Depths .......................................................................... 95
1215(T)/20 1323, 1751, 3561 ARGENTINA: Dredging area; Buoyage ........................................................... 95
1228(P)/20 330 ........................ BRAZIL, North Coast: Depth ............................................................................ 95
1232(P)/20 540, 545, 8048 .... BRAZIL, East Coast: Virtual aids to navigation................................................ 95
1835(P)/20 432 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
1840(T)/20 540, 3975 ............. BRAZIL, East Coast: Buoy................................................................................ 95
2117(P)/20 8049 ...................... BRAZIL, South Coast: Foul .............................................................................. 95
2789(P)/20 8036 ...................... BRAZIL, East Coast: Legend ............................................................................ 95
2795(P)/20 550 ........................ BRAZIL, South Coast: Depths .......................................................................... 95
3070(T)/20 520, 528, 543, 3958 BRAZIL, North Coast: Danger area; Wreck...................................................... 95
3079(T)/20 540, 545 ............... BRAZIL, East Coast: Buoy................................................................................ 95
3183(P)/20 8036 ...................... BRAZIL, East Coast: Piers; Depths; Coastline; Alongside depths; Radio 95
reporting lines.....................................................................................................
3246(P)/20 1328 ...................... ARGENTINA: Channel limit ............................................................................ 95
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO
1527(T)/15 1278, 2262 ........... COLOMBIA, Caribbean Sea Coast: Obstruction .............................................. 88
136(P)/16 8080 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Automatic Identification 83
System ................................................................................................................
340(P)/16 8112....................... UNITED STATES OF AMERICA, Gulf of Mexico: Automatic Identification 83
Systems ..............................................................................................................
813(P)/16 8077 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Dredged depths .............. 83
1349(P)/16 8113....................... UNITED STATES OF AMERICA, Gulf of Mexico: Virtual aid to navigation. 83
1607(P)/16 8065 ...................... VENEZUELA: Radar beacon ............................................................................ 87
2140(P)/16 8065 ...................... VENEZUELA: Depths; Wrecks; Buoyage; Lights............................................ 87
2586(T)/16 376, 1307 ............. MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
2769(T)/16 2434 ...................... COLOMBIA, Caribbean Sea Coast: Buoyage................................................... 88
3726(P)/16 8065 ...................... VENEZUELA: Radar beacon ............................................................................ 87
4197(P)/16 8211....................... COLOMBIA, Caribbean Sea Coast: Beacons ................................................... 88
4258(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4666(T)/16 2866, 3910 ........... WEST INDIES, Bahamas: Lights...................................................................... 83
5819(P)/16 8103 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Note................................ 83
5900(P)/16 8211....................... COLOMBIA, Caribbean Sea Coast: Anchorage area; Legend; Buoyage.......... 88
1A.40
Wk27/20
IA
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO - continued
6160(P)/16 8242 ...................... WEST INDIES, Jamaica: Notes......................................................................... 86
6211(P)/16 465, 466, 3907, HAITI: Depths; Coastline; Lights; Wrecks; Obstructions ................................. 86
3935 ......................
6342(P)/16 8211....................... COLOMBIA, Caribbean Sea Coast: Anchorage areas; Legends....................... 88
6507(P)/16 8195 ...................... MEXICO, Gulf of Mexico: Foul........................................................................ 85
461(P)/17 8078 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Legends .......................... 83
528(P)/17 8242 ...................... WEST INDIES, Jamaica: Automatic Identification System.............................. 86
1215(P)/17 8211....................... COLOMBIA, Caribbean Sea Coast: Note ......................................................... 88
1497(T)/17 1629 ...................... CARIBBEAN SEA: Buoy ................................................................................. 87
2821(P)/17 8112....................... UNITED STATES OF AMERICA, Gulf of Mexico: Light-beacons; Leading 83
line......................................................................................................................
3276(T)/17 2766 ...................... SURINAME: Obstruction; Light ....................................................................... 87
3747(P)/17 8211....................... COLOMBIA, Caribbean Sea Coast: Note ......................................................... 88
4940(P)/17 8077 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Wreck ............................. 83
5136(P)/17 8065 ...................... VENEZUELA: Legend...................................................................................... 87
5307(P)/17 8057 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Radar beacon.................. 83
1763(T)/18 794 ........................ WEST INDIES, Windward Islands: Buoy ......................................................... 87
2080(T)/18 2006, 2019, 2020 WEST INDIES, Virgin Islands: Buoyage; Wrecks; Obstructions ..................... 86
2527(P)/18 8250 ...................... WEST INDIES, Bahamas: Legend; Pilot boarding places ................................ 83
2614(P)/18 8098 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Restricted area................ 83
2695(P)/18 8079 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Dredged depth ................ 83
2835(P)/18 8242 ...................... WEST INDIES, Jamaica: Channel limits; Buoyage; Light-beacons; Dredged 86
depth; Works.......................................................................................................
3094(P)/18 8006 ...................... PANAMA, Panama Canal: Note ........................................................................ 88
3095(P)/18 8006 ...................... PANAMA, Panama Canal: Port development; Anchorage area; Maritime limit; 88
Legends ..............................................................................................................
3248(P)/18 8079 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Light; Light-beacons; 83
Leading line........................................................................................................
3692(P)/18 8098 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Light; Leading line......... 83
4338(P)/18 8080 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Anchorage area; Legend. 83
4530(P)/18 8112....................... UNITED STATES OF AMERICA, Gulf of Mexico: Note................................ 83
4628(T)/18 3768 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
4917(T)/18 474 ........................ WEST INDIES, Trinidad and Tobago: Wreck ................................................... 87
5026(P)/18 8211....................... COLOMBIA, Caribbean Sea Coast: Light; Obstruction ................................... 88
5199(P)/18 8211....................... COLOMBIA, Caribbean Sea Coast: Radar beacon ........................................... 88
5341(P)/18 3768 ...................... MEXICO, Gulf of Mexico: Wreck; Restricted area........................................... 83
5948(P)/18 8079 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Light-beacon; Buoy........ 83
5983(T)/18 1307, 2626 ........... MEXICO, Gulf of Campeche: Platform ............................................................ 83
5994(P)/18 8211....................... COLOMBIA, Caribbean Sea Coast: Restricted areas; Submarine pipeline; 88
Buoy ...................................................................................................................
659(P)/19 230, 2191 ............. VENEZUELA: Superbuoy; Submarine pipeline ............................................... 87
949(T)/19 501, 517, 1044, WEST INDIES, Trinidad and Tobago: Platform; Light..................................... 87
1045 ......................
972(T)/19 475 ........................WEST INDIES, Trinidad and Tobago: Platforms .............................................. 87
1399(T)/19 257, 258, 454, 458, WEST INDIES, Jamaica: Anchorage areas; Anchor berths; Berths; Moorings; 86
459, 464, 8242 .... Piers; Reported anchorages ................................................................................
1895(T)/19 483, 1044, 1045 .. WEST INDIES, Trinidad and Tobago: Buoyage ............................................... 87
2182(T)/19 414 ........................CUBA, North Coast: Buoyage ........................................................................... 83
2228(P)/19 8098 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Bridge; Dredged area; 83
Legend................................................................................................................
2438(P)/19 8077 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Restricted area................ 83
2703(P)/19 8211....................... COLOMBIA, Caribbean Sea Coast: Restricted areas; Legends ........................ 88
2745(T)/19 364, 365, 376, 3768 MEXICO, Gulf of Mexico: Obstructions........................................................... 83
1A.41
Wk27/20
IA
2924(T)/19 483 ........................ WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
2997(P)/19 8211....................... COLOMBIA, Caribbean Sea Coast: Legends ................................................... 88
3392(T)/19 2753 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
3634(P)/19 2019, 2020 ........... WEST INDIES, Virgin Islands: Depths ............................................................. 86
3977(T)/19 662 ........................ MEXICO, Caribbean Sea Coast: Fish havens.................................................... 85
3998(P)/19 8078, 8079 ........... UNITED STATES OF AMERICA, Gulf of Mexico: Dredged areas................. 83
4086(T)/19 1629 ...................... VENEZUELA: Buoy ......................................................................................... 87
4250(T)/19 3190, 8236 ........... UNITED STATES OF AMERICA, Gulf of Mexico: Vertical clearance; Works 83
4277(P)/19 8211....................... COLOMBIA, Caribbean Sea Coast: Marine Reserve........................................ 88
4909(T)/19 1966, 2191 ........... VENEZUELA: Buoy ......................................................................................... 87
4916(T)/19 1307, 4400, 4401 MEXICO, Gulf of Campeche: Buoyage ............................................................ 83, 86
5358(T)/19 2434 ...................... COLOMBIA, Caribbean Sea Coast: Buoy ........................................................ 88
5444(P)/19 359, 1307, 2626 .. MEXICO, Gulf of Campeche: Works; Depths................................................... 83
5925(P)/19 517, 519, 527, 537, GUYANA: Submarine cable .............................................................................. 87
572, 2687 .............
6185(P)/19 1400 ...................... PANAMA, Caribbean Sea Coast: Pier; Buoyage; Dolphin ............................... 88
6209(P)/19 8236 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Depth information; 83
Legends; Dredged depths; Depths; Pier; Channel limits ...................................
6350(T)/19 1307, 2626 ........... MEXICO, Gulf of Campeche: Buoyage; Wreck................................................ 83
156(P)/20 1441, 1450 ........... WEST INDIES, Turks and Caicos Islands: Depths; Drying heights; Coral ...... 86
203(T)/20 359 ........................ MEXICO, Gulf of Mexico: Buoyage................................................................. 83
207(T)/20 2751, 8195 ........... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83, 85
208(T)/20 375 ........................ MEXICO, Gulf of Mexico: Buoyage................................................................. 83
378(T)/20 481, 483 ............... WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
412(T)/20 454 ........................ WEST INDIES, Jamaica: Light-beacon; Buoy.................................................. 86
474(P)/20 8113....................... UNITED STATES OF AMERICA, Gulf of Mexico: Channel limits; Depth 83
information; Depths; Legends; Obstructions .....................................................
475(P)/20 8112....................... UNITED STATES OF AMERICA, Gulf of Mexico: Channel limits; Legends; 83
Depth information; Dredged areas; Maintained channels..................................
510(P)/20 8211....................... COLOMBIA, Caribbean Sea Coast: Coastline .................................................. 88
630(P)/20 487, 489, 583, 584, WEST INDIES, Leeward Islands: Lights .......................................................... 86
1025, 2016 ...........
969(P)/20 2005, 2006, 2016, WEST INDIES, Virgin Islands: Depths ............................................................. 86
2019, 2020 ...........
1055(T)/20 2988 ...................... HONDURAS: Buoy........................................................................................... 85
1079(P)/20 2005, 2019 ........... WEST INDIES, Virgin Islands: Wrecks; Marine Reserves ............................... 86
1111(T)/20 2079 ...................... WEST INDIES, Leeward Islands: Works .......................................................... 86
1178(T)/20 2751, 8195 ........... MEXICO, Gulf of Mexico: Platform ................................................................. 83, 85
1186(T)/20 474 ........................ WEST INDIES, Trinidad and Tobago: Buoyage ............................................... 87
1666(T)/20 2765 ...................... SURINAME: Anchorage area............................................................................ 87
1794(P)/20 8242 ...................... WEST INDIES, Jamaica: Buoy; Jetty................................................................ 86
1818(T)/20 2626 ...................... MEXICO, Gulf of Campeche: Buoy.................................................................. 83
1921(P)/20 8077, 8078, 8079, UNITED STATES OF AMERICA, Gulf of Mexico: Channel limits; Depth 83
8080 ...................... information; Dredged depths..............................................................................
2058(P)/20 487, 489, 583, 584, WEST INDIES, Leeward Islands: Marine Reserves; Restricted area ............... 86
585 ........................
2096(P)/20 8098 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Dredged depth ................ 83
2118(P)/20 8080 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Notes .............................. 83
2133(P)/20 8112....................... UNITED STATES OF AMERICA, Gulf of Mexico: Light-beacons; Leading 83
lines ....................................................................................................................
2134(P)/20 8113....................... UNITED STATES OF AMERICA, Gulf of Mexico: Light-beacon .................. 83
1A.42
Wk27/20
IA
2321(P)/20 1629 ...................... VENEZUELA: Buoy ......................................................................................... 87
2781(P)/20 8103 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Virtual aid to navigation; 83
Automatic Identification System........................................................................
2849(T)/20 8006, CP 1............. PANAMA, Panama Canal: Buoyage ................................................................. 88
2920(T)/20 368, 369, 491, 494, WEST INDIES, Windward Islands: Restricted areas ........................................ 86, 87
593, 618, 804,
1025, 1042, 2079
3007(T)/20 2765 ...................... SURINAME: Buoy ............................................................................................ 87
3019(T)/20 2765 ...................... SURINAME: Buoy ............................................................................................ 87
3074(T)/20 2190 ...................... VENEZUELA: Buoy ......................................................................................... 87
3161(P)/20 471 ........................ DOMINICAN REPUBLIC: Depths; Berths; Lights.......................................... 86
3238(T)/20 1628, 8065 ........... VENEZUELA: Buoy ......................................................................................... 87
26. EAST COAST OF NORTH AMERICA AND GREENLAND
5552(P)/15 8030 ...................... UNITED STATES OF AMERICA, East Coast: Dredged areas; Dredged depths 81
5976(P)/15 8122 ...................... UNITED STATES OF AMERICA, East Coast: Automatic Identification 81
System ................................................................................................................
1565(P)/16 8122 ...................... UNITED STATES OF AMERICA, East Coast: Wreck ..................................... 81
2681(P)/16 2490, 2492, 2670, UNITED STATES OF AMERICA, East Coast: Maritime limit ........................ 80, 81
4746 ......................
2682(P)/16 2864, 2865, 3691 UNITED STATES OF AMERICA, East Coast: Maritime limit ........................ 81
3188(P)/16 8181 ...................... UNITED STATES OF AMERICA, East Coast: Horizontal clearance; Vertical 83
clearance.............................................................................................................
5140(P)/16 8248 ...................... UNITED STATES OF AMERICA, East Coast: Channel limits ........................ 81
928(P)/17 8187 ...................... UNITED STATES OF AMERICA, East Coast: Obstructions; Wrecks ............. 81
1397(T)/17 2483 ...................... UNITED STATES OF AMERICA, East Coast: Buoyage ................................. 81
1417(T)/17 2732 ...................... UNITED STATES OF AMERICA, East Coast: Buoyage ................................. 81
2032(P)/17 8201 ...................... UNITED STATES OF AMERICA, East Coast: Anchorage areas; Legends ..... 81
2071(P)/17 8202 ...................... UNITED STATES OF AMERICA, East Coast: Note........................................ 81
3140(P)/17 8181 ...................... UNITED STATES OF AMERICA, East Coast: Pilot boarding place ............... 83
5582(P)/17 8201 ...................... UNITED STATES OF AMERICA, East Coast: Light; Light-beacon ............... 81
1567(P)/18 8201 ...................... UNITED STATES OF AMERICA, East Coast: Obstruction............................. 81
3595(P)/18 8224 ...................... UNITED STATES OF AMERICA, East Coast: Light....................................... 81
4422(P)/18 8188 ...................... UNITED STATES OF AMERICA, East Coast: Dredged depths ...................... 81
4610(P)/18 8255 ...................... UNITED STATES OF AMERICA, East Coast: Obstructions ........................... 81
5850(P)/18 8249 ...................... UNITED STATES OF AMERICA, East Coast: Dredged depths ...................... 81
2298(P)/19 8262 ...................... UNITED STATES OF AMERICA, East Coast: Dredged areas; Legends; Note 81
2413(P)/19 8248 ...................... UNITED STATES OF AMERICA, East Coast: Vertical clearance; Horizontal 81
clearance.............................................................................................................
2665(P)/19 8255 ...................... UNITED STATES OF AMERICA, East Coast: Dredged depth........................ 81
3941(P)/19 8227 ...................... UNITED STATES OF AMERICA, East Coast: Channel limits; Depths........... 83
3946(P)/19 8201 ...................... UNITED STATES OF AMERICA, East Coast: Lights; Leading line ............... 81
4333(P)/19 8181 ...................... UNITED STATES OF AMERICA, East Coast: Channel limits; Dredged depth; 83
Legends ..............................................................................................................
4912(P)/19 8255 ...................... UNITED STATES OF AMERICA, East Coast: Channel limit; Dredged depths 81
4923(P)/19 8227 ...................... UNITED STATES OF AMERICA, East Coast: Light-beacon .......................... 83
5098(P)/19 8024 ...................... UNITED STATES OF AMERICA, East Coast: Channel limits; Depth 81
information; Dredged depths..............................................................................
5406(P)/19 8227 ...................... UNITED STATES OF AMERICA, East Coast: Obstruction............................. 83
5690(P)/19 8122 ...................... UNITED STATES OF AMERICA, East Coast: Channel limits; Depth 81
information; Legends; Dredged depths..............................................................
5701(P)/19 8189 ...................... UNITED STATES OF AMERICA, East Coast: Radar beacon.......................... 81
1A.43
Wk27/20
IA
26. EAST COAST OF NORTH AMERICA AND GREENLAND - continued
6022(P)/19 8248, 8249 ........... UNITED STATES OF AMERICA, East Coast: Channel limits; Depth 81
information; Dredged depth; Legends; Submarine cable...................................
444(P)/20 2755, 2860 ........... UNITED STATES OF AMERICA, East Coast: Submarine cable..................... 81
995(P)/20 8187, 8188, 8189 UNITED STATES OF AMERICA, East Coast: Channel limits; Coastline; 81
Depth information; Depths; Dredged depths; Horizontal clearance; Legends;
Obstructions; Rocks; Submarine cables.............................................................
1544(P)/20 8262 ...................... UNITED STATES OF AMERICA, East Coast: Channels; Channel limits; 81
Dredged area ......................................................................................................
1592(P)/20 8181 ...................... UNITED STATES OF AMERICA, East Coast: Restricted areas ...................... 83
1912(P)/20 8255 ...................... UNITED STATES OF AMERICA, East Coast: Channel limits; Dredged 81
depths; Depth information; Legends ..................................................................
2360(P)/20 8224 ...................... UNITED STATES OF AMERICA, East Coast: Legends; Restricted area ........ 81
2490(T)/20 3454 ...................... UNITED STATES OF AMERICA, East Coast: Restricted area........................ 81
2733(T)/20 4750 ...................... CANADA: Works .............................................................................................. 80
2749(T)/20 4770, 4777, 4779, CANADA, Saint Lawrence River: Restricted areas; Area to be avoided .......... 79
4782 ......................
2756(T)/20 2666, 4011, 4013, CANADA, Gulf of Saint Lawrence: Restricted areas; General information..... 19, 78, 79,
4404, 4762, 4763, 82
4764, 4765, 4766,
4767, 4768, 4774
3301(P)/20 4784 ...................... CANADA, Saint Lawrence River: Depths ........................................................ 79
Source: UKHO
1A.44
Wk27/20
II
GEOGRAPHICAL INDEX
(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.5 – 2.7
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(4) – 2.9
Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . . 2.9 – 2.11
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.11 – 2.12
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.12 – 2.14
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.14 – 2.15
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.15
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.15 – 2.19
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19 – 2.21
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21 – 2.22
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.22
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.23
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.23
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.23
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24 – 2.26
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.27 – 2.35
2.1
Wk27/20
II
INDEX OF NOTICES AND CHART FOLIOS
Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
3241 2.15 50 3298 2.22 66
3242(T)/20 2.29 40 3299 2.24 79, 80
3243* 2.9 9 3300(T)/20 2.30 47
3244* 2.14 40 3301(P)/20 2.35 79
3245* 2.5 6, 7 3302 2.15 40
3246(P)/20 2.34 95 3303 2.21 52
3247* 2.5 7 3304 2.25 79
3248(P)/20 2.28 16 3305 2.11 9
3249 2.24 81 3306(P)/20 2.29 46
3250 2.12 28, 29 3307 2.15 45
3251 2.16 50 3308* 2.7 4
3252 2.16 50 3309 2.18 50
3253(P)/20 2.30 50 3310(T)/20 2.27 1
3254 2.13 26 3311(P)/20 2.31 50
3255 2.21 52 3312 2.25 80
3256 2.16 47 3313 2.25 79
3257 2.24 81 3314(T)/20 2.28 30
3258 2.14 32 3315* 2.7 2
3259 2.23 83 3316 2.26 78, 79
3260 2.13 24 3317 2.26 79
3261 2.21 60 3318(T)/20 2.27 10
3262 2.13 26 3319 2.12 18
3263 2.13 27 3320 2.26 79
3264 2.24 81 3321 2.7 10
3265(T)/20 2.28 27 3322 2.18 52
3266 2.9 9 3323(T)/20 2.33 52, 53
3267 2.14 27 3324 2.19 52
3268 2.17 50 3325* 2.7 6
3269* 2.6 8 3326 2.8 11
3270 2.17 47 3327* 2.7 3
3271 2.17 50 3328 2.8 10
3272 2.22 58 3329(T)/20 2.27 10
3273 2.11 18 3330 2.19 50
3274* 2.23 85 3331(P)/20 2.31 50
3275 2.18 47 3332 2.9 10
3276 2.15 32 3333 2.23 71
3277* 2.6 7 3334* 2.23 88
3278* 2.6 1, 8
3279(T)/20 2.33 52
3280 2.9 9
3281 2.10 9
3282 2.10 9
3283 2.19 55
3284 2.20 53
3285 2.20 53
3286 2.20 53
3287 2.20 53
3288 2.21 53
3289(T)/20 2.32 53
3290(T)/20 2.32 54
3291(T)/20 2.32 54
3292(T)/20 2.33 54
3293(T)/20 2.33 53
3294(T)/20 2.34 53, 57, 74
3295 2.10 7, 9
3296 2.14 28
3297 2.24 79
2.2
Wk27/20
II
INDEX OF CHARTS AFFECTED
Admiralty Chart No. Notices

Notices Admiralty
Admiralty Chart
Chart No.
No. Notices
35 3325 2605 3249

121 3247 2618 3253P
127 3323T 2620 3326
200 3265T 2634 3314T
204 3263 2636 3332
213 3245 2637 3321
220 3263 2688 3332
278 3245 2816 3318T
344 3300T 2861 3264
354 3254 2919 3257
355 3262 2942 3328, 3329T
896 3323T 2944 3329T
898 3255, 3323T 2976 3273
946 3261 3043 3276
966 3260 3183 3259
1055 3250 3231 3252
1095 3250 3237 3294T
1099 3250 3339 3308
1126 3241 3363 3270
1160 3315 3364 3270
1186 3269 3391 3303
1190 3247 3453 3271
1191 3247 3480 3323T
1199 3309 3496 3277
1249 3324 3497 3277
1252 3324 3511 3302
1256 3279T, 3324 3523 3302
1258 3279T 3551 3294T
1267 3310T 3666 3323T
1328 3246P 3695 3322
1409 3245 3734 3242T
1422 3266 3736 3242T
1431 3327 3751 3272
1443 3265T 3863 3326
1461 3267 3881 3256
1467 3263 3882 3256
1531 3250 3948 3306P
1557 3275 3951 3244
1573 3274 4127 3311P
1591 3314T 4140 3295
1596 3296 4509 3294T
1601 3268 4510 3294T
1602 3309, 3331P 4521 3294T
1603 3268, 3309 4620 3298
1604 3268 4621 3298
1607 3278 4748 3299
1613 3310T 4754 3312
1732 3319 4762 3317
1760 3330 4763 3316
1768 3251 4764 3316
1797 3274 4765 3299
1828 3278 4766 3317
1900 3310T 4774 3317
2014 3318T 4775 3317
2018 3318T 4777 3313
2040 3318T, 3332 4779 3304
2106 3328, 3329T 4782 3304
2117 3329T 4783 3304
2133 3258 4784 3301P
2151 3269 4787 3320
2173 3308 4790 3297
2182A 3295 8164 3248P
2182B 3295
2347 3294T German
2359 3329T Notices
2403 3307 Chart No.
2409 3330
2412 3294T DE 42 3305
2420 3308 DE 44 3280
2.3
Wk27/20
II
INDEX OF CHARTS AFFECTED
German
Admiralty Chart No. Notices International
Admiralty Chart No. Notices
Notices
Chart No. Chart No.
DE 46 3305 INT 1565 3277
DE 47 3282 INT 1616 3308
DE 50 3295 INT 1617 3308
DE 90 3243, 3281 INT 1662 3327
INT 3361 3254
Japanese INT 3362 3262
Notices INT 3681 3314T
Chart No. INT 4633 3312
INT 5251 3323T
JP 126 3291T INT 5355 3323T
JP 129 3292T INT 5360 3303
JP 142 3290T INT 7131 3276
JP 221 3286, 3287 INT 7139 3258
JP 1033A 3283 INT 7241 3244
JP 1036 3283 INT 7258 3242T
JP 1052 3285 INT 7261 3242T
JP 1057A 3289T INT 11461 3326
JP 1106 3291T INT 12902 3321
JP 1112A 3290T
JP 1133C 3291T
JP 1220 3284
JP 1221 3284, 3287, 3288, 3294T
JP 1227 3293T
New Zealand
Notices
Chart No.
NZ 53 3333
NZ 532 3333
Panamanian
Notices
Chart No.
CP 5 3334
International
Notices
Chart No.
INT 140 3295
INT 509 3294T
INT 510 3294T
INT 620 3298
INT 621 3298
INT 1042 3295
INT 1043 3295
INT 1044 3266
INT 1045 3295
INT 1148 3326
INT 1202 3318T
INT 1218 3318T, 3332
INT 1219 3318T
INT 1288 3332
INT 1303 3328, 3329T
INT 1351 3329T
INT 1353 3328, 3329T
INT 1361 3329T
INT 1366 3305
INT 1452 3280
INT 1453 3305
INT 1454 3282
INT 1461 3243, 3281
INT 1504 3245
INT 1507 3247
INT 1508 3247
INT 1554 3277
INT 1562 3278
INT 1563 3278
2.4
Wk27/20
II
3245* SCOTLAND - East Coast - Buoy.
Source: Partrac
Chart 213 [ previous update 2225/19 ] ETRS89 DATUM

Delete
EfFl(5)Y.20s 57° 28´·45N., 1° 23´·55W.
Chart 278 [ previous update 1679/20 ] WGS84 DATUM

Delete
EFl(5)Y.20s 57° 28´·45N., 1° 23´·54W.
Chart 1409 (INT 1504) [ previous update 1363/20 ] ETRS89 DATUM

Delete
EfFl(5)Y.20s 57° 28´·45N., 1° 23´·54W.
3247* ENGLAND - East Coast - Legend. Note. Development area.

Source: Health and Safety Executive

Insert limit of development area, pecked line, joining: (a) 54° 04´·36N., 0° 22´·82E.
(b) 54° 00´·28N., 0° 23´·08E.
(c) 54° 00´·43N., 0° 29´·85E.
(d) 54° 04´·50N., 0° 29´·61E.
legend, DEVELOPMENT AREA (see Note), within: (a)-(d) above
the accompanying note, DEVELOPMENT AREAS, centred
on: 53° 46´·71N., 0° 10´·49W.

(b) 54° 00´·28N., 0° 23´·08E.
(c) 54° 00´·43N., 0° 29´·85E.
(d) 54° 04´·50N., 0° 29´·61E.
on: 52° 46´·05N., 0° 30´·39E.

(b) 54° 00´·28N., 0° 23´·08E.
(c) 54° 00´·43N., 0° 29´·85E.
(d) 54° 04´·50N., 0° 29´·61E.
on: 54° 17´·81N., 1° 22´·97W.
2.5
Wk27/20
II
3269* ENGLAND - East Coast - Depths.

Source: Port of London Authority
Chart 1186 (Panel B, Coalhouse Point to Tilbury) [ previous update 3110/20 ] ETRS89 DATUM
Insert depth, 61 (a) 51° 27´·031N., 0° 20´·579E.
Delete depth, 64, close SW of: (a) above
Insert depth, 72 (b) 51° 26´·992N., 0° 20´·863E.
Delete depth, 73, close SW of: (b) above

Insert depth, 61 (a) 51° 27´·031N., 0° 20´·579E.
Delete depth, 64, close SW of: (a) above
Insert depth, 72 (b) 51° 26´·992N., 0° 20´·863E.
Delete depth, 73, close SW of: (b) above
3277* ENGLAND - East Coast - Depths.

Source: ABP Humber
Chart 3496 (INT 1565) (Panel A, Hull Docks Eastern Part) [ previous update 3100/20 ] ETRS89 DATUM
Insert depth, 69, and extend 7m contour NE to enclose (a) 53° 44´·098N., 0° 16´·491W.
Delete depth, 79, close NE of: (a) above
Insert depth, 7, and extend 7m contour N to enclose 53° 44´·284N., 0° 17´·548W.

Insert depth, 69, and extend 7m contour NE to enclose 53° 44´·10N., 0° 16´·49W.
depth, 7, and extend 7m contour N to enclose 53° 44´·28N., 0° 17´·55W.
3278* ENGLAND - South East Coast - Foul.

Source: Port of London Authority

Insert
« 51° 24´·50N., 1° 27´·10E.

Insert
« 51° 24´·50N., 1° 27´·10E.
2.6
Wk27/20
II
3308* IRELAND - West Coast - Wreck.

Source: Irish Maritime Administration

Insert
21, Wk 53° 09´·63N., 9° 41´·01W.

Insert
21, Wk 53° 09´·63N., 9° 41´·01W.

Insert
21, Wk 53° 09´·63N., 9° 41´·01W.
3315* ENGLAND - Bristol Channel - Harbour limit. Legend.

Source: Ilfracombe Harbour Master
Chart 1160 (Panel G, Ilfracombe) [ previous update 893/20 ] ETRS89 DATUM

Insert harbour limit, pecked line, joining: 51° 12´·661N., 4° 06´·946W.
(a) 51° 12´·802N., 4° 06´·946W.
(b) 51° 12´·802N., 4° 06´·118W.
51° 12´·786N., 4° 06´·118W.
legend, Harbour Limit, along S side of: (a)-(b) above
3325* SCOTLAND - Orkney Islands - Buoyage.

Source: Orkney Islands Council Notice 9/20

Insert
BfFl.Y.5s 58° 52´·30N., 2° 56´·67W.
58° 52´·30N., 2° 56´·44W.
3327* IRELAND - East Coast - Light-beacon.

Source: Drogheda Port Company
Chart 1431 (INT 1662) (Panel B, River Boyne to Drogheda) [ previous update 2776/20 ] ETRS89 DATUM
Insert
T§Ql 53° 43´·12N., 6° 18´·57W.
3321 POLAND - NM Block.

Source: Polish Notice 22/324/20
Chart 2637 (INT 12902) (Panel, Motława Marina) [ previous update New Edition 30/04/2020 ] WGS84 DATUM
Insert the accompanying block, centred on: 54° 21´·0N., 18° 39´·5E.
2.7
Wk27/20
II
3326 FINLAND - West Coast - Recommended tracks. Buoyage.

Source: Finnish Notice 15/108/20
Chart 2620 (INT 11461) (Panel B, Oulu) [ previous update 1971/20 ] WGS84 DATUM
Insert recommended track, firm line, with maximum authorised
draught, <5,0m>, joining: (a) 65° 02´·374N., 25° 25´·298E.
65° 02´·457N., 25° 25´·160E.
(b) 65° 02´·536N., 25° 24´·913E.
Delete former recommended track, firm line, between: (a)-(b) above
symbol, spar buoy with cylinder topmark 65° 02´·464N., 25° 25´·248E.
65° 02´·588N., 25° 24´·721E.
65° 02´·619N., 25° 24´·572E.
65° 02´·700N., 25° 23´·760E.
symbol, spar buoy with cone point up topmark 65° 02´·653N., 25° 23´·603E.
65° 02´·659N., 25° 23´·889E.
65° 02´·568N., 25° 24´·655E.
Chart 3863 (INT 1148) [ previous update 6008/19 ] WGS84 DATUM

Delete symbol, spar buoy with cylinder topmark 65° 02´·46N., 25° 25´·25E.
65° 02´·59N., 25° 24´·72E.
65° 02´·62N., 25° 24´·57E.
65° 02´·70N., 25° 23´·76E.
symbol, spar buoy with cone point up topmark 65° 02´·65N., 25° 23´·60E.
65° 02´·66N., 25° 23´·89E.
65° 02´·57N., 25° 24´·65E.
3328 GERMANY - Baltic Coast - Buoyage.

Source: German Notice 23/30/20

Insert
GfFl(5)Y.20s ODAS 54° 34´·74N., 10° 13´·37E.
54° 34´·22N., 10° 11´·78E.
54° 33´·83N., 10° 14´·27E.

Insert
GfFl(5)Y.20s ODAS 54° 34´·74N., 10° 13´·37E.
54° 34´·22N., 10° 11´·78E.
54° 33´·77N., 10° 14´·47E.
2.8
Wk27/20
II
3332 POLAND - Lights. Legend. Leading line.

Source: Polish Notice 22/325/20

Amend light to, Dir WRG (a) 54° 32´·18N., 18° 31´·91E.
legend to, Dir 271,5°, centred on: 54° 32´·28N., 18° 36´·58E.
Delete
¶ Oc.Or.5s15m8M 54° 32´·16N., 18° 32´·88E.
leading line, pecked line (a) above
54° 32´·14N., 18° 33´·78E.

Amend light to, Iso.Y.4s14m6M (a) 54° 32´·174N., 18° 31´·904E.
Delete
¶ Oc.Or.5s15m8M 54° 32´·158N., 18° 32´·873E.
54° 32´·144N., 18° 33´·780E.

Amend light to, Iso.Y.4s14m6M (a) 54° 32´·17N., 18° 31´·90E.
Delete
¶ Oc.Or.5s15m8M 54° 32´·16N., 18° 32´·87E.
54° 32´·14N., 18° 33´·78.
3243* GERMANY - North Sea Coast - Depths.

Source: WSA Emds-Nordsee, Peilplan 75710/20
Chart DE 90 (INT 1461) [ previous update 3239/20 ] WGS84 DATUM

Insert depth, 32, and extend 5m contour NE to enclose (a) 53° 37´·61N., 6° 42´·12E.
Delete depth, 72, close SE of: (a) above
3266 DENMARK - North Sea Coast - Light.

Source: Danish Lights List and Danish Maritime Authority
Chart 1422 (INT 1044) (Panel B, Hvide Sande) [ previous update 3212/20 ] WGS84 DATUM
Amend light to, 2F.R 56° 00´·165N., 8° 07´·369E.
3280 GERMANY - North Sea Coast - Buoy.


Insert
JdLL 4 54° 00´·80N., 8° 32´·07E.
2.9
Wk27/20
II
3281 GERMANY - North Sea Coast - Depth.


Replace depth, 134, with depth, 129 53° 37´·24N., 6° 54´·87E.
3282 GERMANY - North Sea Coast - Lights.


Insert
·F 53° 43´·50N., 9° 25´·74E.
53° 43´·50N., 9° 25´·80E.
3295 GERMANY - North Sea Coast - Superbuoy.


Delete
PfFl(5)Y.20s NSB II 54° 59´·9N., 6° 21´·1E.
Chart 2182A (INT 1043) [ previous update 3232/20 ] WGS84 DATUM

Delete
PfFl(5)Y.20s NSB II 55° 00´·0N., 6° 20´·0E.
Chart 2182B (INT 1042) [ previous update 3232/20 ] WGS84 DATUM

Delete
PfFl(5)Y.20s NSB II 55° 00´·0N., 6° 19´·9E.

Delete
PNSB II 54° 59´·8N., 6° 20´·3E.
2.10
Wk27/20
II
3305 GERMANY - North Sea Coast - Buoyage. Lights. Obstruction.

Source: German Notices 22/42/20 and 22/46/20
Note: Former Notice 1859(T)/20 is cancelled.
Chart DE 42 (INT 1366) (Panel C, Brunsbüttel) [ previous update 3153/20 ] WGS84 DATUM
Insert
GXQ(9)15s
s (a) 53° 53´·326N., 9° 08´·209E.
Delete
· Oc(2)9s, close SE of: (a) above
Replace
¶ Iso.Y.2s13m 3 with åObstn 53° 53´·250N., 9° 08´·070E.
Move
GVVQ(6)+LFl.10s,
q from:
53° 53´·220N., 9° 08´·124E.
to: 53° 53´·242N., 9° 08´·058E.
and
from: 53° 53´·220N., 9° 08´·208E.
to: 53° 53´·242N., 9° 08´·155E.
Chart DE 46 (INT 1453) (Panel, Brunsbüttel) [ previous update 3226/20 ] WGS84 DATUM
Insert
GXQ(9)15s
s (a) 53° 53´·326N., 9° 08´·209E.
Delete
· Oc(2)9s, close SE of: (a) above
Insert
GVVq Q(6)+LFl.10s (b) 53° 53´·242N., 9° 08´·058E.
Delete
GVQ(6)+LFl.10s,
q close SE of:
(b) above
Insert
GVVq Q(6)+LFl.10s (c) 53° 53´·242N., 9° 08´·155E.
Delete
GVQq (6)+LFl.10s, close SE of: (c) above
Replace

Replace
3273 SPAIN - South West Coast - Buoy.

Source: Spanish Notice 22/170/20
Chart 2976 (Panel, Río Guadalquivir Bonanza to Salina de Santa Teresa) [ previous update 2768/20 ] WGS84 DATUM
Amend designation of buoy to, 2 36° 48´·410N., 6° 20´·510W.
2.11
Wk27/20
II
3319 SPAIN - West Coast - Breakwater. Lights.

Source: Spanish Notice 22/168/20 and ENC ES541641

Insert breakwater, single firm line, joining: (a) 42° 23´·76N., 8° 49´·23W.
(b) 42° 23´·72N., 8° 49´·21W.
· Fl(4)R.11s1m1M (a) above
· Fl(2+1)G.15s1m1M (b) above
3250 GREECE - Dhodhekánisos - Depths.

Source: ENC GR4APP03

Insert depth, 73, enclosed by 100m contour (a) 36° 44´·19N., 27° 03´·99E.
depth, 49, and associated 50m contour 36° 45´·01N., 27° 01´·53E.

Delete depth, 113, close NW of: (a) above
Insert 50m contour, joining: (b) 36° 45´·2N., 27° 01´·0E.
36° 45´·4N., 27° 01´·4E.
(c) 36° 45´·6N., 27° 01´·9E.
Delete former 50m contour, joining: (b) above
(c) above
depth, 49, close SE of: (b) above

Insert 50m contour, joining: (b) 36° 45´·2N., 27° 01´·2E.
36° 45´·4N., 27° 01´·5E.
(c) 36° 45´·6N., 27° 01´·9E.
Delete former 50m contour, joining: (b) above
(c) above
depth, 49, close SE of: (b) above
Chart 1531 (Panel F, Órmos Gyalí) [ previous update 3337/19 ] WGS84 DATUM
Delete depth, 52 36° 39´·69N., 27° 08´·96E.
2.12
Wk27/20
II
3254 ITALY - West Coast - Wreck.

Source: Italian Notice 11.2/20

Insert
9+ Wk 44° 25´·253N., 8° 48´·580E.
3260 ITALY - Sicilia - Lights.

Chart 966 (Panel A, Rada Di Augusta) [ previous update 1267/20 ] WGS84 DATUM
Amend light to, F.RG(vert)5M 37° 13´·77N., 15° 11´·88E.
Delete
¶2F.RG(vert) SASOL 37° 13´·73N., 15° 11´·65E.
3262 ITALY - West Coast - Wrecks.


Insert
12!, Wk 44° 24´·28N., 8° 53´·08E.
13), Wk 44° 23´·82N., 8° 55´·00E.
3263 ITALY - East Coast - Platform. Light. Fog signal. Restricted area. Legend.
Source: Italian Notices 11.15-16/20
Chart 204 [ previous update New Edition 16/04/2020 ] WGS84 DATUM

Move
¼{ AGIP 1 Fl(2)5s, from: 44° 28´·4N., 12° 21´·3E.
to: 44° 28´·6N., 12° 21´·8E.

Move
¼{ AGIP 1 Fl(2)5s, from: 44° 28´·4N., 12° 21´·3E.
to: 44° 28´·6N., 12° 21´·8E.

Move
¼{ AGIP 1 Fl(2)5s10m8M, Horn(3)45s, from: 44° 28´·36N., 12° 21´·33E.
to: (a) 44° 28´·57N., 12° 21´·81E.
Insert circular limit of restricted area,entry prohibited, radius 0·54M,
Ç , centred on:
(b) (a) above
legend, (Buoyed), within: (b) above
2.13
Wk27/20
II
3267 ITALY - East Coast - Wreck. Restricted area.


Insert
´ (a) 45° 39´·92N., 13° 28´·56E.
circular limit of restricted area, radius 0·27M, Ç, centred
on: (a) above
3296 GREECE - Aegean Sea Coast - NM Block.

Source: ENC GR6QQK01

3244* UNITED ARAB EMIRATES - Submarine cables.

Source: e-marine

Insert submarine cable, É, joining: 24° 12´·96N., 51° 59´·90E.
24° 12´·86N., 51° 59´·01E.
24° 12´·56N., 51° 58´·73E.
24° 11´·92N., 51° 58´·57E.
24° 11´·36N., 51° 58´·67E.
(a) 24° 10´·96N., 51° 59´·30E.
and
(a) above
24° 10´·88N., 51° 57´·26E.
24° 10´·33N., 51° 55´·09E.
24° 08´·91N., 51° 52´·93E.
24° 04´·78N., 51° 48´·45E.
24° 04´·65N., 51° 47´·16E.
3258 EGYPT - Red Sea Coast - Jetty.

Source: ENHD Notice 1/19

Insert jetty, single firm line, joining: 29° 53´·16N., 32° 28´·39E.
29° 53´·20N., 32° 28´·47E.
29° 53´·33N., 32° 28´·39E.
2.14
Wk27/20
II
3276 EGYPT - Red Sea Coast - Depths.

Source: Egyptian Notice 4/20
Chart 3043 (INT 7131) (Panel D, Approaches to Berenice (Barnīs)) [ previous update 6563/19 ] WGS84 DATUM
Insert depth, 95, and extend 10m contour S to enclose (a) 23° 57´·05N., 35° 33´·48E.
3302 OMAN - Lights.

Source: Omani Notice 5/10/20
Chart 3511 (Panel A, Approaches to Said Bin Sultan Naval Base) [ previous update 3398/19 ] WGS84 DATUM
Amend light to, Fl.2s4m5M 23° 48´·53N., 57° 34´·33E.
light to, Fl.G.2s4m3M 23° 48´·50N., 57° 34´·24E.
light to, Fl.R.4s5m3M 23° 48´·44N., 57° 34´·24E.

Amend light to, Fl.2s4m5M 23° 48´·53N., 57° 34´·33E.
3307 INDONESIA - Sumatera - Submarine cable.

Source: Indonesian Notice 22/258/20

Insert submarine cable, É, joining: 0° 50´·55N., 103° 35´·26E.
0° 54´·97N., 103° 34´·11E.
0° 56´·36N., 103° 34´·05E.
0° 57´·38N., 103° 33´·70E.
1° 00´·00N., 103° 33´·54E.
3241 CHINA - East Coast - Light-beacons.

Source: Chinese Notice 20/688/20
Chart 1126 [ previous update 2955/20 ] CGCS 2000 DATUM

Insert
TlMÜ o(C)Y.12s12m3M No 1 29° 38´·34N., 121° 56´·41E.
TlMo(C)Y.12s12m3M
Ü No 2
29° 38´·42N., 121° 56´·19E.
2.15
Wk27/20
II
3251 TAIWAN STRAIT - Buoyage.


Insert
GfMo(O)Y.12s
; (a) 23° 46´·10N., 117° 34´·50E.
Delete
GWVQ(3)5s,
r close N of:
(a) above
Insert
GWQ(3)10s
r 23° 45´·92N., 117° 34´·42E.
G\Fl.R.4s
d 7B
23° 45´·59N., 117° 34´·47E.
3252 TAIWAN - Tidal stream. Lights.

Source: Taiwanese Chart 357

Insert symbol, flood tidal stream arrow, direction 105°, 0·5kn,
centred on: 24° 17´·31N., 120° 29´·10E.
Amend light to, Fl(3)Y.10s 24° 18´·76N., 120° 31´·20E.
light to, Fl.R.2s14M & F.R.5M 24° 17´·43N., 120° 30´·02E.
light to, Dir.F.WRG.17M 24° 16´·98N., 120° 31´·40E.
3256 VIETNAM - Depths.

Source: VMS-North Notice 88/20

Insert depth, 11 (a) 20° 49´·22N., 106° 50´·82E.

Insert depth, 11 (a) 20° 49´·22N., 106° 50´·82E.
2.16
Wk27/20
II
3268 CHINA - East Coast - Light-beacons.

Source: Chinese Notices 20/679-681/20
Chart 1601 (Panel A) [ previous update 2966/20 ] CGCS 2000 DATUM

Insert
TÜMo(C)Y.12s12m4M
l 31° 24´·90N., 121° 29´·79E.

Insert
TÜMo(C)Y.12s12m4M
l 31° 24´·90N., 121° 29´·79E.
Chart 1604 (Panel A, Baoshan to Dongfengxi Sha) [ previous update 2966/20 ] CGCS 2000 DATUM
Insert
TÜMo(C)Y.15s13m3M
l No 5
31° 30´·64N., 121° 21´·22E.
31° 29´·57N., 121° 29´·87E.
TÜMo(C)Y.12s12m4M
l 31° 24´·90N., 121° 29´·79E.
3270 CHINA - South Coast - Depths. Rock.

Source: Chinese Notices 20/692-693/20 and ENC C1515732

Delete depth, 3, and associated 5m contour 21° 09´·31N., 110° 24´·25E.

Insert depth, 53 (a) 21° 09´·36N., 110° 24´·21E.
Delete depth, 47, close N of: (a) above
depth, 3, close SE of: (a) above
Replace depth, 139, with depth, 138, with seabed type, R 21° 11´·87N., 110° 25´·25E.
Delete 5m contour, joining: 21° 09´·26N., 110° 24´·20E.
21° 09´·47N., 110° 24´·22E.
3271 CHINA - East Coast - NM Block. Buoyage.


IbF] l(2)G.6s M7 24° 23´·97N., 117° 56´·00E.
GdFl.R.4s
\ M6
24° 24´·07N., 117° 56´·70E.
Delete
IbFl(2)G.6s
] M3
24° 24´·13N., 117° 56´·26E.
GdF\ l.R.4s M2 24° 24´·09N., 117° 56´·51E.
2.17
Wk27/20
II
3275 CHINA - South Coast - Buoyage.

Source: UKHO

Insert
Bd Fl.R.4s D1 (a) 21° 56´·71N., 113° 13´·48E.
Delete
Bd Fl(2)R.6s D1, close SE of: (a) above
Insert
Bd Fl.R.4s G5 (b) 21° 56´·65N., 113° 13´·21E.
Delete
GWr VQ(3)5s G5, close SE of: (b) above
Insert
Bd Fl.R.4s G4 (c) 21° 56´·15N., 113° 13´·13E.
Delete
Bd Fl(2)R.6s G4, close SE of: (c) above
Move
Bd Fl.R.4s G2, from: 21° 55´·69N., 113° 12´·81E.
to: 21° 55´·72N., 113° 12´·77E.
3309 CHINA - East Coast - Light-beacons. Radar beacons.

Source: Chinese Notice 20/682-684/20

Insert
TÜl Mo(C)Y.12s7m3M No 2 (a) 31° 16´·0N., 122° 22´·7E.
radar beacon, Racon(K), at light (a) above
TÜl Mo(C)Y.12s7m3M No 2 (b) 31° 04´·0N., 122° 16´·0E.

radar beacon, Racon(Y), at light (b) above

Insert
TÜl Mo(C)Y.12s7m3M No 2 (a) 31° 15´·96N., 122° 22´·66E.
radar beacon, Racon(K), at light (a) above
TÜl Mo(C)Y.12s7m3M No 2 (b) 31° 04´·05N., 122° 16´·03E.

radar beacon, Racon(Y), at light (b) above
TÜl Mo(C)Y.12s14m3M No 5 31° 08´·57N., 121° 51´·97E.

Insert
TÜl Mo(C)Y.12s14m3M No 5 31° 13´·97N., 121° 46´·50E.
31° 08´·57N., 121° 51´·97E.
3322 CHINA - Yellow Sea Coast - Pilot boarding place.

Source: ENC C1611382
Chart 3695 [ previous update New Edition 04/06/2020 ] CGCS 2000 DATUM
Delete
Â 38° 56´·369N., 121° 42´·789E.
2.18
Wk27/20
II
3324 CHINA - Bo Hai - Wrecks.


Replace
´ with 16$, Wk 39° 34´·5N., 119° 51´·2E.

Replace
´ with 16$, Wk 39° 34´·47N., 119° 51´·20E.

Insert
16$, Wk 39° 34´·5N., 119° 51´·2E.
3330 TAIWAN - Depths.

Source: UKHO

Insert depth, 13, enclosed by 5m contour 23° 32´·2N., 120° 03´·6E.
depth, 26, enclosed by 5m contour 23° 31´·2N., 120° 02´·8E.

Insert depth, 13, and extend 5m contour NE to enclose 23° 32´·21N., 120° 03´·59E.
depth, 26, enclosed by 5m contour 23° 31´·23N., 120° 02´·82E.
depth, 3, enclosed by 5m contour (a) 23° 30´·37N., 120° 03´·20E.
depth, 78, close NE of: (a) above
3283 JAPAN - Hokkaidō - NM Block. Maritime limit. Legends. Jetty. Fixed point.
Source: Japanese Notice 23/419/20
Note: Former Notice 2591(P)/20 is cancelled
Chart JP 1033A [ previous update 1471/20 ] WGS84 DATUM

Insert the accompanying block, centred on: 42° 37´ 15"N., 141° 37´ 11"E.
maritime limit, pecked line, joining: (a) 42° 38´ 49·9"N., 141° 39´ 54·0"E.
(b) 42° 38´ 50·9"N., 141° 39´ 57·0"E.
legend, Under construction, along: (a)-(b) above
Chart JP 1036 [ previous update 1471/20 ] WGS84 DATUM

Insert submerged jetty, dotted line, joining: 42° 37´ 17·5"N., 141° 37´ 13·5"E.
(a) 42° 37´ 15·0"N., 141° 37´ 11·6"E.
legend, Submerged Jetty, close NE of: (a) above
Delete
è 2Y Lts (Submerged Jetty) 42° 37´ 15·8"N., 141° 37´ 12·1"E.
2.19
Wk27/20
II
3284 JAPAN - Kyūshū - NM Block.

Note: Former Notices 5200(T)/12 and 4806(T)/14 are cancelled.


3285 JAPAN - Honshū - Fish haven.


Insert
Á 34° 33´·37N., 137° 13´·58E.
3286 JAPAN - Kyūshū - Breakwater.


Insert breakwater, single firm line, joining: 31° 23´·93N., 130° 45´·93E.
31° 24´·00N., 130° 45´·87E.
3287 JAPAN - Kyūshū - Marine farm. Legend.

Note: Former Notice 2947(P)/20 is cancelled.

Insert limit of marine farm, pecked line, joining: (a) 31° 15´·00N., 130° 45´·87E.
(b) 31° 15´·05N., 130° 45´·30E.
(c) 31° 15´·65N., 130° 45´·37E.
(d) 31° 15´·60N., 130° 45´·93E.
legend, Fish Farms, within: (a)-(d) above

Insert limit of marine farm, pecked line, joining: (a) 31° 15´·00N., 130° 45´·87E.
(b) 31° 15´·05N., 130° 45´·30E.
(c) 31° 15´·65N., 130° 45´·37E.
(d) 31° 15´·60N., 130° 45´·93E.
legend, Fish Farms, within: (a)-(d) above
2.20
Wk27/20
II
3288 JAPAN - Kyūshū - Light.


Delete
· Fl G 3M 30° 41´·27N., 130° 57´·34E.
3255 KOREA - East Coast - Light.

Source: Korean Notice 22/331/20
Chart 898 (Panel B, Pohang and Approaches) [ previous update 3034/20 ] WGS84 DATUM
Amend range of light to, 6M 36° 06´·72N., 129° 26´·46E.
3303 KOREA - South Coast - Lights.

Source: Korean Notice 22/335/20

Amend range of light to, 11M 34° 45´·06N., 127° 45´·66E.
34° 45´·16N., 127° 45´·99E.
3261 INDONESIA - Nusa Tengarra - Wreck. Light-beacons. Beacon. Leading lines.

Source: ENC ID5261R8
Chart 946 (Panel C, Celukanbawang) [ previous update 2455/20 ] WGS84 DATUM

Insert
´Rep (1985) 8° 11´·416S., 114° 50´·870E.
Tj§ Fl.R.6s10m8M (a) 8° 11´·211S., 114° 50´·458E.

Delete
Tj Fl.R.6s11m4M, close S of: (a) above
Replace
K§j with Tj§ Fl.R.4s12m8M 8° 11´·394S., 114° 50´·397E.
Move symbol, white light-beacon with triangular topmark, apex
downwards, Oc.4s17m8M, from: (b) 8° 11´·710S., 114° 50´·186E.
to: (c) 8° 11´·708S., 114° 50´·191E.
Insert leading line, pecked line for 616m then firm line for 950m,
extending in direction 16°, from: (d) (c) above
legend, 196°, seaward end of: (d) above
Delete former leading line, pecked line and firm line, and associated
legend, 198°, extending in direction 18°, from: (b) above
Tj§¿ Fl.R.4s7m6M 8° 11´·411S., 114° 50´·465E.
2.21
Wk27/20
II
3272 INDONESIA - Papua - Light.

Source: ENC ID5379R3

Amend light to, Fl.R.10s30m17M 3° 39´·9S., 133° 45´·6E.
3298 PAPUA NEW GUINEA - Depths. Danger lines.

Source: Australian Chart 614

Insert depth, 191 (a) 17° 36´·7S., 150° 48´·3E.
Insert danger line, dotted line, joining: (b) 17° 40´·1S., 150° 47´·0E.
(c) 17° 35´·6S., 150° 46´·5E.
and
(d) 17° 37´·3S., 150° 51´·1E.
(e) 17° 34´·8S., 150° 48´·0E.
Replace depth, 89, with depth, 43 17° 26´·7S., 150° 54´·4E.
depth, 139, with depth, 10 17° 31´·0S., 150° 52´·9E.
Delete former danger line, dotted line, joining (c) above
(e) above
and
(b) above
(d) above

Insert depth, 191 (a) 17° 36´·7S., 150° 48´·3E.
Insert danger line, dotted line, joining: (b) 17° 40´·0S., 150° 47´·2E.
(c) 17° 35´·8S., 150° 46´·5E.
and
(d) 17° 37´·5S., 150° 50´·9E.
(e) 17° 34´·8S., 150° 48´·0E.
Replace depth, 89, with depth, 43 17° 26´·7S., 150° 54´·4E.
depth, 139, with depth, 10 17° 31´·0S., 150° 52´·9E.
Delete former danger line, dotted line, joining (c) above
(e) above
and
(b) above
(d) above
2.22
Wk27/20
II
3333 NEW ZEALAND - North Island - Marine farms.

Source: New Zealand Notice 12/46/20
Chart NZ 53 [ previous update 1700/19 ] WGS84 DATUM

Insert
Ë 37° 00´·66S., 175° 21´·62E.
37° 00´·92S., 175° 18´·75E.
36° 59´·67S., 175° 18´·04E.
36° 55´·14S., 175° 19´·86E.
Chart NZ 532 [ previous update 1700/19 ] WGS84 DATUM

Insert limit of marine farm, pecked line, joining: (a) 36° 55´·42S., 175° 20´·42E.
(b) 36° 55´·67S., 175° 19´·94E.
(c) 36° 54´·90S., 175° 19´·16E.
(d) 36° 54´·61S., 175° 19´·65E.
Ì, within: (a)-(d) above
3334* PANAMA - Pacific Ocean Coast - NM Block.

Source: PMA
Chart CP 5 [ previous update New Edition 28/05/2020 ] WGS84 DATUM

Insert the accompanying block, centred on: 8° 48´·5N., 79° 35´·0W.
3259 UNITED STATES OF AMERICA - Gulf of Mexico - Obstruction.

Source: US Coast Guard District 8 LNM 20/11324/20
Chart 3183 (Panel, Galveston and Approaches) [ previous update 2585/20 ] NAD83 DATUM
Delete
åObstn PA 29° 20´·48N., 94° 42´·82W.
3274* BELIZE - Pilot boarding places.

Source: Belize Port Authority

Insert
ÂPlacencia Harbour 16° 21´·79N., 88° 24´·01W.

Insert
ÂPlacencia Harbour 16° 21´·80N., 88° 24´·03W.
Delete
ÂBig Creek 16° 26´·24N., 88° 21´·56W.
2.23
Wk27/20
II
3249 UNITED STATES OF AMERICA - East Coast - Obstruction.

Source: ENC US5PHLDF
Chart 2605 (Panel 1) [ previous update 2236/20 ] NAD83 DATUM

Insert
40, Obstn 40° 00´·64N., 75° 02´·80W.
3257 UNITED STATES OF AMERICA - East Coast - Buoyage. Fog signal.

Source: US Coast Guard District 5 LNMs 20/12208/20 and 20/12221/20
Chart 2919 [ previous update 1915/20 ] NAD83 DATUM

Delete
GdFl.R.2·5s ’14’ 37° 07´·41N., 75° 40´·97W.
HpMo(A) Whis ’R1’ 36° 49´·80N., 75° 56´·96W.
3264 UNITED STATES OF AMERICA - East Coast - Buoyage.

Source: US Coast Guard District 5 LNMs 20/12207/20, 20/12210-20/12211/20 and 20/12221/20

Delete
GdFl.R.6s ’6’ 37° 59´·5N., 75° 01´·5W.
GdFl.R.4s ’10’ 37° 32´·3N., 75° 25´·8W.
GdFl.R.2·5s ’12’ 37° 17´·7N., 75° 34´·6W.
GdFl.R.2·5s ’4A’ 36° 35´·6N., 75° 44´·2W.
3297 CANADA - Saint Lawrence River - Beacon.

Source: Canadian Notice 5/1312/20
Chart 4790 [ previous update New Edition 22/08/2019 ] NAD83 DATUM

Delete
ã Bn Or 46° 13´·20N., 72° 55´·11W.
3299 CANADA - Gulf of Saint Lawrence - Buoy. Fog signal.

Source: Canadian Notices 5/4013/20 and 5/4023/20

Replace
Gj Q R WHIS with Jj Q R C2 46° 02´·6N., 63° 06´·9W.

Replace
Gd Q R WHIS with Jd Q R C2 46° 02´·6N., 63° 06´·8W.
2.24
Wk27/20
II
3304 CANADA - Saint Lawrence River - Obstructions. Fog signal.

Source: Canadian Notices 5/1203/20, 5/1234/20 and 5/1320/20
Chart 4779 [ previous update New Edition 06/06/2019 ] NAD83 DATUM

Insert
92, SADO/ODAS 48° 14´·75N., 69° 58´·15W.
Delete fog signal, BELL, at buoy 48° 03´·50N., 69° 38´·60W.

Insert
118- SADO/ODAS 47° 54´·85N., 69° 46´·72W.
83, SADO/ODAS 48° 07´·15N., 69° 24´·00W.

Delete fog signal, BELL, at buoy 48° 03´·50N., 69° 38´·60W.

Insert
118- SADO/ODAS 47° 54´·85N., 69° 46´·72W.
3312 CANADA - Nova Scotia - Mooring buoys. Depths.

Chart 4754 (INT 4633) [ previous update 1272/20 ] NAD83 DATUM

Insert
RPriv 44° 38´ 41·4"N., 63° 32´ 46·0"W.
44° 38´ 36·8"N., 63° 32´ 40·4"W.
depth, 12 (a) 44° 38´ 37·9"N., 63° 32´ 44·3"W.
Insert depth, 03 44° 38´ 12·9"N., 63° 36´ 49·1"W.
depth, 17 44° 38´ 03·6"N., 63° 36´ 57·1"W.
depth, 16 (b) 44° 38´ 05·1"N., 63° 36´ 55·7"W.
Delete depth, 19, close NE of: (b) above
Replace depth, 08, with depth, 06 44° 38´ 07·1"N., 63° 36´ 57·3"W.
3313 CANADA - Saint Lawrence River - Obstructions.


Insert
101- SADO/ODAS 49° 00´·20N., 68° 25´·50W.
114- SADO/ODAS 49° 16´·95N., 67° 38´·90W.
2.25
Wk27/20
II
3316 CANADA - Newfoundland and Labrador - Fog signals. Light.

Source: Canadian Notices 5/4015/20 and 5/4022/20

Amend fog signal to, BELL, at buoy 47° 37´·5N., 58° 23´·0W.
Delete fog signal, WHIS, at buoy 47° 35´·5N., 58° 41´·7W.

Amend fog signal to, BELL, at buoy 47° 37´·4N., 58° 22´·9W.
light to, F R 47° 33´·4N., 61° 33´·8W.
Delete fog signal, WHIS, at buoy 47° 35´·5N., 58° 41´·7W.
3317 CANADA - Saint Lawrence River - Obstructions.

Source: Canadian Notices 5/1221/20, 5/4002/20, 5/4024/20 and 5/4026/20

Insert
90, SADO/ODAS 48° 16´·7N., 62° 38´·6W.
120- SADO/ODAS 50° 07´·5N., 64° 52´·6W.
105- SADO/ODAS 50° 04´·4N., 66° 37´·7W.

Insert
90, SADO/ODAS 48° 16´·7N., 62° 38´·6W.

Insert
120- SADO/ODAS 50° 07´·5N., 64° 52´·6W.
105- SADO/ODAS 50° 04´·4N., 66° 37´·7W.

Insert
105- SADO/ODAS 50° 04´ 20·9"N., 66° 37´ 43·0"W.
3320 CANADA - Saint Lawrence River - NM Block. Depths. Wrecks.


Insert the accompanying block, centred on: 46° 49´·2N., 71° 12´·2W.
depth, 28 46° 46´·11N., 71° 14´·98W.
depth, 44 (a) 46° 44´·94N., 71° 16´·64W.
Insert
15%, Wk (b) 46° 44´·91N., 71° 17´·05W.
Delete
15!, Wk, close SW of: (b) above
2.26
Wk27/20
II
3310(T)/20 ENGLAND - South Coast - Measuring instrument. Buoy.

Source: Plymouth Marine Laboratory
1. A measuring instrument, marked by a yellow spherical light-buoy, Q, has been established in position
50° 15´·16N., 4° 13´·01W.
2. Former Notice 189(T)/20 is cancelled.
(ETRS89 DATUM)
Charts affected - 1267 - 1613 - 1900
3318(T)/20 POLAND - Explosives dumping ground.

Source: Polish Notice 22/365(T)/20
1. Explosives have been reported in the vicinity of the following positions:
55° 03´·09N., 17° 34´·01E.

55° 02´·34N., 17° 38´·42E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)
Charts affected - 2014 (INT 1219) - 2018 (INT 1202) - 2040 (INT 1218) - 2816
3329(T)/20 GERMANY - Baltic Coast - Buoyage.

Source: German Notice 23/36(T)/20
1. ODAS light-buoys, Fl(5)Y.20s, have been temporarily established in the following positions:
54° 20´·30N., 11° 09´·35E.

54° 27´·90N., 10° 51´·27E.
54° 18´·54N., 11° 53´·20E.
54° 14´·86N., 11° 30´·78E.
54° 03´·24N., 11° 18´·47E.
(WGS84 DATUM)
Charts affected - 2106 (INT 1303) - 2117 - 2359 (INT 1361) - 2942 (INT 1353) - 2944 (INT 1351)
2.27
Wk27/20
II
3248(P)/20 FRANCE - North Coast - Notes.

Source: French Notice 17/2.4.2/20
1. Updated Section: PILOTAGE Text Box, DUNKERQUE, PROCEDURE
Replace:
(1) Pilotage is compulsory for the following:
(a) All vessels of 100m LOA or more in the Outer Zone

(b) All vessels of 70m LOA or more in the Inner Zone bound for Port Ouest
(c) All vessels of 50m LOA or more in the Inner Zone bound for Port Est
(d) All vessels carrying dangerous cargoes or without VHF, regardless of length, in both Zones
With:
(1) Pilotage is compulsory for the following:
(a) All vessels of 100m LOA or more in the Outer Zone

(b) All vessels of 70m LOA or more in the Inner Zone bound for Port Ouest
(c) All vessels of 50m LOA or more in the Inner Zone bound for Port Est
(d) All vessels carrying dangerous cargoes or without VHF, regardless of length, in both Zones
(e) Pilotage is compulsory within the basins and outer harbour area for the following vessel movements:
(i) Passing through a lock or lock gate
(ii) Entering or leaving a dock or dry dock
(iii) Moving from one dock or basin to another
(iv) Moving from one port zone, as described in (f) below, to another
(v) Any movement involving the use of tugs
(f) The following vessels are not bound by the requirements described in (e) above when moving without tug
assistance within the same zone as described below:
(i) Vessels less than 70m LOA in zone A (Port Est, E of the Brocquaire Channel)
(ii) Vessels less than 80m LOA in zone B (Port Est, W of the Brocquaire Channel)
(iii) Vessels less than 90m LOA in zone C (Port Ouest)
These lengths are increased to 85m, 100m and 130m respectively for vessels, including ferry boats, with
working thrusters.
Chart affected - 8164
3265(T)/20 ITALY - East Coast - Moored storage tanker. Restricted area.

Source: Italian Notice 11.29(T)/20
1. Until further notice, the M.V Seminole is moored in position 42° 24´·00N., 14° 25´·00E.
2. An entry prohibited area, radius 1M, has been established centred on the vessel.
3. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
(WGS84 DATUM)
Charts affected - 200 - 1443
3314(T)/20 ISRAEL - Mediterranean Sea Coast - Restricted area.

Source: Israeli Notice 72/20
1. A closed area has been established, radius 1M, centred on position 31° 55´·93N., 34° 34´·02E.
(WGS84 DATUM)
Charts affected - 1591 (INT 3681) - 2634
2.28
Wk27/20
II
3242(T)/20 BAHRAIN - Jetty. Works.

Source: MENAS Nav Warning 156/20
1. Construction of a temporary jetty is taking place within an area bounded by the following positions:
26° 09´·90N., 50° 39´·60E.

26° 09´·94N., 50° 39´·68E.
26° 09´·80N., 50° 39´·76E.
26° 09´·76N., 50° 39´·68E.
2. Mariners are advised to navigate with caution in the area and to consult the local port authority for the latest information.
(WGS84 DATUM)
Charts affected - 3734 (INT 7261) - 3736 (INT 7258)
3306(P)/20 INDONESIA - Sumatera - Submarine cable.

Source: Indonesian Notice 22/258/20
1. A submarine cable has been laid joining the following positions:
0° 31´·75N., 104° 22´·29E.

0° 30´·50N., 104° 20´·53E.
0° 28´·12N., 104° 19´·19E.
0° 26´·23N., 104° 15´·14E.
0° 26´·00N., 104° 07´·83E.
0° 29´·44N., 103° 55´·02E.
0° 38´·14N., 103° 47´·84E.
0° 40´·94N., 103° 38´·40E.
0° 44´·02N., 103° 36´·12E.
0° 50´·94N., 103° 35´·18E.
1° 01´·68N., 103° 33´·40E.
1° 02´·09N., 103° 33´·29E.
3. These changes will be included in a New Edition of Chart 3948 to be published mid 2020.
4. Chart 2403 will be updated by Notice to Mariners.
5. Former Notice 2616(P)/19 is cancelled.
(WGS84 DATUM)
2.29
Wk27/20
II
3253(P)/20 TAIWAN - Lights. Buoyage.

Source: Taiwanese Chart 357
1. There have been numerous changes to lights in T’ai-Chung. The following lights have changed:
Amended characteristic Position

Fl.R.4s 24° 18´·84N., 120° 31´·02E.
Fl(3)Y.10s 24° 18´·76N., 120° 31´·20E.
Fl.G.4s44m17M 24° 17´·98N., 120° 29´·19E.
F.Y.55m11M 24° 17´·81N., 120° 30´·17E.
Dir.F.WRG.11m11-14M and F.Y.39m11M 24° 17´·69N., 120° 29´·91E.
Fl.R.2s43m14M and F.R.5M 24° 17´·41N., 120° 30´·04E.
Dir.F.WRG.68m17M 24° 16´·96N., 120° 31´·42E.
F.92m10M 24° 16´·78N., 120° 31´·85E.
F.G.47m9M 24° 15´·23N., 120° 30´·48E.
F.Y.27m3M 24° 12´·99N., 120° 27´·68E.
Fl.Y.4s 24° 12´·87N., 120° 27´·90E.
2. There have been changes to buoyage in T’ai-Chung. The following buoys have changed:
Designation Characteristic Position

‘No 1’ Fl.G.4s 24° 16´·06N., 120° 31´·44E.
‘No 3’ Fl(2)G.4s 24° 15´·30N., 120° 30´·36E.
‘No 8’ Fl(3)R.6s 24° 14´·93N., 120° 29´·53E.
‘No 11’ Fl(5)G.7s 24° 14´·40N., 120° 29´·47E.
‘No 13’ Fl.G.4s 24° 14´·18N., 120° 29´·36E.
4. Chart 3231 will be updated by Notice to Mariners.
(WGS84 DATUM)
3300(T)/20 CHINA - South Coast - Buoyage.

Source: UKHO
1. The following temporary lateral light-buoys have been established:
Characteristic Designation Buoy Type Position

Fl(3)G.10s No 1 Starboard-Hand 22° 43´·20N., 113° 40´·54E.
Fl(3)R.10s No 5 Port-Hand 22° 45´·39N., 113° 38´·42E.
2. The following lateral light-buoys have been removed:
Characteristic Designation Buoy Type Position

2.30
Wk27/20
II
3300(T)/20 CHINA - South Coast - Buoyage. (continued)
3. The following light-buoy has been moved:
Characteristic Designation Former Position New Position

Mo(Z)Y.12s No 4 22° 45´·66N., 113° 38´·25E. 22° 45´·62N., 113° 38´·14E.
(CGCS 2000 DATUM)
3311(P)/20 CHINA - South Coast - Submarine cables.

Source: UKHO
1. Submarine cables have been laid joining the following positions:
22° 07´·06N., 114° 06´·80E.

22° 06´·55N., 114° 11´·74E.
22° 06´·60N., 114° 17´·08E.
22° 07´·64N., 114° 20´·34E.
22° 07´·68N., 114° 21´·53E.
22° 07´·92N., 114° 21´·83E.
22° 08´·38N., 114° 22´·90E.
and
22° 06´·50N., 114° 21´·06E.
22° 07´·54N., 114° 22´·90E.
2. These changes will be included when full details are available.
(WGS84 DATUM)
3331(P)/20 CHINA - East Coast - Buoyage.

1. There have been numerous changes to navigational aids within the Nancao Hangdao channel between the positions:
31° 08´·65N., 121° 53´·61E.

31° 00´·02N., 122° 29´·45E.
2. The designations of the existing safe water buoys and lateral buoys marking the Nancao Hangdao channel have been
amended.
3. These and other changes will be included in a New Edition of Chart 1602 to be published mid 2020.
(CGCS 2000 DATUM)
2.31
Wk27/20
II
3289(T)/20 JAPAN - Honshū - Depths.

Source: Japanese Notice 23/5277(T)/20
1. Depths of up to 1·3m less than charted exist on and in the vicinity of a line joining the following positions:
34° 48´ 24"N., 137° 13´ 20"E.

34° 48´ 25"N., 137° 13´ 15"E.
2. A depth of 9m exists in position 34° 48´ 27"N., 137° 13´ 05"E.
(WGS84 DATUM)
Chart affected - JP 1057A
3290(T)/20 JAPAN - Seto Naikai - Obstructions.

1. Obstructions exist in the following positions:
Depth Position
12·3m 34° 20´ 25·2"N., 132° 28´ 15·8"E.
12·7m 34° 20´ 12·5"N., 132° 28´ 23·8"E.
12·6m 34° 20´ 11·1"N., 132° 28´ 25·4"E.
14·1m 34° 20´ 01·4"N., 132° 28´ 22·8"E.
13·5m 34° 19´ 59·0"N., 132° 28´ 20·1"E.
13·9m 34° 19´ 51·3"N., 132° 28´ 22·9"E.
12·6m 34° 20´ 08·5"N., 132° 27´ 59·5"E.
14·8m 34° 20´ 17·0"N., 132° 27´ 51·6"E.
16·9m 34° 20´ 17·6"N., 132° 27´ 46·2"E.
(WGS84 DATUM)
Charts affected - JP 142 - JP 1112A
3291(T)/20 JAPAN - Seto Naikai - Works.

1. Dredging works are taking place, until 31 August 2020, within an area bounded by the following positions:
34° 00´ 36"N., 131° 46´ 02"E.

33° 59´ 54"N., 131° 45´ 33"E.
33° 59´ 59"N., 131° 45´ 21"E.
34° 00´ 41"N., 131° 45´ 50"E.
(WGS84 DATUM)
Charts affected - JP 126 - JP 1106 - JP 1133C
2.32
Wk27/20
II
3292(T)/20 JAPAN - Seto Naikai - Works.

1. Dredging works are taking place, until 31 August 2020, within an area bounded by the following positions:
33° 48´ 13"N., 131° 00´ 37"E.

33° 48´ 05"N., 131° 00´ 50"E.
33° 48´ 01"N., 131° 00´ 46"E.
33° 48´ 10"N., 131° 00´ 34"E.
(WGS84 DATUM)
Chart affected - JP 129
3293(T)/20 JAPAN - Kyūshū - Works.

1. Magnetic survey and dredging works are taking place, until 11 September 2020, within an area bounded by the following
positions:
33° 36´ 50·7"N., 130° 23´ 32·8"E.

33° 36´ 53·2"N., 130° 23´ 30·3"E.
33° 36´ 50·9"N., 130° 23´ 25·7"E.
33° 36´ 55·8"N., 130° 23´ 18·3"E.
33° 36´ 56·8"N., 130° 23´ 17·3"E.
33° 37´ 00·8"N., 130° 23´ 14·8"E.
33° 37´ 04·0"N., 130° 23´ 33·3"E.
33° 36´ 53·0"N., 130° 23´ 40·1"E.
(WGS84 DATUM)
Chart affected - JP 1227
3279(T)/20 KOREA - West Coast - Buoy.

Source: : Korean Notice 22/349(T)/20
1. A yellow ODAS light-buoy, Fl(5)Y.20s, has been established in position 37° 14´·44N., 125° 42´·33E.
(WGS84 DATUM)
Charts affected - 1256 - 1258
3323(T)/20 KOREA - East Coast - Automatic Identification System. Buoyage.

Source: Korean Notice 22/345(T)/20
1. Special buoyage has been established in the following positions:
Designation Light Position

No A Fl(3)Y.7s 35° 24´·26N., 129° 23´·54E.
No B Fl(3)Y.7s 35° 24´·56N., 129° 23´·92E.
2. An Automatic Identification System, AIS, has been established at the light in position 35° 27´·99N., 129° 23´·99E.
(WGS84 DATUM)
Charts affected - 127 - 896 (INT 5355) - 898 - 3480 - 3666 (INT 5251)
2.33
Wk27/20
II
3294(T)/20 NORTH PACIFIC OCEAN - General information.

1. A rocket launch is due to take place from the Tanegashima Space Center between 14 July and 12 August 2020.
2. A sea warning area will be established, bounded by the following positions:
30° 25´·67N., 130° 58´·37E.

30° 26´·40N., 130° 59´·37E.
30° 26´·40N., 131° 15´·00E.
30° 21´·00N., 131° 15´·00E.
30° 21´·00N., 130° 57´·82E.
30° 21´·95N., 130° 57´·82E.
30° 22´·33N., 130° 57´·68E.
3. Between 14 July and 12 August, rocket debris is predicted to fall within areas bounded by the following positions:
30° 14´·72N., 133° 03´·52E.

30° 20´·28N., 133° 11´·42E.
30° 17´·00N., 133° 45´·00E.
30° 04´·00N., 133° 44´·00E.
30° 08´·00N., 133° 03´·00E.
and
30° 00´·00N., 138° 19´·00E.
30° 10´·50N., 138° 25´·07E.
30° 00´·00N., 140° 17´·00E.
29° 32´·00N., 140° 14´·00E.
29° 42´·00N., 138° 24´·00E.
29° 54´·00N., 138° 19´·00E.
and
28° 17´·00N., 156° 10´·00E.
26° 36´·00N., 162° 54´·00E.
25° 33´·00N., 162° 39´·00E.
27° 14´·00N., 155° 54´·00E.
4. Mariners are advised to navigate with caution within these areas.
(WGS84 DATUM)
Charts affected - 2347 - 2412 - 3237 - 3551 - 4509 (INT 509) - 4510 (INT 510) - 4521 - JP 1221
3246(P)/20 ARGENTINA - Channel limit.

Source: UKHO
1. It has been reported that the Río Paraná channel has moved approximately 500m E and N between positions
33° 10´·90S., 60° 22´·66W. and 33° 08´·51S., 60° 25´·15W.
2. Mariners are advised to contact the relevant authorities for the latest information.
3. Chart 1328 will be updated when full details are available.
(WGS84 DATUM)
2.34
Wk27/20
II
3301(P)/20 CANADA - Saint Lawrence River - Depths.

1. Depths less than charted exist within Hauts-fonds Port Joli and Chenal Traverse du Milieu. The most significant are as
follows:
Depth Position
10·5m 47° 11´·48N., 70° 29´·20W.
8·2m 47° 09´·94N., 70° 29´·24W.
7·9m 47° 09´·91N., 70° 28´·94W.
16·4m 47° 10´·41N., 70° 22´·62W.
11·6m 47° 10´·80N., 70° 22´·35W.
6·2m 47° 11´·20N., 70° 21´·17W.
6·6m 47° 11´·82N., 70° 21´·41W.
(NAD83 DATUM)
2.35
Wk27/20
To accompany Notice to Mariners 3247/20
On Chart 121
DEVELOPMENT AREAS
The limits of Development Areas are charted
around certain oil or gas fields. Surface
vessels, subsea craft and divers may be
engaged in constructing and servicing
installations within these areas. Other vessels
are strongly advised to keep outside the
charted limits.
On Chart 1190
DEVELOPMENT AREAS
charted limits.
On Chart 1191
DEVELOPMENT AREAS
charted limits.
Wk27/20
To accompany Notice to Mariners 3271/20. Image Size (mm) 55.2 by 123.4
Wk27/20
Wk27/20
Wk27/20
Wk27/20
Wk27/20
Wk27/20
Wk27/20
Wk27/20
III
NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2016 Edition). It is recommended that the warnings reprinted below should be kept in a file or
book, followed by subsequent weekly reprints. Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via SafetyNET and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@ukho.gov.uk
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA
Co-ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 27, published on the UKHO website 22 Jun 20.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 27
The following NAVAREA I warnings were in force at 220500 UTC Jun 20.
2020 series: 053 060 063 069 076 080 082 083.
Summary of Navarea I warnings issued since Weekly Edition 26:
080 SKAGERAK, KATTEGAT AND THE SOUND.

Chart GB 259 (INT 120).
1. New TSS, precautionary areas, deep-water routes and recommended routes to be established at Skagen, Kattegat and
The Sound on 010000 UTC Jul.
2. For more information see Swedish NTM 14975.
3. Cancel this message 090100 UTC Jul 20.
082 1. Navarea I warnings in force at 191000 UTC Jun 20. 2. Cancel 078/20.
083 1. RIGLIST. Correct at 220500 UTC Jun 20.
Southern North Sea: 51N to 55N

51-43.6N 002-57.9E Seafox 7 ACP Borssele Beta
53-03.3N 001-41.2E Valaris 72 ACP Hewett Gas Field
53-14.0N 003-14.5E 590021
53-19.1N 002-05.8E Ensco 92 ACP South Valiant Gas Field
53-30.9N 003-25.1E Seafox 4 ACP Nam Field
54-24.4N 002-48.9E Maersk Resolve ACP D12-B
North Sea: 55N to 60N, East of 5W

55-43.4N 004-48.0E Maersk Guardian ACP Tyra Gas Field
56-15.0N 003-20.9E Maersk Invincible ACP Valhall Oil Field
56-16.8N 003-24.0E Maersk Reacher ACP Valhall Oil Field
56-43.5N 002-12.5E Ensco 120 ACP Jasmine Gas Field
56-48.4N 000-42.3E Valaris Gorilla VI
56-58.0N 001-52.2E Rowan Gorilla 5 ACP Franklin Gas Field
57-01.9N 001-57.3E Valaris 122 ACP Shearwater Oil Field
57-06.6N 002-50.8E Maersk Integrator ACP Ula Oil Field
57-10.1N 002-15.5E Ocean Endeavor
57-11.7N 001-54.8E Maersk Highlander ACP Culzean Gas Field
57-29.5N 002-18.0E Rowan Viking
57-50.7N 000-54.7W COSL Pioneer
58-04.4N 000-26.2E Wilphoenix
58-50.7N 001-44.6E Rowan Stavanger ACP Gudrun Oil and Gas Field
59-29.4N 001-33.5E Ocean Patriot
59-32.8N 002-01.1E Deepsea Nordkapp
59-35.4N 001-03.4E Noble Lloyd Noble ACP Mariner Oil Field
59-53.9N 001-16.9E Stena Don
Norwegian Sea: 60N to 65N, East of 5W

60-03.6N 003-59.5W Transocean Leader
60-20.2N 004-02.4W Deepsea Aberdeen
60-30.4N 002-00.9E Maersk Intrepid
60-45.3N 003-26.5E Transocean Endurance
60-49.9N 003-36.1E Transocean Equinox
60-56.2N 002-37.2E West Hercules
60-56.7N 003-34.7E COSL Promoter
61-20.7N 002-04.2E Deepsea Atlantic
Wk27/20 3.1
III
61-23.9N 002-03.9E Transocean Norge
61-32.1N 002-14.7E Transocean Spitsbergen
NEW 61-33.8N 002-02.6E Deepsea Yantai
64-01.8N 006-44.6E West Phoenix
64-52.0N 006-50.3E Transocean Enabler
64-56.8N 006-57.1E West Mira
South and West Coasts of the British Isles.

53-34.0N 003-27.3W Irish Sea Pioneer ACP Hamilton Gas Field
53-49.0N 003-33.6W Borr Ran ACP South Morecambe Gas Field.
NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform.
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no
2. Cancel 079/20.
3.2 Wk27/20
IV
[27/20]
UPDATES TO ADMIRALTY SAILING DIRECTIONS
NP7 South America Pilot Volume 3 (2018 Edition) 11 115948S Security,

771207W Provisioning
and Quarantine
Peru -- Callao — Outer anchorages; wreck 7 12 120124S Fuel loading/ A dangerous
771292W unloading wreck lies near
291--292 the centre of
the area
Paragraph 9.215 including existing Section IV Notice A 120391S Yacht Club
Week 49/18 Replace by: 770995W
1 Designated anchorages exist, for different classes B 120375S Recreational A wreck,
of vessels, centred as follows: 770996W vessels reported
(2019), lies
No Position Designation Remarks
close off the
1 120153S Merchant N limit
771151W vessels 8 C 120384S La Punta Yacht
2 120151S Fishing, Mining, A wreck lies 770982W Club
771009W Factory Vessel in S part
A 120373S Marine School
2 3 120233S Fishing vessels Three 770973W
770949W dangerous
B 120365S Hydrographic Three wrecks
wrecks
770950W vessels and two
lie in the area
mooring buoys
4 120176S Harbour vessels lie in the area
770942W 9 A 120328S Fishing vessels
5 120074S Lay--up vessels 770929W
770998W
B 120340S Harbour vessels
3 6A 115949S Fishing vessels A stranded 770922W
770867W wreck lies on
C 120349S Tour vessels
the NW limit.
770918W
A submarine
pipeline is laid D 120377S Small craft
on the 770927W
S border
Peruvian Notice 5/21/20 [NP7--No 102--Wk 27/20]
6B 120018S Fishing vessels
770912W
Panama -- Gulf of Panama -- Isla Taboga —
4 7 115948S Nuclear Anchorage
771060W powered
vessels and any 363
vessel carrying Paragraph 13.18 1--3 Replace by:
or holding
radioactive 1 Position and function. Isla Taboga (84750N
material 793334W), wooded except on N face of SE ridge, is
mainly used as a bunkering anchorage.
5 8 120057S Tankers Oil A stranded
Port Authority. Autoridad Portuaria Nacional,
771132W and Gas wreck,
Apdo 8062, Panamá 7, Panamá.
surrounded by
Pilotage is not compulsory. Pilot boards at Balboa
a restricted
area radius anchorage.
165 m marked Directions. For the channel NE of Isla Taboga see
by an isolated 13.21.
danger buoy, 2 Useful marks:
and a Towers (84725N 793372W).
dangerous Church (84769N 793333W).
wreck lie in Anchorages. Designated anchorages are as
the E part follows:
G1--G5 anchor berths (84914N 793503W);
6 9 1202110S Pilot waiting
radius from 350 to 555 m; vessels greater than
7710190W area
500 gt and less than 300 m LOA;
10 120100S Vessels 3 TM1--TM3 anchor berths (84789N 793495W);
770890W awaiting radius 555 m; vessels greater than 500 gt and
disposal less than 300 m LOA.
Wk27/20 4.1
IV
Further anchorages for bunkering have been Denmark -- Kattegat -- Roskilde Fjord --
reported as follows: Kulhus Rende — Directions; leading beacons
Vicinity of 84740N 793180W, in a depth of about
31 m; 151
Vicinity of 84855N 793370W; Paragraph 4.222 3 lines 1--9 Replace by:
Vicinity of 84885N 793130W;
Vicinity of 84595N 793240W. 3 The track then continues E for about 2¼ miles
4 Anchorage may also be obtained about 3½ cables through a channel, marked by buoys (lateral) passing:
NE of Taboga village (84765N 793327W) in a
depth of 18 m. Danish Notice 21/361/20 [NP18--No 3--Wk 27/20]
Other facilities. Medical.
Sweden -- The Sound -- Landskrona — Pilotage
After Paragraph 13.19 1 line 9 Insert:
197
Anchorage. See 13.18.
Pilots board in position 555400N 124540E.
Anchorage. See 13.18.
Swedish Notice 807/14924/20 [NP18--No 4--Wk 27/20]
Panama Maritime Authority [NP7--No 101--Wk 27/20]
Denmark -- Storebælt -- Storebælt Link —
Vertical clearance
NP18 Baltic Pilot Volume 1 (2020 Edition)
261
The following notice is to be implemented at 0000 Paragraph 8.17 4 line 5 For 65 m Read 64 m
UTC on 1 st July 2020
Danish Notice 19/299/20 [NP18--No 5--Wk 27/20]
Denmark -- Kattegat -- Skagen — Directions; TSS
Denmark -- Smålandsfarvandet -- Storstrøm --
79 Orehoved — Directions; light
Paragraph 3.14 1 lines 1--5 Replace by: 346
1 Track. From a position approximately 5 miles NNW Paragraph 11.135 1 lines 1--5 Replace by:
of Skagen W Light (3.236), the track leads E for
9 miles through Skagen W TSS and into the 1 From a position in the vicinity of 550052N
Off Skagen precautionary area. The track then leads 114910E the track leads SSE for about 1¾ miles,
SE for 4 miles out of the precautionary area and passing:
through Skagen E TSS, to a position 10 miles ENE of Danish Notice 10/159/20 [NP18--No 6--Wk 27/20]
Skagen Light (574413N 103781E) in the vicinity of
No 1A Light Buoy (safe water) (574676N
Denmark -- Smålandsfarvandet -- Grønsund --
105570E). Thence the track leads SE for about Bogø — Directions; leading lights
25 miles, passing:
349
IMO Colreg.2/Circ.71, IMO SN.1/Circ.336
[NP18--No 1--Wk 27/20] Paragraph 11.145 3--5 Replace by:
The following notice is to be implemented at 0000 3 Directions. The harbour is approached from S
UTC on 1 st July 2020 through a marked channel across Bredemads Hage
(11.136).
Alongside berths. The W side of the mole has a
Denmark -- Kattegat -- Skagen — Directions; TSS dredged depth alongside of 31 m.
Oily waste. There are limited reception facilities
113 available for oily bilge water.
Supplies: water; provisions.
Paragraph 3.237 1 lines 1--3 Replace by:
Danish Notice 22/384/20 [NP18--No 7--Wk 27/20]
1 From a position approximately 5 miles NNW of
Skagen W Light (3.236) the track leads E for 7½ miles
through Skagen W TSS and into the Off Skagen Denmark -- Femern Bælt -- Rødbyhavn —
Prohibited area
precautionary area. The track then leads S for
2½ miles to the boundary of the precautionary area to 359
a position about 5½ miles NE of Skagen Lighthouse
(3.236). Thence the track leads S on Route C, After Paragraph 12.29 3 line 10 Insert:
passing: A prohibited area, marked by light buoys (special), is
centred on 543772N 112119E.
[NP18--No 2--Wk 27/20] Danish Notice 21/347/20(P) [NP18--No 8--Wk 27/20]
4.2 Wk27/20
IV
Germany -- Baltic Sea -- Lübeck — NP19 Baltic Pilot Volume 2 (2018 Edition)
Horizontal clearances
Poland -- Gulf of Gdansk -- Gdynia — Directions

397
356
Paragraph 13.83 1 line 4 For 375 m Read 37 m
Paragraph 9.58 1--3 Replace by:
1 From the vicinity of GD Light Buoy (safe water)
Paragraph 13.84 3 line 3 For 125 m Read 12 m (543205N 183984E) the track follows the line of
bearing (2715) of a light (concrete tower)
(543217N 183190E) through a channel, marked by
light buoys (lateral and cardinal), to the main entrance.
German Chart DE52 (2020) [NP18--No 9--Wk 27/20]
Lights are displayed, one each side of the main
entrance as follows:
2 N side (concrete tower with gallery and dome,
Germany -- North--east of Warnemünde — 13 m in height) at the S end of the N
Restricted area; explosives dumping ground detached breakwater.
S side (similar structure) at the N end of the S
detached breakwater.
399
Polish Notice 22/325/20 [NP19--No 104--Wk 27/20]
Paragraph 13.117 3 lines 1--3 Delete
Latvia -- Liepºja — Prohibited areas
German Notice 14/64/20 [NP18--No 10--Wk 27/20] 382
Germany -- Rostock -- Warnemünde Reede — Prohibited areas

Anchorage 10.88a
1 Explosives dumping grounds, in which anchoring
and underwater operations are prohibited, are centred
400 on:
562635N 204052E;
Paragraph 13.122 2 lines 1--5 Replace by: 563320N 204112E;
563400N 205900E;
2 Care is needed when anchoring to avoid a patch of 562670N 205510E.
foul ground (541349N 120114E) lying in the E part
of anchorage area No 1. Latvian Chart LV2259/20 [NP19--No 105--Wk 27/20]
German Notice 18/36/20 [NP18--No 11--Wk 27/20]

NP30 China Sea Pilot Volume 1 (2018 Edition)
Germany -- Rostock — Prohibited areas China -- Hong Kong – Lantau Island —

Anchorage
401 309
Paragraph 8.328 1--2 including existing Section IV Notice

After Paragraph 13.133 3 line 9 Insert: Week 12/19 Replace by:
1 Anchorage areas are as follows:
Prohibited area Y1 No 21DY (221226N 1134840E); general
13.133a anchorage;
1 A prohibited area (541096N 120532E), which Y2 No 22DY (221305N 1134830E); general
surrounds works in progress (2020), lies E of the anchorage;
entrance to Alter Strom (13.145). No 1 Waiting Anchorage (221572N 1134982E);
quarantine.
Entry is also prohibited within 100 m of 540968N
2 Caution. A wreck (221189N 1134843E),
120674E.
reported (2011), lies on the S limit of area Y1
No 21DY.
German Notices 11/1672/20 & 13/1672/20
[NP18--No 12--Wk 27/20] Chinese Notice 11/28/20 [NP30--No 148--Wk 27/20]
Wk27/20 4.3
IV
NP32A China Sea Pilot Volume 3 (2019 Edition) NP55 North Sea (East) Pilot (2018 Edition)
The following notices are to be implemented at 0000

UTC on 1 st July 2020
China -- Maji Shan Gang — Regulations
Denmark -- Skagerrak -- Hanstholm to Skagen —

244 Recommended routes
After Paragraph 6.198 2 Insert:

4
3 Regulations concerning entry. Vessels over
30 000 gt are prohibited from overtaking or passing in After Paragraph 1.20 2 line 3 Insert:
Majishan Gang Entrance Channel between No 1 Between the vicinity of Hanstholm (9.302) and
Anchorage and the berths without prior permission Skagen peninsula (9.315) two IMO--recommended
from VTS. routes are established.
Vessels should avoid turning around in the entrance N of Skagen peninsula, Skagen W and Skagen E
channel. TSSs are established, separated by a precautionary
As far as possible, vessels should cross the area, see 9.293a.
navigation channels at right angles and avoid
obstructing vessels navigating within the channels. IMO Colreg.2/Circ.71, IMO SN.1/Circ.336
[NP55--No 43--Wk 27/20]
Chinese Update to C1 Book C110 Ships routing and VTS
[NP32A--No 125--Wk 27/20]
Inshore traffic zones
NP43 South and East Coasts of Korea, East 4

Coast of Siberia and Sea of Okhotsk Pilot Paragraph 1.21 1 lines 1--4 Replace by:
(2020 Edition)
1 Inshore traffic zones (ITZ) are established inshore
of Off Vlieland TSS, Terschelling--German Bight TSS
and Skagen W TSS (1.20). Regulations for the use of
Russia -- Sea of Okhotsk -- Sakhalinskiy Zaliv -- an ITZ are given in Rule 10 of The International
Proliv Tatarskiy — Pilotage
Regulations for Preventing Collisions at Sea (1972).
321 IMO Colreg.2/Circ.71, IMO SN.1/Circ.336

[NP55--No 44--Wk 27/20]
Paragraph 10.5 2 line(s) 5--6 Replace by:
...(10.39). Pilots board in position 532139N 1414146E. Regulations
Russian Chart RU62177 Ed 2 (2019)

[NP43--No 27--Wk 27/20] 300
After Paragraph 9.293 Insert:
Regulations
NP47 Mediterranean Pilot Volume 3 9.293a
(2017 Edition) 1 Recommended routes. Two IMO recommended
two--way routes exist off the N coast of Jylland
between Hanstholm and Skagen peninsula (9.315),
Adriatic Sea-- Croatia -- RijeÅki Zaljev — designated Route A and Route B.
Anchorage 2 Traffic separation schemes. Two traffic separation
schemes, Skagen W and Skagen E are established N
of Skagen, separated by a precautionary area. The
369 schemes are IMO--adopted, and Rule 10 of The
International Regulations for Preventing Collisions at
Paragraph 9.194 1 line(s) 5--7 Replace by: Sea (1972) applies.
3 Inshore traffic zone. An inshore traffic zone is
Tankers and vessels carrying dangerous goods established between Skagen W TSS, the W part of
anchor in the E section of the anchorage (451585N the precautionary area and the coast.
142900E).
Croatian Notice 5/3/20 [NP47--No 85--Wk 27/20] [NP55--No 45--Wk 27/20]
4.4 Wk27/20
IV
Denmark -- Skagerrak -- Hanstholm to Skagen — NP56 Norway Pilot Volume 1 (2018 Edition)
Recommended routes
302
Norway -- Skagerrak -- Mandal -- Hille north --
Gjallaråsholmen — Directions; leading lights
Paragraph 9.312 1 lines 1--6 Replace by:
1 From a position off Hanstholm (570676N 103

83591E) the track follows the offshore
IMO -- recommended two -- way Route A NE for
approximately 48 miles, thence ENE for approximately ...Våre, and the coastal islets, 5 cables N.
30 miles to Skagen W TSS. Alternatively, for vessels Gjallaråsholmen Leading Lights:
transiting closer to shore, the track follows Front light (white lantern) (580154N 72035E).
IMO -- recommended two -- way Route B NE for Rear light (similar structure) (3¾ cables from front
approximately 68 miles to join Route A, thence ENE light).
for approximately 9 miles to Skagen W TSS (9.293a). The alignment (0805) of these lights leads E for
about 3 miles, passing:
[NP55--No 46--Wk 27/20] Norwegian Notice 10/61505/20
[NP56--No 30--Wk 27/20]
Denmark -- Skagerrak -- Hanstholm to Skagen — Norway -- Skagerrak -- Songvårfjorden --

Directions; recommended routes Norde Vassøy — Directions; light sector
304 114
After Paragraph 9.325 2 line 9 Insert: Paragraph 3.75 1 line(s) 1--5 Replace by:
1 From a position in the vicinity of 580180N
Route A 74283E, the track leads E through Songvårfjorden
9.325a for 4½ miles, passing:
1 From a position 17¼ miles NNW of Hanstholm Light
(9.300), Route A leads NE for 48 miles to a position
approximately 17 miles NW of Hirtshals Light (9.325). ...to Auster Grønningen, and:
Thence the track leads ENE for approximately
29 miles to a position at the entrance to Skagen W Norwegian Notice 10/61509/20
TSS. The route passes entirely outside the 20 m [NP56--No 31--Wk 27/20]
contour and is clear of dangers throughout.
Paragraph 9.326 including heading and existing Section IV

Notice Week 12/20 Replace by: NP57A Norway Pilot Volume 2A
(2019 Edition)
Route B
9.326
1 From a position 7 miles NNW of Hanstholm Light Rogaland -- Karmøy -- Skudeneshavn —
(9.300), Route B leads ENE across Vigsø Bugt (9.313) Directions; light; leading line
Jammerbugt (9.314) and Tannis Bugt (9.315) for
approximately 68 miles. The route crosses an 87
extensive shoal area (572940N 91660E) with
Paragraph 3.65 1--3 Replace by:
depths less than 20 m. A dangerous wreck
(572447N 90713E) lies in the SW part of the 1 Secondary channel. A secondary channel leads
shoal area. into Skudeneshavn from the S, entering between a
2 Thence the track joins Route A (9.325a) and leads mole (590863N 51556E) extending E from
ENE for approximately 9 miles to a position at the Karmøy, and a mole, close S, extending W from
entrance to Skagen W TSS. Skjåholmen.
Useful marks: 2 The channel is marked by the alignment (3234) of
Gammel Skagen Beacon (574351N 103122E). the following lights:
Höjen Old Lighthouse (574442N 103328E), Skudeneshavn Molo Light (post, 3 m in height)
disused and charted as a tower. (590860N 51554E).
(Directions continue in Baltic Pilot Volume I) Skagaskjeret Light (590864N 51549E).
IMO Colreg.2/Circ.71, IMO SN.1/Circ.336 Norwegian Notice 10/61506/20

[NP55--No 47--Wk 27/20] [NP57A--No 26--Wk 27/20]
Wk27/20 4.5
IV
Hordaland -- Hardangerfjorden -- Skorpegavlen NP58A Norway Pilot Volume 3A (2020 Edition)

— Directions; light sector; bearing
194 Nord--Trøndelag -- Dolmsundet to Lekafjorden --

Gullhomen — Directions; rocks
Paragraph 6.155 1 line(s) 7 For red Read green
77
Paragraph 6.155 1 line(s) 9 For 1056 Read 1059 Paragraph 3.66 4 line(s) 1--5 Replace by:
Paragraph 6.155 2 line(s) 5 For (1291--132) Read 4 WNW of a rock (650152N 114238E), depth
(1306--1331) 92 m, situated near the W extent of a shoal
area. A rock (650156N 114272E), depth
56 m, marked by a buoy (isolated danger), is
Paragraph 6.155 3 line(s) 6 For (1515--1617) Read
situated near the E extent of the shoal.
(1517--1619)
Thence the track leads to a position about 1 mile E
of Madsøygalten Light (650248N 114089E) (3.28).
Norwegian Notice 10/61523/20
[NP57A--No 27--Wk 27/20] Norwegian Notice 10/61512/20
[NP58A--No 25--Wk 27/20]
Hordaland -- Hardangerfjorden -- Skorpegavlen
— Directions; light sector Lofoten -- Moskenesøya -- Approaches to
Sundstraumen through Selfjorden -- Hornneset
196 — Directions; light sectors
Paragraph 6.170 4 line(s) 1--5 Replace by: 417
4 At night having passed Skorpegavlen the track Paragraph 13.24 1 line(s) 4 For (060½--064 and
leads NE within the white sector (2134--2170) of 069--070½) Read (0609--0638 and 0661--0676)
Skorpen Light, astern, and thence continues NE within
the white sector (3533--0259) of Fjæreflu Light, until Norwegian Notice 10/61528/20; Norwegian LL 776600
a position is reached about 1½ miles S of the latter [NP58A--No 26--Wk 27/20]
light.
Norwegian Notice 10/61523/20 NP58B Norway Pilot Volume 3B (2018 Edition)

[NP57A--No 28--Wk 27/20]
Norway -- North coast -- Laksefjorden --
Hordaland -- Kvinnheradsfjorden to Øynefjorden South Dyfjordhalvøya — Directions; light sector
— Directions; light sectors; bearings
348
198
Paragraph 11.105 2 line(s) 1--5 Delete
Paragraph 6.189 2 line(s) 3 For red Read green
Norwegian Notice 10/61532/20
Paragraph 6.189 2 line(s) 4 For 1799 Read 1819 [NP58B--No 47--Wk 27/20]
Paragraph 6.189 2 line(s) 9 For 3471 Read 3459

NP68 East Coast of the United States Pilot
Paragraph 6.189 4 line(s) 6 For red Read green Volume 1 (2018 Edition)
Paragraph 6.189 4 line(s) 7 For 2253 Read 2254 Rhode Island -- Rhode Island Sound --
Approaches to Narragansett Bay —
Paragraph 6.189 5 line(s) 3 For (336--3471) Read Directions; wreck
(3359--3459)
159
Paragraph 6.189 5 line(s) 6 For (2253--2305) Read After Paragraph 5.186 1 line 5 Insert:
(2254--2305)
Caution. A dangerous wreck (412105N
712482W) lies in the outbound lane of the TSS.
Norwegian Notice 10/61497; 61499/20
[NP57A--No 29--Wk 27/20] US Notice 23/12300/20 [NP68--No 33--Wk 27/20]
4.6 Wk27/20
V
UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS
NP74, Vol A Edition 2020. Weekly Edition No. 27, Dated 02 July 2020.
Last Updates: Weekly Edition No. 26, dated 25 June 2020.
WEST COAST. FIRTH OF CLYDE. LOCH LONG. FINNART OCEAN TERMINAL

A4411·9 - Cnap Point 56 07·38 N Fl(2)Y 6s 5 .. .. (P) 2020
(GB:CPO) 4 50·19 W
* * * * * * * *
A4412·85 - Mallan No 1 56 06·80 N Fl(2)Y 6s 5 .. .. (P) 2020

(BP) 4 51·10 W
* * * * * * * *

(BP) 4 49·58 W
* * * * * * * *
WEST COAST. FIRTH OF CLYDE. LOCH LONG

(GB:MODN) 4 49·22 W
* * * * * * * *
A5917·32 - Turning Area. S Side 53 43·12 N QW 4 1

6 18·57 W
* * * * * * * *
NP75, Vol B Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
DIE ELBE. NORD-OSTEE-KANAL (KIEL CANAL)

B1436 Remove from list; deleted
DIE ELBE. NORD-OSTEE-KANAL (KIEL CANAL)

B1437 Remove from list; deleted
DIE ELBE
B1472 - Ruthenstrom 53 43·50 N FW
9 25·74 E
* * * * * * * *
DIE ELBE
B1473 - Ruthenstrom 53 43·50 N FW
9 25·80 E
* * * * * * * *
B1474 - Ruthensand 53 43·22 N Dir WRG 6s 15 W15 Red tower, white ec 1·5.
DE, 4003, 310700 9 25·43 E R12 bands and lantern Oc G170°-174·8°(4·8°).
DE, 4003, 310701 G11 15 Oc W174·8°-176·1°(1·3°).
Oc R176·1°-182°(5·9°)
- - Ldg Lts 161·6°. Front .. Iso W 4s .. 9 .. Intens on leading line only.
Rear B1474·1
*
B1499·3 - Schwarztonnensand 53 41·21 N FW

9 29·18 E
* * * * * * * *
B1499·5 - Schwarztonnensand 53 41·24 N FW

9 29·12 E
* * * * * * * *
5.1 Wk27/20
V
NP75, Vol B Edition 2019/20 continued.
B1862·1 - Hvide Sande Kanal. 56 00·17 N 2FR 3 2 White post R060°-035°(335°)

DK, , 167 Industrihavn. Shelter Mole 8 07·37 E
* *
RINGKØBING FJORD
B1862·101 Remove from list; deleted
NP76, Vol C Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
MARSTAL BUCHT. LANGELAND ISLAND

C1709 Remove from list; deleted
GULF OF GDAŃSK. GDYNIA

C3018 Remove from list; deleted
GULF OF GDAŃSK. GDYNIA

C3018·1 Remove from list; deleted
C3029·5 - Kanał Portowy. Nabrzeże 54 32·20 N Dir WRG 24 8 Beacon Oc G 3s 269·7°-270·1°(0·4°).

PL, 521, 0317 Słowackiego. Basen V. SE 18 31·90 E F G270·1°-270·6°(0·5°).
Side. Dir Lt 271·5° Al WG270·6°-271·3°(0·7°).
F W271·3°-271·7°(0·4°).
Al WR271·7°-272·4°(0·7°).
F R272·4°-272·9°(0·5°).
Oc R 3s 272·9°-273·3°(0·4°).
Shown 24 hours
------ .. By day .. 3
------ .. Iso Y 4s 14 6 Beacon Y263°-279°(16°)
* * * * * * * *
NP77, Vol D Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
D1526·3 - Real Club Marítimo. 43 19·84 N Oc G 4s .. 1 Metal post ec 1

ES, I, 00798 Breakwater. Head 3 00·91 W 2
*
D1660·5 - Punta Castrelius 43 33·07 N Fl(4)WG 15s 9 5 Green column, white (fl 1, ec 2) x 3, fl 1, ec 5.
ES, I, 02741 7 02·01 W band W148°-172°(24°), G179°-010°(191°).
8 Obscured 172°-179°(7°)
*
D1689·2 - Piedra de Media Mar 43 39·36 N Fl(2)W 7s 12 4 Black #, red band on fl 0·5, ec 1·5, fl 0·5, ec 4·5
ES, I, 03195 8 04·81 W black truncated
conical tower
13
*
ISLA DE GRAN CANARIA. AFRICA DOCK

D2799·324 - Africa Dock. Starboard 28 09·69 N Dir WR 4s 9 10 White post Iso W350°-000°(10°).
ES, I, 12251·6 Beacon 15 24·05 W 5 Iso R000°-005°(5°)
--- .. By day .. 2
* * * * * * * *
5.2 Wk27/20
V
NP77, Vol D Edition 2019/20 continued.
D2799·325 - Africa Dock. Port Beacon 28 09·69 N Dir WG 4s 9 10 White post Iso G355°-000°(5°).
ES, I, 12251·5 15 24·08 W 5 Iso W000°-010°(10°)
--- .. By day .. 2
* * * * * * * *
D7314·3 - Main Channel. Dir Lt 279° 16 57·71 N Dir WRG 15 10 Grey metal F G277·7°-278·5°(0·8°).
OM, , 0208 53 59·86 E framework tower Al WG278·5°-278·7°(0·2°).
12 F W278·7°-279·7°(1°).
Al WR279·7°-280°(0·3°).
F R280°-280·7°(0·7°).
TE 2020
--- .. By day .. 4
*
WUDĀM
D7324·83 - ABG Marina. W Entrance 23 48·45 N Fl R 4s 5 3 Red & on metal post
OM, , 1008·10 57 34·25 E 2
* *
D7324·835 - ABG Marina. Breakwater. 23 48·52 N Fl W 2s 4 5 Grey metal post

OM, , 1008·5 End 57 34·33 E 2
* *
D7324·84 - ABG Marina. E Entrance 23 48·50 N Fl G 2s 4 3 Green % on metal

OM, , 1008·9 57 34·23 E post
2
* *
NP78, Vol E Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
E0383·2 - Dique de Levante. Muelle 41 03·67 N Fl(4)G 11s .. 6 Green cylindrical (fl 0·5, ec 1·5) x 3, fl 0·5, ec 4·5
ES, , 28561 del Varadero. Head 1 03·68 E post, white base
* * * * * * * *
E0383·3 - Dique de Levante. Carril 41 03·69 N Fl G 5s 3 1 Green cylindrical fl 0·5

ES, , 28562 travelift. Head 1 03·72 E post, white base
2
* * * * * * * *
E0392·3 - Breakwater. Head 41 06·35 N Fl(2)G 10s 7 5 Green % on white fl 1, ec 2, fl 1, ec 6

ES, II, 29080 1 15·07 E post
3
*
RADA DI AUGUSTA
E1852·9 Remove from list; deleted
E1853·1 - SALSOL ITALY. Jetty. 37 13·77 N F RG(vert) 7 5 Red post, green bands 1m apart. Private
IT, , 2874·02 Head 15 11·88 E 2
*
EAST OF RAVENNA. OIL TERMINAL

E7520 - Terminale N. 1 (Isola 44 28·57 N Fl(2)W 5s 10 8 White post, red bands fl 0·5, ec 1, fl 0·5, ec 3.
IT, , 4049 raffinazione) 12 21·81 E 10 Private. Numerous oil installations,
some marked by lights and fog
signals, lie within a radius of 20M.
TE 2020
--- .. Horn Mo(U) .. 3 .. (bl 5, si 2) x 2, bl 5, si 26.
45s TD 2020
* *
5.3 Wk27/20
V
NP79, Vol F Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
F2536 - Sorsogon Bay. Bagatao 12 49·94 N Fl W 5s 41 17 White round metal Vis over an arc of 130°
PH, , 0097 Island. SW Point 123 47·51 E tower and dwelling
(PH:CG) 10
* *
F2858·1 - Ldg Lts 311°14′. Rear. 3 58·93 N Oc G 5s 34 15 Green beacon G296·1°-326·1°(30°)

960m from front 103 25·50 E 30
* * * *
F2860·15 - Port of Kemaman. Outer 4 12·92 N QR 12 5 Beacon

Approaches. South 103 29·85 E
*
NP80, Vol G Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
G3518·765 - CFE. Breakwater. No 1 25 36·17 N Fl G 3s 8 6 Green round metal fl 0·5

MX, , 25-390 109 02·28 W tower
6
*
G3518·766 - CFE. Breakwater. No 2 25 36·21 N Fl G 3s 8 6 Green round metal fl 0·5

MX, , 25-390·1 109 02·21 W tower
6
*
BAHÍA DE TOPOLOBAMPO
G3518·8 - Container Quay. E 25 34·92 N Iso G 2s 8 5 White round metal
MX, , 25-130·4 109 03·55 W tower
6
*
G5689·9 - Coldwell Point. Sisters 52 19·15 N Fl W 6s 7 3 White square fl 0·5

CA, P, 604·5 Point 128 01·52 W framework tower
7
*
NP81, Vol H Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
Last Updates: Weekly Edition No. 22, dated 28 May 2020.
H0214 - Saint Georges Harbour. 48 25·90 N Fl Y 4s 3 . . Mast fl 1.

CA, N, 183 Saint George's. Wharf. 58 29·13 W 3 Seasonal
Cautionary light
* * * *
CAPE BRETON ISLAND. SOUTH COAST. ISLE MADAME. GREEN ISLAND

H3376 - Green Island. Summit 45 28·69 N Fl(2)W 20s 34 10 White round tower, fl 1, ec 3, fl 1, ec 15
CA, A, 722 60 53·96 W red top
11
* * * * * * * *
5.4 Wk27/20
V
NP81, Vol H Edition 2019/20 continued.
H3658 West Dover. Callahan Island. 44 29·41 N Fl G (2+1) 6s 15 4 Red and white U, red
CA, A, 488 S End 63 51·68 W , and green & in the
centre, on pipe swing
pole
6
* * *
H3834 Remove from list; deleted
NP82, Vol J Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
J4180·2 - No 13 28 56·48 N QG 5 3 Green &, yellow &,

US, IV, 27011 95 18·54 W on pile
US, IV, 37382
* * * * * * * *
J4181·36 - Junction. FH 28 56·45 N Fl(2+1)G 6s 5 3 Green & daymark ,

US, IV, 27012 95 18·82 W red bands, yellow %,
US, IV, 37384 on pile
* * * * * * * *
J4181·63 - No 18 28 56·18 N Fl R 2·5s 5 3 Red % on pile

US, IV, 27017 95 19·41 W
* * * * * * * *
J4181·73 - No 19 28 55·97 N QG 5 3 Green & on pile

US, IV, 27018 95 19·35 W
* * * * * * * *
GULF OF PARIA. BOCA GRANDE. CHACACHACARE ISLAND

J5846 - Chacachacare Island 10 41·93 N Fl W 10s 251 26 White concrete tower fl 0·4.
(Summit of N Point). Lts in 61 45·15 W 15 TE 2020
line 036°. Rear
* *
NP83, Vol K Edition 2020/21. Weekly Edition No. 27, Dated 02 July 2020.
K2337·1 - Port Melbourne Channel. 37 57·79 S Fl G 1·5s 10 9 Green % on green

No E1 144 55·51 E metal beacon
* * *
K2337·12 - Port Melbourne Channel. 37 57·79 S Fl R 1·5s 10 9 Red & on red metal
No E2 144 55·36 E beacon
* *
K2338·25 - Port Melbourne Channel. 37 52·52 S Fl(2)R 4s 7 5 Red beacon

No 14 144 55·60 E
*
K2338·26 - Port Melbourne Channel. 37 52·32 S Fl R 5s 7 2 Red beacon

No 16 144 55·53 E
*
5.5 Wk27/20
V
NP83, Vol K Edition 2020/21 continued.
K2338·4 - Port Melbourne Channel. 37 52·09 S Q(9)W 15s .. 2 $ on yellow beacon,

No 15 144 55·56 E black band
*
HA'APAI GROUP. KOTU GROUP. HA'AFEVA ISLAND

K4637 - Ha'afeva Island 19 57·58 S Q(6) + LFl W .. 10 " on black beacon,
174 41·18 W 15s yellow top
* * * * *
HA'APAI GROUP. KOTU GROUP. HAAFEVA ISLAND

K4637·2 - Pulotu 19 56·60 S Q G 1s 18 4 Green pile
174 43·37 W
* * *
HA'APAI GROUP. KOTU GROUP. TOKULU ISLAND

K4639·5 - Tokulu Island 20 06·10 S Fl W 3s 9 10 Metal tower
174 47·46 W 12
* * *
HA'APAI GROUP. NOMUKA GROUP. NOMUKA ISLAND

K4640 - Muifuiva 20 16·13 S Fl(2)W 5s 9 10 Metal tower
174 49·06 W 7
* * * *
K4735 - Yaciwa (Coconut) Island 18 08·24 S Fl W 6s 9 8·5 White round concrete

FJ, F201, 4735 179 20·53 E tower, red band
5
* * *
NP85, Vol M Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
M4305·428 Jinjiyeo 34 43·63 N Fl(2)W 10s 7 3 Black # on black

KR, 410, 2538·5 127 26·49 E beacon, red band
8
*
M4310·1 - Yeosu Hang. E Breakwater 34 45·16 N Fl G 4s 25 11 White round concrete

KR, 410, 2453·5 Head 127 45·99 E tower
18
*
M4310·3 - Yeosu Sin Hang. N 34 45·07 N Fl Y 4s 19 11 Yellow round

KR, 410, 2456 Breakwater 127 45·66 E concrete tower
18
*
M4345·305 Gotdo 35 04·32 N Fl(4)Y 8s 9 7 × on yellow beacon (T) 2020

128 44·55 E
* * * * * * * *
M4410·65 - Yeongilman Hang. 36 06·72 N Fl G 4s 9 6 White round metal

KR, 410, 1302·6 Container Terminal Wharf. 129 26·46 E tower
N End 8
*
M5870·5 - Dir Lt 358°. E 34 42·02 N Dir WRG 21 7 White post F R352°-356°(4°). F W356°-000°(4°).
JP, 411, 3656·5 135 14·63 E 16 F G000°-004°(4°)
--- .. By day .. 0·5
* *
5.6 Wk27/20
V
NP87, Vol P Edition 2019/20. Weekly Edition No. 27, Dated 02 July 2020.
P3692·42 - Dazhong Zhuang Pier. No 1 29 38·34 N Mo(C)Y 12s 12 3 Yellow × on yellow

CN, G102, 2545·81 121 56·41 E beacon
5
* * * * * * * *
P3692·43 - Dazhong Zuang Pier. No 2 29 38·42 N Mo(C)Y 12s 12 3 Yellow × on yellow

CN, G102, 2545·82 121 56·19 E beacon
5
* * * * * * * *
P3717·71 - Shenjiawan Dao 30 36·20 N Mo(C)Y 12s 12 3 Yellow × on yellow

CN, G102, 2326·085 122 08·61 E beacon
6
* * * * * * * *
P3717·8945 - Lingang. Haigong. No 1 30 50·53 N Mo(C)Y 12s 5 4 Yellow × on yellow

CN, G102, 2260·026 121 48·03 E beacon
1
* * * * * * * *

CN, G102, 2260·027 121 47·75 E beacon
1
* * * * * * * *

CN, G102, 2260·028 121 48·09 E beacon
1
* * * * * * * *
P3749·545 - Nanhui Zui Hydrological 30 51·38 N Mo(C)Y 12s 7 3 Yellow × on yellow

CN, G102, 2167·82 Warning. No 2 122 01·62 E beacon
CN, G102, 2167·81 1
- - - No 1 .. Mo(C)Y 12s 7 3
--- .. AIS .. .. .. MMSI No 999412254
* * * * * * * *
P3753·6 - Hengsha E Hydrological 31 15·96 N Mo(C)Y 12s 7 3 Yellow × on yellow

CN, G102, 2077·47 Warning No 2 122 22·67 E beacon
CN, G102, 2077·46 1
- - No 1 .. Mo(C)Y 12s 7 3
-- .. AIS .. .. .. MMSI No 999412258
-- .. Racon .. .. .. ALRS Vol 2 Station 81824.5
* * * * * * * *
P3754·1 - Jiuduan Sha Hydrological 31 04·05 N Mo(C)Y 12s 7 3 Yellow × on yellow

CN, G102, 2135·85 1
- - - No 1 .. Mo(C)Y 12s 7 3
--- .. AIS .. .. .. MMSI No 999412259
--- .. Racon .. .. .. 81826·25
* * * * * * * *
P3767·8 - Meimao Sha Hydrological 31 08·57 N Mo(C)Y 12s 15 3 Yellow × on yellow

CN, G102, 1
2168·21-2168·24 - - - No 1-No 4 .. Mo(C)Y 12s 8 3
* * * * * * * *
P3769·2 - Sanjia Gang Hydrological 31 13·97 N Mo(C)Y 12s 14 3 Yellow × on yellow

CN, G102, 1
2175·41-2175·44 - - - No 1 - No 4 .. Mo(C)Y 12s 7 3
--- .. AIS .. .. .. MMSI No 999412253
* * * * * * * *
5.7 Wk27/20
V
NP87, Vol P Edition 2019/20 continued.
CHANGJIANG KOU AND HUANGPU JIANG

P3789·1 - Baoshan. Wusong Kou 31 24·90 N Mo(C)Y 12s 12 4 Yellow × on yellow
CN, G102, 2213·1 Passenger Liner Pier 121 29·79 E beacon
4
* * * * * * * *
P3792·4 - Changxing Dao 31 29·57 N Mo(C)Y 15s 13 3 Yellow × on yellow

CN, G102, 2097·415 Hydrological Warning. No 5 121 29·87 E beacon
CN, G102, 1
2097·411-2097·414 - - - No 1 - No 4 .. Mo(C)Y 15s 7 3
* * * * * * * *
P3792·85 - Baoshan S Channel. 31 30·64 N Mo(C)Y 15s 14 3 Yellow × on yellow

CN, G102, 2208·085 Chenhang Hydrological 121 21·22 E beacon
CN, G102, 2208·081 Warning. No 5 1
- 2208·84 - - - - No 1 - No 4 .. Mo(C)Y 15s 7 3
---- .. AIS .. .. .. MMSI No 999412252
* * * * * * * *
NP88, Vol Q Edition 2020/21. Weekly Edition No. 27, Dated 02 July 2020.
Q1256·6 - Banyuwangi Harbour. 8 07·00 S Fl Y 5s 7 5 Yellow × on yellow fl 1

ID, , 4039·1 Dolphin. No 1 114 24·09 E beacon
(ID) 7
* *
Q1256·65 - Banyuwangi Harbour. 8 06·96 S Fl Y 5s 7 5 Yellow × on yellow fl 1

ID, , 4039·2 Dolphin. No 2 114 24·18 E beacon
(ID) 7
* *
SELAT BALI. JAWA

Q1258·152 - Banyuwangi. Boom Port 8 11·92 S Fl G .. . . Green beacon
(ID) 114 23·05 E
* * * * * * * *
SELAT BALI. JAWA

Q1258·158 - Banyuwangi 8 12·12 S Fl R .. . . Red beacon
(ID) 114 23·17 E
* * * * * * * *
SELAT BALI. JAWA

Q1258·159 - Banyuwangi 8 12·32 S Fl R .. . . Red beacon
(ID) 114 23·18 E
* * * * * * * *
Q1283 - Celukanbawang 8 11·21 S Fl R 6s 10 8 Red beacon fl 0·5

(ID) 114 50·46 E 11
* * *
Q1283·2 - Celukanbawang 8 11·39 S Fl R 4s 12 8 Red & on red beacon fl 0·5

ID, , 4146 (ID) 114 50·40 E
* * *
Q1283·3 - Celukanbawang. Ldg Lts 8 11·65 S Oc W 3s 13 8 White % on white ec 1

ID, , 4142 196°. Front 114 50·21 E beacon
(ID) 13
* *
5.8 Wk27/20
V
NP88, Vol Q Edition 2020/21 continued.
Q1283·31 - Celukanbawang. Ldg Lts 8 11·71 S Oc W 4s 17 8 White + on white ec 1

ID, , 4143 196°. Rear 114 50·19 E metal framework
(ID) structure
17
* *
Q3345 - Kaimana 3 39·92 S Fl R 10s 30 17 White beacon

ID, , 6040 (ID) 133 45·56 E
* * * * *
WEST PAPUA. FAKFAK

Q3347 - 2 55·96 S Fl W 3s 12 5 White beacon fl 1
(ID) 132 18·57 E
* * * * * * * *
Q3347·2 - 2 55·91 S FW .. . . Beacon

(ID) 132 18·60 E
* * * * * * * *
Q3378·495 - Arar Terminal 1 01·60 S Fl G 5s 17 12 Green % on green

ID, , 6285·1 (ID) 131 14·15 E beacon
* * * * * * * *
Q3378·5 - Arar Terminal 1 02·12 S Fl W 3s 22 12 White beacon fl 1

ID, , 6285 (ID) 131 14·40 E
*
Q3378·6 - Pulau Selebus 1 02·50 S Fl G 5s 17 12 Green % on green

ID, , 6285·3 (ID) 131 14·00 E beacon
* * * * * * * *
Q3395·87 - Nabire 3 21·07 S Fl W 5s 15 10 White beacon

(ID) 135 30·46 E
* * * * * * * *
5.9 Wk27/20
VI
COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE REQUIREMENTS,

PILOTAGE, VTS, REPORTING, RADIO COMMUNICATIONS AND TRANSMISSIONS
An increasing number of ports are introducing specific quarantine reporting requirements with regards to this virus. Its continued
spread is also impacting a number of other services covered by ADMIRALTY List of Radio Signals products. Due to the ongoing
and dynamic nature of the situation, mariners should contact the appropriate Port Authority, VTS, Pilot, coastguard, radio station
or other designated body covering their planned route and destination, for the latest advice and procedures. Due to the rapidly
changing situation, it is advised to check local situation at the earliest opportunity when passage planning.
VI
UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS

Weekly Edition No. 27 dated 02 July 2020
The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2020.pdf)
VOLUME 2, NP282(2), First Edition, 2020

Published Wk 13/20
(Last Updates: Weekly Edition No. 26 dated 25 June 2020)
RADAR BEACONS
PAGE 42, KOREA, SOUTH, below 82405 Gainseo Lt.

Insert:
Daesan Port Hyundai Oilbank

37°01′·94N 126°20′·71E 3 & 10 10 K 82407
Mooring Buoy
Korean Notice 24/383/20 (RSDRA2020000138822) 27/20
AUTOMATIC IDENTIFICATION SYSTEM (AIS)
PAGE 178, KOREA, SOUTH, below Busan New Port Entrance Lt Buoy.
Insert:
Busan New Port Lt 35°04′·66N 128°47′·11E 994401025 Real
Korean Bulletin 23/20 (RSDRA2020000135664) 27/20
PAGE 178, KOREA, SOUTH.

Busan New Port Lt Bn A.
Delete entry
PAGE 178, KOREA, SOUTH, below Busan New Port Lt Buoy C.

Insert:
Busan New Port Safezone 35°04′·27N 128°47′·51E 994406113 Virtual
Wk27/20
6.1
VI
VI
VOLUME 6, PART 2, NP 286(2), 2019/20 INFORMATION SERVICE:

The information service is provided by the VTS to ensure that key information is
Published Wk 21/19 available at the appropriate time to system users and serves to facilitate the decision-
–––––––––––––––––– making process on board a vessel in relation to the safety of navigation in the VTS area.
(1) Information made available in the information service may concern in particular:
(a) The positions, dimensions, manoeuvres, and identication of vessels
PAGES 323 & 324, POLAND, USTKA, Vessel Traffic Service and Port (b) Any area vessel congestion and the conditions prevailing on the fairway
sections. (c) The traffic of vessels posing a danger and limited by their draught
Delete and replace by: (d) The recommended route and status of waters periodically closed to navigation
and shing
(e) The locations and waters where work affecting the safety of navigation is being
Vessel Traffic Service carried out
(f) The closure of waters and ports
LOCATION: Ustka Port Hr Mr’s Office (g) The safety and protection of navigation
AREA: (h) Navigational warnings
The VTS covers the territorial sea and the Exclusive Economic Zone from the line of (i) The condition of (radio navigation) buoyage
longitude 15°23′·40E to the line of longitude 17°40′·50E, excluding maritime ports. (j) Weather forecasts, actual conditions, and hydrometeorological warnings
(k) Ice conditions
DESCRIPTION: (l) The suspension of the pilotage service or the VTS service
To increase the level of safety and protection of navigation, the smoothness of vessel (m) Changes and supplements to services provided by the VTS
traffic and protection of the marine environment, Ławica Słupska VTS has been (n) Other factors that could affect the safety and the efficacy of navigation
established to perform tasks in the domain of vessel traffic monitoring and information (2) The information service is provided by the VTS to all vessels by radio or, if the
transmission. The VTS maintains a listening watch on VHF channels 16 and 73 and on situation so requires, using an individual means of communication.
channel 70 for DSC calls. The working channel is VHF 73; the reserve channel is VHF
Port
10. The service is active 24 hours a day. The working languages of the VTS are English
and Polish. Vessels in the area of the Ławica Słupska traffic separation scheme (TSS) CONTACT DETAILS:
should maintain a constant listening watch on VHF channel 73.
Hr Mr (Port Captain)
SERVICES: VHF Channel: Ch 16; 12
The VTS provides an Information Service (INS). Telephone: +48(0)59 8144430
Fax: +48(0)59 8144430
CONTACT DETAILS: E-mail: kpustka@umgdy.gov.pl
Call: VTS Ławica
VHF Channel: Ch 16 70 (DSC); 67 73 Berthing Master
Telephone: +48(0)59 8144889 VHF Channel: Ch 16; 12
+48(0)59 8146204 Telephone: +48(0)59 8144533
+48(0)784 778876 (Mobile) E-mail: bosmanat.ustka@umgdy.gov.pl
+881 631586326 (Iridium) HOURS: Hr Mr: 0730-1530 LT (working days only)
Fax: +48(0)59 8146204 Berthing Master: H24
E-mail: vtslawica@umsl.gov.pl
MMSI: 002610500 PROCEDURE:
(1) Notice of ETA: Vessels should advise ETA 24h prior to arrival.
HOURS: H24 (2) Tugs are available on request.
PURPOSE OF THE VTS: (3) Radar advice to vessels is provided by the Hr Mr on VHF Chs 12 and 16.
(1) To monitor and manage vessel traffic by issuing instructions, recommendations,
and orders. Polish Bulletin 23-24/20, (RSDRA2020000135278), 27/20
(2) To supervise compliance by vessels with the traffic rules and other rules prevailing
in designated traffic lanes and within the traffic separation scheme. ––––––––––––––––––––––––––––––
(3) To disseminate by radio navigational information and meteorological/hydrological
information in accordance with International Maritime Organisation (IMO) guidelines.
VOLUME 6, PART 4, NP 286(4), 2019/20
(4) To monitor the traffic of vessels that could potentially pose a danger to navigation
or endanger safety at sea or the safety of people or the marine environment and Published Wk 37/19
events endangering maritime safety and to disseminate navigational warnings about
such vessels and events by radio and through the National Coordinator of Navigational ––––––––––––––––––
Warnings of the Hydrographic Office of the Polish Navy. (Last Updates: Weekly Edition No. 23 dated 4 June 2020)
(5) To maintain communications with the captain of a vessel, the operator of a vessel,
or the owner of dangerous goods carried by a vessel where such goods present a PAGE 125, FRENCH POLYNESIA, PAPEETE, Tahiti, Îles de la Société,
danger to maritime safety or the marine environment. Pilots, PROCEDURE, section (7).
(6) To perform tasks specied in the plan for the provision of shelter to vessels in Delete and replace by:
distress in Polish maritime waters.
(7) To realise tasks of the Regional Contact Point in connection with the protection of (7) Pilot boards in the following positions:
navigation and maritime ports, in relation to vessels and port facilities. (a) Papeete:
(8) To supply information using the national system ‘SafeSeaNet’ to SafeSeaNet (i) Vessels over 90m LOA: 17°30′·50S 149°36′·20W (2 n miles from Toa Ta
users. Channel entrance)
(9) To issue instructions, recommendations and orders about vessel traffic, if the (ii) Vessels under 90m LOA: 17°31′·30S 149°35′·70W
situation so requires, in particular where the situation could, in the assessment of the (b) Taunoa (Tahiti Island):
VTS operator, result in a danger to the safety of navigation. (i) Vessels approaching from the W: 17°30′·50S 149°36′·30W
(10) To issue information at the request of a vessel. (ii) Vessels approaching from the E: 17°30′·00S 149°33′·20W
continued on next column continued on next page
1
Wk27/20
6.2
VI
VI
(c) Moorea Island: (5) Pilot boards in the following positions:

(i) For Baie de Paopao: 17°27′·00S 149°50′·60W (a) No 4 (30°06′·00N 121°48′·20E)
(ii) For Baie de Opunohu: 17°27′·40S 149°52′·50W (b) No 3 (30°00′·80N 121°48′·40E)
(d) Huahine Island: (c) Qili Zhi Anchorage (30°00′·58N 121°46′·75E)
(i) For Passe de Avapehi: 16°43′·40S 151°05′·40W (d) Jintang Maodi Anchorage (30°00′·65N 121°49′·39E)
(ii) For Passe de Avamoa: 16°41′·40S 151°04′·40W (e) Cezi (30°13′·00N 121°50′·98E)
(iii) For Passe de Farerea: 16°44′·40S 150°56′·00W (f) Yeyashan N Anchorage (30°00′·58N 121°59′·64E)
(e) Uturoa (Raiatea Island): 16°44′·60S 151°22′·80W (g) Minerals Anchorage (29°44′·60N 122°34′·25E)
(f) Tahaa (Tahaa Island): 16°42′·00S 151°32′·50W (h) Tanker Anchorage (29°42′·70N 122°34′·25E)
(g) Vaitape (Bora Bora Island): 16°28′·60S 151°48′·80W (i) Xiazhi Men Northern Anchorage (29°45′·50N 122°21′·50E)
(h) Tiputa (Rangiroa Atoll): 14°56′·40S 147°36′·20W (j) Xiazhi Men Southern Anchorage (29°42′·28N 122°21′·18E)
(i) Fakarava (Tuamotu Atolls): 16°03′·00S 145°44′·10W (k) No 3 (29°41′·00N 122°22′·00E)
(l) No 1 (29°45′·90N 122°18′·13E)
SHOM correspondence, (RSDRA2020000138818), 27/20 (m) No 2: Disembarkation (29°46′·15N 122°16′·75E)
(n) No 1 (29°42′·53N 122°16′·92E)
–––––––––––––––––––––––––––––– (o) No 2: Disembarkation (29°42′·43N 122°15′·50E)
(p) Ao Shan Quarantine Anchorage (29°51′·58N 122°12′·95E)
(q) Mazhi No 2 Anchorage (29°53′·00N 122°12′·88E)
VOLUME 6, PART 6, NP 286(6), First Edition, 2020 (r) Mazhi No 1 Anchorage (29°54′·81N 122°15′·03E)
Published Wk 3/20 (s) Xianshangang Fairway (29°39′·00N 121°51′·90E)
–––––––––––––––––– Ningbo - Zhoushan Vessel Traffic Service
(Last Updates: Weekly Edition No. 22 dated 28 May 2020) AREA:

(1) The Ningbo-Zhoushan VTS Area comprises the water area covering the Deepwater
PAGE 11, CHINA, CEZI. Route in Xiazhi Men, Tiaozhou Men, Zhitou Gang, Zhitou Yang, Luotou, Jintang,
Delete entry and replace by: Hengshui Yang, Cezi and Xihou Men.
(2) The above area is divided into 7 VHF Zones as outline on the associated diagram
CEZI 30°05′N 121°56′E NINGBO - ZHOUSHAN VESSEL TRAFFIC SERVICE.
(a) Zone 1: VHF Ch 08
See diagram NINGBO - ZHOUSHAN VESSEL TRAFFIC SERVICE (See NINGBO). (b) Zone 2: VHF Ch 28
(c) Zone 3: VHF Ch 14
Pilots (d) Zone 4: VHF Ch 71
For details see NINGBO, including Beilun. (e) Zone 5: VHF Ch 14
(f) Zone 6: VHF Ch 06
Vessel Traffic Service (g) Zone 7: VHF Ch 11
For details see NINGBO, including Beilun.
CONTACT DETAILS:
Chinese VTS Guide 2019, (RSDRA2020000112513), 27/20 Ningbo VTS Centre
Call: Ningbo-Zhoushan VTS Centre
VHF Channel: Ch 06 08 11 14 28 71
PAGES 89 & 91 to 92, CHINA, NINGBO, including Beilun. Telephone: +86(0)574 86801531
Delete entry and replace by: Fax: +86(0)574 86801546
E-mail: nbvts@cnzjmsa.gov.cn
NINGBO, including Beilun 29°58′N 121°47′E
UNCTAD LOCODE: CN NBG Zhoushan VTS Centre
Call: Ningbo-Zhoushan VTS Centre
See diagram NINGBO - ZHOUSHAN VESSEL TRAFFIC SERVICE. VHF Channel: Ch 06 08 11 14 28 71
Telephone: +86(0)580 2607153
Pilots +86(0)580 2063765
CONTACT DETAILS: +86(0)580 2265163
VHF Channel: Ch 16; 09 Fax: +86(0)580 2263590
Telephone: +86(0)574 27691291 E-mail: zsvts@163.com
Fax: +86(0)574 27691794 HOURS: H24
E-mail: info@nbpilots.com
PROCEDURE:
HOURS: H24 (1) Participation: Participation in the VTS is mandatory for the following:
PROCEDURE: (a) All foreign vessels
(1) Pilotage is compulsory and is available H24. (b) Passenger vessels
(2) Foreign vessels calling at Ningbo for the rst time, or vessels of over 1000 dwt must (c) Vessels carrying dangerous cargo
use a Pilot to pass under Jintang Great Bridge. Vessels that have previously called at (d) Vessels restricted in manoeuvrability
the port and are less than 10 000 dwt need not use a Pilot to pass the bridge. (e) Chinese vessels of 300 gt and over
(3) Pilot ordering: Vessels that need pilotage must make application for the service (f) Other Chinese vessels less than 300 gt equipped with VHF radio may
24h prior to arrival or on leaving the last port. participate voluntarily
(4) Vessels should contact the Pilot on VHF Ch 16, 1h before ETA at anchorage and (2) Reporting Lines have been established as follows:
maintain a continuous listening watch on VHF Ch 16 until the Pilot boards.
2
Wk27/20
6.3
VI
VI
VHF INFORMATION BROADCASTS:

Designator Reporting Line The VTS will provide vessel movement reports, situation of aids to navigation, weather
Channel
information, navigational warnings and other safety information when appropriate.
Between Taohua Dao Lt (29°46′·30N 122°18′·60E)
L1 and Dongtao Zui (Xiazhi Dao) (29°44′·77N 08 SERVICES:
122°18′·25E) The VTS Centre provides the following services:
Between Dongtiao Ju (29°44′·68N 122°18′·22E) and (1) Traffic Information Service
L2 28 (2) Navigational Assistance Service
Liuheng Dao Waijiao Lt Bn (29°41′·30N 122°17′·40E)
(3) Traffic Organisation Services
Between Meishan Dao Xiaodanshan (29°46′·11N
(4) Information to support joint operations
121°59′·34E), Tingdanshan Lt Bn, Wenzhouzhi Lt
L3 28
Bn, Yaque Jaio Lt Bn and the W side of Liuheng Dao Port
Guojushan (29°42′·47N 122°04′·17E)
CONTACT DETAILS:
Between Yongjiang Kou breakwater Lt (29°58′·67N VHF Channel: Ch 16; 09 13
L4 121°45′·36E) and Changtiao Zui Lt (29°58′·46N 06
121°45′·90E) Ningbo-Zhoushan Port Management Committee
Telephone: +86(0)571 88909347
Between positions 30°05′·20N 121°35′·90E and
L5 06 Fax: +86(0)571 88368091
30°07′·05N 121°49′·25E
Website: www.nbport.com.cn/gfww/ (Chinese)
Between Xiaocaihua Lt Bn (30°07′·09N 121°52′·09E)
L6 and W end of Zhoushan Dao (30°10′·00N 11 Port Authority
121°56′·00E) Telephone: +86(0)574 7695142
Fax: +86(0)574 7695233
(3) The languages to be used are Mandarin Chinese and English.
Sinoagent Ningbo
REPORTING: VHF Channel: Ch 74
(1) Inbound report: When passing through Reporting Line or approaching anchorage
or berth the following must be reported: Penavico
(i) Vessel name and call sign VHF Channel: Ch 12
(ii) Time passing Reporting Line HOURS: H24
(iii) Draught
(iv) Maximum height above the water surface (Former update 22/20)
(2) Arrival report: Must be made on arrival at the anchorage or berth and include the
following: Chinese VTS Guide 2019, (RSDRA2020000112513), 27/20
(a) Vessel name and call sign
(b) Arrival time
(3) Sailing report: Must be made before departure or weighing anchors and include PAGE 90, CHINA, NINGBO, including Beilun, diagram NINGBO
the following: VESSEL TRAFFIC SERVICE.
(a) Vessel name and call sign Delete and replace by diagram: NINGBO - ZHOUSHAN VESSEL TRAFFIC
(b) Time SERVICE on page 6.7
(c) Destination
(4) Departure report: Must be made on leaving the VTS area via the reporting line Chinese VTS Guide 2019, (RSDRA2020000112513), 27/20
and include the following:
(b) Time PAGES 154 & 157 to 158, CHINA, ZHOUSHAN.
(c) Position Delete entry and replace by:
(d) Draught
(e) Maximum height above the water surface ZHOUSHAN 30°01′N 122°06′E
(f) Next port UNCTAD LOCODE: CN ZOS
(5) Accident report: Vessel is involved in an accident that affects traffic safety and
environmental pollution must report the details of the accident See diagram NINGBO - ZHOUSHAN VESSEL TRAFFIC SERVICE (See NINGBO).
(6) Abnormal situation report: Vessels are required to report details of any
Pilots
abnormalities found which may affect the safety of navigation
(7) Activity report: CONTACT DETAILS:
(a) Vessels should report before carrying out the following actions: VHF Channel: Ch 16 74
(i) Towing or speed-measuring Telephone: +86(0)139 57226877
(ii) 30 mins before anchoring or weighing anchor Website: www.zspilot.com.cn (Chinese & English)
(iii) Commissioning or sea trials
(iv) Underwater construction operations HOURS: H24
(v) Release or recovery of lifeboats PROCEDURE:
(vi) Other activities affecting the safety of navigation (1) Pilotage is compulsory for all foreign vessels.
(b) The report should include the following: (2) Pilot ordering: Vessels should order Pilot through local agent.
(i) Vessel name and call sign (3) Pilot boards in the following positions:
(ii) Activity start and end time (a) Ningbo - Zhoushan
(8) Pilot report: Must be made when Pilot boarding or disembarking vessel in the (i) No 4 (30°06′·00N 121°48′·20E)
Cezi Channel or in the waters of the Jintang Bridge and include the following: (ii) No 3 (30°00′·80N 121°48′·40E)
(a) Vessel name and call sign (iii) Qili Zhi Anchorage (30°00′·58N 121°46′·75E)
(b) Time (iv) Jintang Maodi Anchorage (30°00′·65N 121°49′·39E)
(v) Cezi (30°13′·00N 121°50′·98E)
3
Wk27/20
6.4
VI
VI
(vi) Yeyashan N Anchorage (30°00′·58N 121°59′·64E) VHF

(vii) Minerals Anchorage (29°44′·60N 122°34′·25E) Designator Reporting Line
Channel
(viii) Tanker Anchorage (29°42′·70N 122°34′·25E)
(ix) Xiazhi Men Northern Anchorage (29°45′·50N 122°21′·50E) Between Taohua Dao Lt (29°46′·30N 122°18′·60E)
(x) Xiazhi Men Southern Anchorage (29°42′·28N 122°21′·18E) L1 and Dongtao Zui (Xiazhi Dao) (29°44′·77N 08
(xi) No 3 (29°41′·00N 122°22′·00E) 122°18′·25E)
(xii) No 1 (29°45′·90N 122°18′·13E) Between Dongtiao Ju (29°44′·68N 122°18′·22E) and
L2 28
(xiii) No 2: Disembarkation (29°46′·15N 122°16′·75E) Liuheng Dao Waijiao Lt Bn (29°41′·30N 122°17′·40E)
(xiv) No 1 (29°42′·53N 122°16′·92E) Between Meishan Dao Xiaodanshan (29°46′·11N
(xv) No 2: Disembarkation (29°42′·43N 122°15′·50E) 121°59′·34E), Tingdanshan Lt Bn, Wenzhouzhi Lt
(xvi) Ao Shan Quarantine Anchorage (29°51′·58N 122°12′·95E) L3 28
Bn, Yaque Jaio Lt Bn and the W side of Liuheng Dao
(xvii) Mazhi No 2 Anchorage (29°53′·00N 122°12′·88E) Guojushan (29°42′·47N 122°04′·17E)
(xviii) Mazhi No 1 Anchorage (29°54′·81N 122°15′·03E)
(xix) Xianshangang Fairway (29°39′·00N 121°51′·90E) Between Yongjiang Kou breakwater Lt (29°58′·67N
(b) Daishan: L4 121°45′·36E) and Changtiao Zui Lt (29°58′·46N 06
(i) No 1: 30°16′·70N 121°55′·20E 121°45′·90E)
(ii) No 2: 30°19′·50N 122°17′·50E Between positions 30°05′·20N 121°35′·90E and
L5 06
(iii) 30°09′·08N 122°15′·40E 30°07′·05N 121°49′·25E
(iv) 30°07′·54N 122°17′·68E
Between Xiaocaihua Lt Bn (30°07′·09N 121°52′·09E)
Ningbo - Zhoushan Vessel Traffic Service L6 and W end of Zhoushan Dao (30°10′·00N 11
121°56′·00E)
AREA:
(1) The Ningbo-Zhoushan VTS Area comprises the water area covering the Deepwater
REPORTING:
Route in Xiazhi Men, Tiaozhou Men, Zhitou Gang, Zhitou Yang, Luotou, Jintang,
(1) Inbound report: When passing through Reporting Line or approaching anchorage
Hengshui Yang, Cezi and Xihou Men.
or berth the following must be reported:
(2) The above area is divided into 7 VHF Zones as outline on the diagram: NINGBO -
(i) Vessel name and call sign
ZHOUSHAN VESSEL TRAFFIC SERVICE (See NINGBO).
(ii) Time passing Reporting Line
(a) Zone 1: VHF Ch 08
(iii) Draught
(b) Zone 2: VHF Ch 28
(iv) Maximum height above the water surface
(c) Zone 3: VHF Ch 14
(2) Arrival report: Must be made on arrival at the anchorage or berth and include the
(d) Zone 4: VHF Ch 71
following:
(e) Zone 5: VHF Ch 14
(f) Zone 6: VHF Ch 06
(b) Arrival time
(g) Zone 7: VHF Ch 11
(3) Sailing report: Must be made before departure or weighing anchors and include
CONTACT DETAILS: the following:
Zhoushan VTS Centre (b) Time
Call: Ningbo-Zhoushan VTS Centre (c) Destination
VHF Channel: Ch 06 08 11 14 28 71 (4) Departure report: Must be made on leaving the VTS area via the reporting line
Telephone: +86(0)580 2067153 and include the following:
Fax: +86(0)580 2063781 (a) Vessel name and call sign
E-mail: zsvts@163.com (b) Time
Ningbo VTS Centre (c) Position
Call: Ningbo-Zhoushan VTS centre (d) Draught
VHF Channel: Ch 06 08 11 14 28 71 (e) Maximum height above the water surface
Telephone: +86(0)574 86801531 (f) Next port
Fax: +86(0)574 86801546 (5) Accident report: Vessel is involved in an accident that affects traffic safety and
E-mail: nbvts@cnzjmsa.gov.cn environmental pollution must report the details of the accident
(6) Abnormal situation report: Vessels are required to report details of any
HOURS: H24 abnormalities found which may affect the safety of navigation
PROCEDURE: (7) Activity report:
(1) Participation: Participation in the VTS is mandatory for the following: (a) Vessels should report before carrying out the following actions:
(a) All foreign vessels (i) Towing or speed-measuring
(b) Passenger vessels (ii) 30 mins before anchoring or weighing anchor
(c) Vessels carrying dangerous cargo (iii) Commissioning or sea trials
(d) Vessels restricted in manoeuvrability (iv) Underwater construction operations
(e) Chinese vessels of 300 gt and over (v) Release or recovery of lifeboats
(f) Other Chinese vessels less than 300 gt equipped with VHF radio may (iv) Other activities affecting the safety of navigation
participate voluntarily (b) The report should include the following:
(2) Reporting Lines have been established as follows: (i) Vessel name and call sign
(ii) Activity start and end time
continued on next column (8) Pilot report: Must be made when Pilot boarding or disembarking vessel in the
Cezi Channel or in the waters of the Jintang Bridge and include the following:
(b) Time
continued on next page
4
Wk27/20
6.5
VI
VI
INFORMATION BROARDCASTS:
The VTS will provide vessel movement reports, situation of aids to navigation, weather
information, navigational warnings and other safety information when appropriate.
SERVICES:
The VTS Centre provides the following services:
(1) Traffic Information Service
(2) Navigational Assistance Service
(3) Traffic Organisation Services
(4) Information to support joint operations
Port
CONTACT DETAILS:
VHF Channel: Ch 16
Ningbo-Zhoushan Port Management Committee
Telephone: +86(0)571 88909347
Fax: +86(0)571 88368091
Website: www.nbport.com.cn/gfww/ (Chinese)
Port Authority
Telephone: +86(0)580 2067221
Fax: +86(0)580 2067224
Website: www.zsport.com.cn (Chinese)
port.zhoushan.gov.cn/ (Chinese)
HOURS: H24
PROCEDURE:
Notice of ETA: Vessels should advise ETA at the Pilot Station 72h, 48h and 24h in
advance.
(Former update 22/20)
Chinese VTS Guide 2019, (RSDRA2020000112513), 27/20
PAGE 156, CHINA, ZHOUSHAN, diagram ZHOUSHAN VESSEL

TRAFFIC SERVICE CEZI VTS AREA.
Delete diagram.
Chinese VTS Guide 2019, (RSDRA2020000112513), 27/20
––––––––––––––––––––––––––––––
VOLUME 6, PART 7, NP 286(7), First Edition, 2020

Published Wk 7/20
––––––––––––––––––
(Last Updates: Weekly Edition No. 15 dated 9 April 2020)
PAGE 31, BELIZE, BIG CREEK, Pilots, PROCEDURE, section (2).

Delete and replace by:
(2) Pilot boards in position 16°21′·66N 88°24′·02W (Placencia Harbour).
Belize Port Authority Correspondence, (RSDRA2020000128392), 27/20
––––––––––––––––––––––––––––––
5
Wk27/20
6.6
VI
V6(6)NINGBO-ZHOUSHAN V001 12/06/20

30°
50´
40´
10´
Zone 1 VHF Ch 08
30´
20´
Zone 1 VHF Ch 28
VI
UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS
20´
20´
Weekly Edition No. 27 dated 02 July 2020

Zone 4 VHF Ch 71
L1
L2
Taohua
Dao
Taohua
The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
Dao
Dao
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
zhi
Xia
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2020.pdf)
Yangxiaomao
Zone 3 VHF Ch 14
VOLUME 2, NP282(2), First Edition, 2020

Zhoushan Dao
Published Wk 13/20
10´
10´
Dao
Zhoushan
Zone 2 VHF Ch 28
RADAR BEACONS
PAGE 42, KOREA, SOUTH, below 82405 Gainseo Lt.

Insert:
Daesan Port Hyundai Oilbank

L3
37°01′·94N 126°20′·71E 3 & 10 10 K 82407

Mooring Buoy
122°
Zone 7 VHF Ch 11
122°
Korean Notice 24/383/20 (RSDRA2020000138822) 27/20
L3
Cezi Shuidao
Daxie Dao
AUTOMATIC IDENTIFICATION SYSTEM (AIS)

Zone 5 VHF Ch 14
PAGE 178, KOREA, SOUTH, below Busan New Port Entrance Lt Buoy.
Insert:
Jintang Dao
L6
Busan New Port Lt 35°04′·66N 128°47′·11E 994401025 Real

Reporting Lines (with designated letters)

50´
50´
NINGBO - ZHOUSHAN
VESSEL TRAFFIC SERVICE
ao Zui
PAGE 178, KOREA, SOUTH.

Changti
Beilun
Busan New Port Lt Bn A.

Delete entry
Pilot Boarding Areas
L4
Zone 6 VHF Ch 06
Ningbo Gang
ge

Yongjiang Kou
rid
tB
Anchorages
ea
PAGE 178, KOREA, SOUTH, below Busan New Port Lt Buoy C.

Zhenhai
L5
G r
Insert:
g
tan
Jin
40´
40´
Busan New Port Safezone 35°04′·27N 128°47′·51E 994406113 Virtual

Ningbo
g
ian
L1
J
ng
Yo

30°
50´
40´
10´
Wk27/20
6.7
VII
UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS
There are no updates to miscellaneous Nautical Publications this week
COVID--19 (CORONAVIRUS)
UPDATE ON THE EFFECTS ON THE DELIVERY OF NAUTICAL PUBLICATIONS
As a result of ongoing effects of COVID--19 on distribution infrastructure around the world, for
safety reasons, we took the decision a few months ago to delay the publication of any non--essential
ADMIRALTY Nautical Publications until further notice.
We have been continuously monitoring the situation ever since this decision was made.
In view of the progressively reduced effects of COVID--19 on our distribution network across the
world, we are now in a position to start easing the restrictions on the despatch of our paper
publications.
We will publish a limited number of ADMIRALTY Nautical Publications in July 2020 and closely
monitor our distribution network capacities. Information gathered during this period will help us
finalise our future plans to resume to a normal publications schedule as soon as we are able to.
7.1
Wk27/20
VIII
ADMIRALTY DIGITAL SERVICES
COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE

REQUIREMENTS, PILOTAGE, VTS, REPORTING, RADIO COMMUNICATIONS AND
TRANSMISSIONS
An increasing number of ports are introducing specific quarantine reporting requirements with regards to
this virus. Its continued spread is also impacting a number of other services covered by ADMIRALTY
List of Radio Signals products. Due to the ongoing and dynamic nature of the situation, mariners should
contact the appropriate Port Authority, VTS, Pilot, coastguard, radio station or other designated body
covering their planned route and destination, for the latest advice and procedures. Due to the rapidly
changing situation, it is advised to check local situation at the earliest opportunity when passage planning.
1. ENC / ECDIS and AVCS
a) Safety Notice
For a graphical way to establish that the ECDIS is correctly displaying the new symbols introduced in IHO S-52 Presentation Library
Edition 4.0 the mariner can check ECDIS Chart 1. ECDIS Chart 1 is a legend of the entire set of symbols that may be used within an
ENC and is installed on all type-approved ECDIS systems. See iho.int for further information. ECDIS Systems have been required to
use Presentation Library edition 4.0 since 1st September 2017 and previous editions are no longer SOLAS compliant.
b) ENCs temporarily withdrawn from AVCS

To review a cumulative list of ENCs temporarily withdrawn from AVCS, please visit the ‘Updates’ tab on:
admiralty.co.uk/AVCS
c) ENC Readme.txt file

The README.TXT file located within the ENC_ROOT folder on the latest AVCS discs contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the support tab at admiralty.co.uk/avcs.
This file is updated on a regular basis and should be consulted to ensure that all related issues are taken into consideration.
d) Temporary & Preliminary Notices to Mariners (T&P NMs) in ENCs

The use of T&P NM information is considered an essential part of keeping navigational charts up to date.
The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file in the INFO folder on the service media and at: admiralty.co.uk/ENC-TP-NMs
ADMIRALTY Information Overlay (AIO) shows ADMIRALTY paper T&Ps where they are not already included in the ENCs. Most
countries now include temporary information in their ENCs.
Further guidance can be found in the INFO folder on AIO discs.
e) Important notice regarding AVCS CD Service
From WK14/19, AVCS is only available by download or on the weekly DVDs.

For more information, please contact your ADMIRALTY Chart Agent.
8.1
Wk 27/20
VIII
f) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)
The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.
Email calls to AVCS OUS will receive an auto-response that asks the customer to resubmit their data request online by http. Please
contact your ADMIRALTY Distributor if support is required for use of the http service.
Due to the technology updates at UKHO, the ARCS Online Updating Service was withdrawn in July 2019.
2. ADMIRALTY Products Supporting Digital Navigation

i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.
ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.
iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.
iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.
3. ADMIRALTY Digital Publications (ADP)
ADMIRALTY Sailing Directions: Removal of AIS and Racons

In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as this is held in
greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon information will be removed
from new editions of each Sailing Direction volume, and AIS and Racon information present in existing Sailing Direction volumes will
no longer be updated. For accurate, up-to-date information on AIS and Racons, refer to ADMIRALTY Radio Signals publications.
ADP V19 is available on the ADP Weekly Update DVD.

The UKHO only supports ADP V18 and V19. Users of older versions of ADP should upgrade to a supported version at their earliest
convenience. ADP V18 and V19 are the only versions that allow users to receive tidal updates as they are made available.
ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT

The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.
For information: Please note that there will not be a 2020 ADP release.
Historically we have made new versions of the ADP software available in December of each year however, there will be no commercial
release of ADP this year. Previous versions have been released with yearly updates to tidal data and non-essential bug fixes however, as
tidal data is now updated weekly there is no need for us to release a new version of the software at this time.
The supported ADP versions continue to remain at V18 and V19.
The ADP software and the Data updates can still be downloaded from weekly ADP and AENP Update DVDs.
Users can also download ADP directly on the Distributors FTP Site at ftp://ukho.gov.uk
For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@ukho.gov.uk
8.2
Wk 27/20
VIII
4. Status of ADMIRALTY Digital Services
Update status table
Product Last issue date/Week Reissue Date/Week

i. ADMIRALTY Vector Chart Service (AVCS) Base CD download 04 June 2020 - 23 06 August 2020 - 32
ii. ADMIRALTY Information Overlay (AIO) Base CD 04 October 2018 - 40
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 23 January 2020 - 04 30 July 2020 - 31
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 21 May 2020 - 21
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 23 April 2020 - 17
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 26 March 2020 - 13
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 12 December 2019 - 50 20 August 2020 - 34
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 06 February 2020 - 06 10 September 2020 - 37
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 20 February 2020 - 08
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 02 July 2020 - 27
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 18 June 2020 - 25
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 12 March 2020 - 11
23 August 2018 – 34
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts
ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.
5. Supported ADMIRALTY Software Versions
Product Supported Versions

ADP V18, V19
ADMIRALTY e-Reader 1.3
ADMIRALTY Planning Station 3.4
ADMIRALTY gateway 4.2, 4.4
NavPac and Compact Data 3.4, 4.0, 4.1
If you are using an unsupported version, contact your Chart Agent to upgrade to the latest version as soon as possible.
Important notice for users of ADMIRALTY NavPac and Compact Data
Versions 3.4 and 4.0 of ADMIRALTY NavPac and Compact Data 2016 – 2020 will be retired on 31 December 2020 in the following
phased approach:
• 28.05.20 - end of bug fixes and updates to ADMIRALTY NavPac and Compact Data v3.4 2016 – 2020 and ADMIRALTY
NavPac and Compact Data v4.0 2016 – 2020
• 31.12.20 – data expires and end of functionality to do forward calculations for celestial navigation in ADMIRALTY NavPac
and Compact Data v3.4 2016 – 2020 and ADMIRALTY NavPac and Compact Data v4.0 2016 – 2020
• 31.12.20 – end of UKHO Customer Services and Technical support for ADMIRALTY NavPac and Compact Data v3.4 2016 –
2020 and ADMIRALTY NavPac and Compact Data v4.0 2016 – 2020
In advance of the retirement date, users are advised to contact their ADMIRALTY Chart Agent to discuss migrating to ADMIRALTY
NavPac and Compact Data v4.1 2021 – 2025, which is available to order from 28.05.20 and is fully operational, maintained and
supported by UKHO from this date onwards.
During the phased retirement of ADMIRALTY NavPac and Compact Data v3.4 and v4.0 UKHO will continue to provide the current
level of support in place to users, including assistance with resolving queries in using these versions, until v3.4 and v4.0 are officially
retired on 31.12.20. However, no further upgrades will be applied to v3.4 and v4.0 and the versions users are currently using will
remain unchanged.
During the phased retirement, and from 01.01.21 onwards, UKHO will continue to provide Customer Services and Technical support for
users of ADMIRALTY NavPac and Compact Data v4.1 2021 – 2025, and assist users migrating to this version of the software.
8.3
Wk 27/20
VIII
Important notice for users of ADMIRALTY e-Navigator Planning Station and ADMIRALTY gateway
All versions of ADMIRALTY e-Navigator Planning Station and ADMIRALTY gateway will be retired on 29 January 2021 in the
following phased approach:
• 01.05.20 – no new users of ADMIRALTY e-Navigator Planning Station and ADMIRALTY gateway accepted into service
• 29.01.21 – ADMIRALTY e-Navigator Planning Station and ADMIRALTY gateway deactivated, end of availability of
functionality and product updates and user support materials
• 26.02.21 – end of UKHO Customer Services support for ADMIRALTY e-Navigator Planning Station and ADMIRALTY
gateway
During this period UKHO will continue to provide the current level of support to ADMIRALTY Planning Station and ADMIRALTY
gateway users, including chart updates, until the products are officially retired. However, no further upgrades will be applied to
ADMIRALTY Planning Station and ADMIRALTY gateway and the versions users are currently using will remain unchanged.
In advance of the retirement date, users are advised to contact their ADMIRALTY Chart Agent to discuss migration plans and options for
alternative products and services to meet their needs.
8.4
Wk 27/20
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)
Reporting Port Information affecting ADMIRALTY Products
NAME OF PORT
APPROXIMATE POSITION Latitude Longitude
GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.
Number of ships or tonnage handled per

year.
Maximum size of vessel handled.
Copy of Port Handbook (if available).
ANCHORAGES
Designation, depths, holding ground,
shelter afforded.
PILOTAGE
Authority for requests.
Embark position.
Regulations.
DIRECTIONS
Entry and berthing information.
Tidal streams.
Navigational aids.
TUGS
Number available.
WHARVES
Names, numbers or positions & lengths.
Depths alongside.
CARGO HANDLING
Containers, lighters, Ro-Ro etc.
REPAIRS
Hull, machinery and underwater.
Shipyards.
Docking or slipping facilities.

(Give size of vessels handled or
dimensions)
Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
RESCUE AND DISTRESS

Salvage, Lifeboat, Coastguard, etc.
SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)
Fresh water.
(with method of delivery and rate of
supply)
Provisions.
SERVICES
Medical.
Ship Sanitation.
Garbage and slops.
Ship chandlery, tank cleaning, compass

adjustment, hull painting.
COMMUNICATIONS
Nearest airport or airfield.
Port radio and information service. (with

frequencies and hours of operating)
PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.
VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.
ADDITIONAL DETAILS
NOTES:
1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.
2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.
2. Objective of GNSS Data Collection
The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.
It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.
It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.
3. Details required
a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.
b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).
c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.
d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services
For emergency information affecting safety of life at sea forward to: navwarnings@ukho.gov.uk
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@ukho.gov.uk
This form H.102 and instructions are available online: admiralty.co.uk/msi
Date Ref. number

Name of ship or sender IMO number
Address and general locality
E-mail / Tel / Fax of sender
Subject
Position
Latitude Longitude
(see Instruction 2)
GPS Datum Accuracy
ADMIRALTY Charts affected Edition
Latest Weekly Edition of

Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected
Latest update disk applied Week:
Make, model and or age of ECDIS if

applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:
Name of observer / reporter
H.102A submitted Yes No H.102B submitted Yes No
Tick box if not willing to be named as source of this information
Alternatively use our H-Note App located here:

admiralty.co.uk/H-note

27wknm20 Week27 2020

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

27wknm20 Week27 2020

Uploaded by

Copyright:

Available Formats

Notices

I Explanatory Notes. Publications List

GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS

SEARCHABLE NOTICES TO MARINERS

 Search NMs by - Chart Number only

NOTICES TO MARINERS ON-LINE

FURTHER GUIDANCE NOTES

Our Singapore team can also be contacted outside of UK hours on:

ADMIRALTY NOTICES TO MARINERS

Planning for the future

Admiralty Way, Taunton, Somerset

Find out more about our market-leading

and are trademarks of the Secretary of State for Defence

ADMIRALTY Charts International Charts

COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE REQUIREMENTS,

The World Meteorological Organization is conducting a survey regarding the World-Wide

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 02 July 2020

Note: This chart remains affected by Notice 1210(T)/20. This chart is to be

Includes significant safety-related information as follows: new piers and

2449 North Sea , Dover Strait to Westerschelde. 1:150,000 9 24

Includes significant safety-related information as follows: new windfarms,

Note: This chart remains affected by Notices 428(P)/19, 2320(T)/19,

2638 Indonesia, Ports and Approaches in Sulawesi. 58 72, 74

Includes significant safety-related information as follows: changes to depths,

Note: On publication of this New Edition former Notice 2720(P)/20 is

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 02 July 2020 (continued)

Includes significant safety-related information as follows: changes to

Note: On publication of this New Edition former Notice 4467(P)/19 is

Note: This chart remains affected by Notices 1728(T)/20, 2756(T)/20 and

Note: This chart remains affected by Notice 5962(T)/19.

Note: This chart remains affected by Notices 5962(T)/19 and 2756(T)/20.

Note: This chart remains affected by Notices 1728(T)/20 and 2912(T)/20.

Note: This chart remains affected by Notice 2821(T)/20.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

NP No. Title and other remarks Date Remarks

ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 16 JULY 2020

New Editions of ADMIRALTY Charts

1066 Indonesia, Java Sea. 1:800,000 1066 60

Includes significant safety-related information as follows: new

Includes changes to depths from the latest British Government

Includes significant safety-related information as follows: new

2797 Indonesia, Jakarta to Semarang. 1:500,000 2797 60

Includes significant safety-related information as follows: new

Includes updated lines of equal magnetic variation for 2020.

3596 South Atlantic Ocean, Approaches to South Georgia. 1:750,000 3596 96

Includes updated lines of equal magnetic variation for 2020.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

ADMIRALTY CHARTS TO BE PUBLISHED 16 JULY 2020

New Editions of ADMIRALTY Charts (continued)

3730 Indonesia, Jawa - North Coast, Cirebon to Semarang. 1:250,000 3730 60

Includes significant safety-related information as follows: new

Includes updated line of equal magnetic variation for 2020.

4212 Southern Ocean, Drake Passage. 1:3,500,000 4212 96

Includes updated lines of equal magnetic variation for 2020.

Includes updated lines of equal magnetic variation 2020.

ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

2449 North Sea , Dover Strait to Westerschelde. 2449

Search NMs by - Chart Number only