26wknm20 Week26 2020

Notices
3103--3240/20
Current Nautical Publications
Updates to ADMIRALTY Sailing Directions in Force
Cumulative List for ADMIRALTY List of Radio Signals
ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 26
25 June 2020
(Published on the ADMIRALTY website 15 June 2020)
CONTENTS
I Explanatory Notes. Publications List

II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services
For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: navwarnings@ukho.gov.uk
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@ukho.gov.uk
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@ukho.gov.uk
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2020. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
intellectual.property@ukho.gov.uk
I
GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS

ON THE UKHO WEBSITE
The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
admiralty.co.uk/msi or the searchable NM Website www.ukho.gov.uk/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.
NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.
Software required:
Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website (www.adobe.com).
SEARCHABLE NOTICES TO MARINERS
Enter the www.ukho.gov.uk/nmwebsearch website and select the search option that you require
following the on screen instructions:
Search NMs by - Chart Number only

Search NMs by - Chart Number + Previous NM Number/Year
Search NMs by - Chart Number + Between Previous and Present Dates
Search for Single NM by NM Number/Year
To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.
NOTICES TO MARINERS ON-LINE
Enter the admiralty.co.uk/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List
FURTHER GUIDANCE NOTES
For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
File content and description
PC and printer specifications
CUSTOMER SERVICE
If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:
Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: customerservices@ukho.gov.uk
Our Singapore team can also be contacted outside of UK hours on:

Tel: +65 6424 4200
Wk26/20 1.2
,
ADMIRALTY NOTICES TO MARINERS

7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10% LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH8.+27KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ 5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\
:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN13
IRUIXUWKHUGHWDLOV
7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV
Planning for the future

Plan with ADMIRALTY Maritime Data Solutions, brought to you by the United Kingdom Hydrographic Office.
Admiralty Way, Taunton, Somerset

TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
customerservices@ukho.gov.uk
gov.uk/ukho
Find out more about our market-leading

ADMIRALTY Maritime Data Solutions:
admiralty.co.uk
and are trademarks of the Secretary of State for Defence
© Crown Copyright 2020. All rights reserved. Correct at the time of publishing.
Wk26/20
I
EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as
this is held in greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon
information will be removed from new editions of each Sailing Direction volume, and AIS and Racon information present in
existing Sailing Direction volumes will no longer be updated. For accurate, up-to-date information on AIS and Racons, refer
to ADMIRALTY Radio Signals publications.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.
Wk26/20 1.4
,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJLQ6HFWLRQ9,WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13 $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN13JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13 $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
aWKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
bWKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQVXFKDVDQHZK\GURJUDSKLFVXUYH\LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN137KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO$'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1&YHUVLRQVRIFKDUWV
Wk26/20
I
[26/20]
ADMIRALTY Charts affected by the Publication List
ADMIRALTY Charts ADMIRALTY Charts
343 AUS 614

344 AUS 621
346 AUS 627
348 PNG 621
874 PNG 627
999
1046 International Charts
1077
1872 INT 10
1874 INT 200
1889 INT 202
1990 INT 215
2241 INT 701
2248 INT 702
2949 INT 703
3171 INT 707
3172 INT 1250
3173 INT 1251
3818 INT 1319
3819 INT 1474
4010 INT 1540
4115 INT 7056
4200
4202
4215
4701
4702
4703
4707
8056
8255
8276
8296
COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE REQUIREMENTS,

PILOTAGE, VTS, REPORTING, RADIO COMMUNICATIONS AND TRANSMISSIONS
An increasing number of ports are introducing specific quarantine reporting requirements with regards to
this virus. Its continued spread is also impacting a number of other services covered by Admiralty List of
Radio Signals products. Due to the ongoing and dynamic nature of the situation, mariners should contact
the appropriate Port Authority, VTS, Pilot, coastguard, radio station or other designated body covering
their planned route and destination, for the latest advice and procedures. Due to the rapidly changing
situation, it is advised to check local situation at the earliest opportunity when passage planning.
 denotes chart available in the ADMIRALTY Raster Chart Service series.
Wk26/20 1.6
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS
New Editions of ADMIRALTY Charts published 25 June 2020
Chart Title, limits and other remarks Scale Folio 2020 Catalogue
page
344 China - Zhu Jiang, Shanban Zhou to Nizhou Tou. 1:25,000 47 78
Includes significant safety-related information as follows: changes to depths,

buoys and container wharfs.
Note: On publication of this New Edition former Notice 1597(P)/20 is

cancelled.
346 China - Zhu Jiang, Nizhou Tou to Huangpu. 1:25,000 47 78
Includes significant safety-related information as follows: changes to depths

and coastline.

cancelled.
348 China - South Coast , Chiwan Gangqu to Dachanwan Gangqu. 1:15,000 47 78
Includes significant safety-related information as follows: changes to depths.
Note: On publication of this New Edition former Notices 1603(P)/20 and

2644(P)/20 are cancelled.
1077 Scotland - East Coast, Approaches to Cromarty Firth and Inverness Firth. 1:20,000 6 28
Includes significant safety-related information as follows: new anchorage

area and changes to anchor berths. Also includes changes to depths from the
latest Port Authority and commercial surveys.

cancelled.
1889 International Chart Series, Scotland - East Coast, Cromarty Firth, Cromarty 1:15,000 6 28
INT 1540 to Invergordon.
Invergordon. 1:5,000
Includes significant safety-related information as follows: new anchorage

area and changes to anchor berths. Also includes changes to depths from the
latest Port Authority and commercial surveys.

cancelled. This chart remains affected by Notice 1546(T)/19.
1.7 Wk26/20
I
New Editions of ADMIRALTY Charts published 25 June 2020 (continued)
page
1990 Mediterranean Sea, Oristano to Arbatax including Golfo di Cagliari. 1:300,000 25 42
Includes general updating throughout.
2241 Baltic Sea, Entrance to the Gulf of Finland. 1:200,000 10 36
Includes significant safety-related information as follows: a new submarine

cable.

cancelled. This chart remains affected by Notices 6402(P)/19 and
2825(T)/20.
2248 Baltic Sea, Gulf of Finland Western Part. 1:200,000 11 36

cable.

cancelled. This chart remains affected by Notices 6402(P)/19, 1264(T)/20
and 2825(T)/20.
3171 Gulf of Oman, Iran, Oman and United Arab Emirates, Southern Approaches 1:125,000 40 62
to the Strait of Hormuz.
Includes changes to depths and coastline.
3172 Oman and Iran, Strait of Hormuz. 1:125,000 40 62
Includes changes to depths, coastline and firing practise areas.
3173 Iran and Oman, Strait of Hormuz Northern Part. 1:125,000 40 62
Includes changes to depths, coastline, harbour installations, wrecks, aids to

navigation and submarine cables.
3818 International Chart Series, Baltic Sea - Gulf of Finland, Approaches to 1:50,000 11 36
INT 1250 Helsinki.

cable. (A modified reproduction of INT1250 published by Finland.)

cancelled. This chart remains affected by Notice 6402(P)/19.
Wk26/20 1.8
I
New Editions of ADMIRALTY Charts published 25 June 2020 (continued)
page
3819 International Chart Series, Baltic Sea - Gulf of Finland, Approaches to 1:50,000 11 36
INT 1251 Porkkala and Kantvik.

cable. (A modified reproduction of INT1251 published by Finland.)

cancelled. This chart remains affected by Notice 6402(P)/19.
4010 International Chart Series, Norwegian Sea and Adjacent Seas. 1:10,000,000 15 16, 134
INT 10
Includes updated lines of equal magnetic variation for 2020. (A modified
reproduction of INT10 published by Norway.)
Note: This chart remains affected by Notices 5402(T)/19, 134(T)/20 and

1728(T)/20.
4115 North Atlantic Ocean, Arquipélago dos Açores to the Arquipelago de Cabo 1:3,500,000 19 18
Verde.
Includes updated lines of equal magnetic variation for 2020.
Note: This chart remains affected by Notices 1483(T)/20.
4200 International Chart Series, South Atlantic Ocean, Río de la Plata to Cabo de 1:3,500,000 96 18
INT 200 Hornos.

reproduction of INT200 published by Argentina.)
4202 International Chart Series, South Atlantic Ocean, East Coast of South 1:3,500,000 95 18
INT 202 America.

reproduction of INT202 published by Brazil.)
4215 International Chart Series, Atlantic Ocean, Recife to Dakar. 1:3,500,000 20 18

INT 215
reproduction of INT215 published by Brazil.)
1.9 Wk26/20
I
Reproductions of Australian Government Charts

(Publication dates of these charts reflect the dates shown on the Australian Government Charts)
Chart Published Title and other remarks Scale Folio 2020 Catalogue
page
AUS614 29/05/2020 Australia - East Coast, Coral Sea, Diamond Passage. 1:150,000 66 90
17° 00´·00 S.— 17° 53´·20 S., 150° 47´·40 E.— 152° 15´·00 E
East Diamond Islet. 1:25,000
Turtle Islet. 1:25,000
Includes general updating throughout. (A modified reproduction of

Aus614 published by Australia.)
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED
ADMIRALTY CHARTS TO BE PUBLISHED 09 JULY 2020
New Editions of ADMIRALTY Charts

Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio
343 China - South Coast, Zhujiang Kou. 1:75,000 343 47
Includes significant safety-related information as follows:

Changes to depths,coastline and lights.
874 International Chart Series, Sweden - West Coast, Varberg to 1:50,000 874 10
INT 1319 Tylön. INT 1319
A Varberg. 1:10,000
B Träslövsläge. 1:5,000
C Galtabäck. 1:10,000
D Glommen. 1:5,000
E Falkenburg. 1:15,000
F Stensjöhamn. 1:10,000
Includes a new recommended route, and changes to depths,

dredged depths, aids to navigation and nature reserves. (A
modified reproduction of INT1319 published by Sweden.)
999 Gulf of Thailand, Thailand, Approaches to Bangkok (Krung 1:35,000 999 47

Thep).
Wk26/20 1.10
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED
ADMIRALTY CHARTS TO BE PUBLISHED 09 JULY 2020
New Editions of ADMIRALTY Charts (continued)

Charts to be
1046 Gulf of Thailand, Outer Approaches to Ports from Krung Thep to 1:120,000 1046 47
Map Ta Phut.
1872 North Sea , Dunkerque to Vlissingen. 1:100,000 1872 9

Blankenberge. 1:15,000
Includes significant safety-related information as follows: new

restricted area, marine reserve and changes to marine reserve,
mine laying practice area and restricted area. (A modified
reproduction of Chart D11 published by Belgium).
1874 International Chart Series, North Sea, Westerschelde, Oostende to 1874 9

INT 1474 Westkapelle. 1:60,000 INT 1474
A Zeebrugge. 1:20,000
B Brugge. 1:15,000
Includes significant safety-related information as follows: a new

restricted area and changes to marine reserves, mine laying
practice area and restricted area. (A modified reproduction of INT
1474 published by Belgium).
2949 International Chart Series, Mozambique, Tanzania, Kenya and 1:1,000,000 2949 36
INT 7056 Somalia, Mtwara to Lamu. INT 7056
Includes updates to lines of equal magnetic variation for 2020.
4701 International Chart Series, Indian Ocean, Maputo to Muqdisho. 1:3,500,000 4701 BF36
INT 701 INT 701
4702 International Chart Series, Indian Ocean, Chagos Archipelago to 1:3,500,000 4702 BF38
INT 702 Madagascar. INT 702
4703 International Chart Series, Indian Ocean, Gulf of Aden to the 1:3,500,000 4703 BF42
INT 703 Maldives and the Seychelles Group. INT 703
4707 International Chart Series, Indian Ocean, Maldives to Sumatera. 1:3,500,000 4707 BF42
INT 707 INT 707
1.11 Wk26/20
I
CHARTS TO BE AVAILABLE 09 JULY 2020
New Charts
Reproductions of Australian Government Charts
Charts to be
PNG621 Papua New Guinea, South Coast, Approaches to Port Moresby. 1:37,500 AUS621 66
A replacement of chart AUS621 with the same chart limits.

Includes changes to depths and general updating throughout. (A
modified reproduction of PNG621 published by Australia.)
PNG627 Papua New Guinea, North East Coast, Jomard Entrance. 1:75,000 AUS627 67
A replacement of chart AUS627 with the same chart limits.

Includes changes to depths and general updating throughout. (A
modified reproduction of PNG627 published by Australia.)
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN
ADMIRALTY Charts
Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition
344 China - Zhu Jiang, Shanban Zhou to Nizhou Tou. 344
346 China - Zhu Jiang, Nizhou Tou to Huangpu. 346
348 China - South Coast , Chiwan Gangqu to Dachanwan Gangqu. 348
1077 Scotland - East Coast, Approaches to Cromarty Firth and Inverness Firth. 1077
1889 International Chart Series, Scotland - East Coast, Cromarty Firth, Cromarty to 1889
INT 1540 Invergordon. INT 1540
1990 Mediterranean Sea, Oristano to Arbatax including Golfo di Cagliari. 1990
2241 Baltic Sea, Entrance to the Gulf of Finland. 2241
2248 Baltic Sea, Gulf of Finland Western Part. 2248
3171 Gulf of Oman, Iran, Oman and United Arab Emirates, Southern Approaches to 3171
the Strait of Hormuz.
3172 Oman and Iran, Strait of Hormuz. 3172
Wk26/20 1.12
I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN
ADMIRALTY Charts (continued)
Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition
3173 Iran and Oman, Strait of Hormuz Northern Part. 3173
3818 International Chart Series, Baltic Sea - Gulf of Finland, Approaches to Helsinki. 3818
INT 1250 INT 1250
3819 International Chart Series, Baltic Sea - Gulf of Finland, Approaches to Porkkala 3819
INT 1251 and Kantvik. INT 1251
4010 International Chart Series, Norwegian Sea and Adjacent Seas. 4010
INT 10 INT 10
4115 North Atlantic Ocean, Arquipélago dos Açores to the Arquipelago de Cabo 4115
Verde.
4200 International Chart Series, South Atlantic Ocean, Río de la Plata to Cabo de 4200
INT 200 Hornos. INT 200
4202 International Chart Series, South Atlantic Ocean, East Coast of South America. 4202
INT 202 INT 202
4215 International Chart Series, Atlantic Ocean, Recife to Dakar. 4215

INT 215 INT 215
AUS614 Australia - East Coast, Coral Sea, Diamond Passage. AUS614
ADMIRALTY CHARTS INDEPENDENTLY WITHDRAWN
ADMIRALTY Charts
Chart to be Date of
WITHDRAWN Main Title withdrawal
8056 Port Approach Guide, Pelabuhan Tanjungpriok. 25 June 2020
8255 Port Approach Guide, Charleston. 25 June 2020
8276 Port Approach Guide, Invergordon. 25 June 2020
8296 Port Approach Guide, Malmö and Københavns Havn (Copenhagen). 25 June 2020
1.13 Wk26/20
IB
CURRENT NAUTICAL PUBLICATIONS
(ADMIRALTY Sailing Directions, ADMIRALTY List of Lights, ADMIRALTY Lists of Radio Signals,
ADMIRALTY Tidal Publications, ADMIRALTY Reference Publications)
(Updated to 25 June 2020)

(Former Listing dated 26 March 2020 is cancelled)
(1) Current Editions of ADMIRALTY Sailing Directions
NP No Title Edition
1* Africa Pilot Volume 1 18th (2017)
2 Africa Pilot Volume 2 18th (2017)
3 Africa Pilot Volume 3 18th (2019)
4 South-East Alaska Pilot 8th (2015)
5 South America Pilot Volume 1 19th (2017)
7A South America Pilot Volume 4 8th (2018)
8 Pacific Coasts of Central America and United States Pilot 15th (2019)
9 Antarctic Pilot 9th (2019)
10 Arctic Pilot Volume 1 9th (2016)
13* Australia Pilot Volume 1 5th (2017)
14 Australia Pilot Volume 2 14th (2019)
15 Australia Pilot Volume 3 14th (2018)
18* Baltic Pilot Volume 1 18th (2018)
19 Baltic Pilot Volume 2 17th (2018)
20 Baltic Pilot Volume 3 14th (2019)
21 Bay of Bengal Pilot 13th (2019)
22 Bay of Biscay Pilot 14th (2019)
23 Bering Sea and Strait Pilot 9th (2019)
24 Black Sea and Sea of Azov Pilot 6th (2019)
25 British Columbia Pilot Volume 1 17th (2019)
26 British Columbia Pilot Volume 2 11th (2017)
27 Channel Pilot 12th (2018)
28* Dover Strait Pilot 12th (2017)
30* China Sea Pilot Volume 1 11th (2018)
31 China Sea Pilot Volume 2 14th (2019)
32A* China Sea Pilot Volume 3 2nd (2019)
32B* China Sea Pilot Volume 4 2nd (2019)
33* Philippine Islands Pilot 6th (2017)
34* Indonesia Pilot Volume 2 9th (2019)
35 Indonesia Pilot Volume 3 7th (2017)
36* Indonesia Pilot Volume 1 10th (2019)
37 West Coasts of England and Wales Pilot 20th (2017)
38 West Coast of India Pilot 19th (2019)
39* South Indian Ocean Pilot 15th (2017)
40 Irish Coast Pilot 21st (2019)
41 Japan Pilot Volume 1 12th (2018)
42A Japan Pilot Volume 2 7th (2020)
42B Japan Pilot Volume 3 12th (2019)
42C* Japan Pilot Volume 4 5th (2015)
43 South and East Coasts of Korea, East Coast of Siberia and Sea of Okhotsk Pilot 12th (2020)
44 Malacca Strait and West Coast of Sumatera Pilot 14th (2019)
45* Mediterranean Pilot Volume 1 16th (2018)
1B-1
Wk26/20
IB
(1) Current Editions of ADMIRALTY Sailing Directions (continued)
NP No Title Edition
46 Mediterranean Pilot Volume 2 16th (2018)
48 Mediterranean Pilot Volume 4 18th (2019)
50 Newfoundland and Labrador Pilot 14th (2016)
51 New Zealand Pilot 19th (2015)
52 North Coast of Scotland Pilot 10th (2018)
54 North Sea (West) Pilot 11th (2018)
55* North Sea (East) Pilot 11th (2018)
56 Norway Pilot Volume 1 17th (2018)
57A Norway Pilot Volume 2A 13th (2019)
57B Norway Pilot Volume 2B 10th (2017)
58A Norway Pilot Volume 3A 9th (2020)
58B Norway Pilot Volume 3B 8th (2018)
59 Nova Scotia and Bay of Fundy Pilot 16th (2020)
60 Pacific Islands Pilot Volume 1 13th (2018)
63* Persian Gulf Pilot 18th (2018)
64 Red Sea and Gulf of Aden Pilot 19th (2018)
65 St Lawrence Pilot 19th (2020)
66A South West Coast of Scotland Pilot 2nd (2019)
66B North West Coast of Scotland Pilot 2nd (2019)
67 West Coasts of Spain and Portugal Pilot 13th (2018)
68 East Coast of the United States Pilot Volume 1 16th (2018)
69 East Coast of the United States Pilot Volume 2 14th (2017)
69A* East Coasts of Central America and Gulf of Mexico Pilot 8th (2019)
70* West Indies Pilot Volume 1 7th (2018)
71 West Indies Pilot Volume 2 18th (2017)
72 Southern Barents Sea and Beloye More Pilot 4th (2019)
* New or Revised Edition due for publication within one year.
(2) ADMIRALTY List of Lights and Fog Signals
NP No Edition Published
74 Volume A, 2020 April 2020
75 Volume B, 2019/20 June 2019
76 Volume C, 2019/20 July 2019
77 Volume D, 2019/20 May 2019
78 Volume E, 2019/20 May 2019
79 Volume F, 2019/20 August 2019
80 Volume G, 2019/20 November 2019
81 Volume H, 2019/20 December 2019
82 Volume J, 2019/20 January 2020
83 Volume K, 2020/21 January 2020
84 Volume L, 2020/21 March 2020
85 Volume M, 2019/20 October 2019
86 Volume N, 2019/20 August 2019
87 Volume P, 2019/20 September 2019
88 Volume Q, 2020/21 December 2019
1B-2
Wk26/20
IB
(3) ADMIRALTY List of Radio Signals
NP No Title Published
281 Volume 1 Maritime Radio Stations:
2019/20 Part 1: Europe, Africa and Asia (excluding the Far East) November 2019
2019/20 Part 2: The Americas, Far East and Oceania November 2019
282 Volume 2 Radio Aids to Navigation, Differential GPS (DGPS), Legal Time,
Radio Time Signals and Electronic Position Fixing System
Part 1: Europe, Africa and Asia (excluding the Far East) 1st (2020)
Part 2: The Americas, Far East and Oceania 1st (2020)
283 Volume 3 Maritime Safety Information Services:
2020 Part 1: Europe, Africa and Asia (excluding the Far East) December 2019
2020 Part 2: The Americas, Far East and Oceania January 2020
284 Volume 4, Meteorological Observation Stations 1st (2020)
285 Volume 5, 2019/20 Global Maritime Distress and Safety System (GMDSS) July 2019
286 Volume 6 Pilot Services, Vessel Traffic Services and Port Operations:
Part 1: United Kingdom and Europe (excluding Arctic, Baltic and 1st (2020)
Mediterranean coasts)
Part 2: Europe, Arctic and Baltic coasts, including Iceland and Faroe Islands 1st (2020)
2019/20 Part 3: Mediterranean Sea, Black Sea and Suez Canal July 2019
2019/20 Part 4: Indian Sub-continent, South East Asia and Australasia September 2019
2019/20 Part 5: North America, Canada and Greenland November 2019
Part 6: North East Asia and Russia (Pacific Coast) 1st (2020)
Part 7: Central and South America and the Caribbean 1st (2020)
Part 8: Africa (excluding Mediterranean Coast), Red Sea and the Persian Gulf 1st (2020)
(4) ADMIRALTY Tidal Publications
NP No ADMIRALTY Tide Tables

United Kingdom – English Channel to River Humber (including Isles of Scilly, Channel
201A-20 Volume 1A
Islands and European Channel Ports)
United Kingdom and Ireland (excluding Isles of Scilly, English Channel to River Humber,
201B-20 Volume 1B
Channel Islands and European Channel Ports)
202-20 Volume 2 North Atlantic Ocean and Arctic Regions
203-20 Volume 3 Indian Ocean (including Tidal Stream Tables)
204-20 Volume 4 South Pacific Ocean (including Tidal Stream Tables)
205-20 Volume 5 South China Sea and Indonesia (including Tidal Stream Tables)
206-20 Volume 6 North Pacific Ocean (including Tidal Stream Tables)
207-20 Volume 7 South West Atlantic Ocean and South America
208-20 Volume 8 South East Atlantic Ocean, West Africa and Mediterranean (including Tidal Stream Tables)
164-20 - Dover, Times of High Water and Mean Ranges (published annually)
1B-3
Wk26/20
IB
(4) ADMIRALTY Tidal Publications (continued)
NP No ADMIRALTY Tidal Stream Atlases

209 Edition 4 Orkney and Shetland Islands, 1986
218 Edition 5 North Coast of Ireland and West Coast of Scotland, 1995
219 Edition 2 Portsmouth Harbour and Approaches, 1991
220 Edition 2 Rosyth Harbour and Approaches, 1991
221 Edition 2 Plymouth Harbour and Approaches, 1991
222 Edition 1 Firth of Clyde and Approaches, 1992
233 Edition 3 Dover Strait, 1995
249 Edition 2 Thames Estuary, 1985 (with Co Tidal Charts)
250 Edition 4 The English Channel, 1992
251 Edition 4 North Sea, Southern Part, 2005
252 Edition 4 North Sea, North Western Part, 2005
253 Edition 2 North Sea, Eastern Part, 2004
254 Edition 1 The West Country, Falmouth to Teignmouth, 2003
255 Edition 1 Falmouth to Padstow, including the Isles of Scilly, 2004
256 Edition 4 Irish Sea and Bristol Channel, 1992
257 Edition 3 Approaches to Portland, 1973
258 Edition 1 Bristol Channel, Lundy to Avonmouth, 2006
259 Edition 1 Irish Sea Eastern Part, 2006
263 Edition 1 Lyme Bay, 2003
264 Edition 5 The Channel Islands and the Adjacent Coasts of France, 1993
265 Edition 2 France, West Coast, 2005
337 Edition 4 The Solent and Adjacent Waters, 1993
NP No Co-Tidal Atlases
214 Edition 2 Persian Gulf, 1999
215 Edition 1 South-East Asia, 1979
(5) ADMIRALTY Reference Publications
NP No Title Edition
100 The Mariner’s Handbook 12th (2020)
133C ENC and ECDIS Maintenance Record 2nd (2017)
136 Ocean Passages for the World 1st (2018)
231 ADMIRALTY Guide to the Practical Use of ENCs 3rd (2019)
232 ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures. 3rd (2019)
294 How to Keep Your ADMIRALTY Products Up-to-Date. 10th (2017)
735 IALA Maritime Buoyage System. 8th (2018)
5011 Symbols and Abbreviations used on ADMIRALTY Paper Charts 7th (2018)
5012 ADMIRALTY Guide to ENC Symbols used in ECDIS 2nd (2015)
350(1) ADMIRALTY Distance Tables - Atlantic Ocean 2nd (2011)
350(2) ADMIRALTY Distance Tables - Indian Ocean 3rd (2008)
350(3) ADMIRALTY Distance Tables - Pacific Ocean 2nd (2009)
(6) ADMIRALTY Digital Services
Please refer to Section VIII of ADMIRALTY Weekly Notices to Mariners.
1B-4
Wk26/20
II
GEOGRAPHICAL INDEX
(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7

(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7 – 2.9
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.10
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.10 – 2.12
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . 2.12 – 2.15
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.15
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.15 – 2.16
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.17
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.17 – 2.18
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.18
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.18
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21 – 2.24
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24 – 2.29
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.29
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.29 – 2.31
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.31 – 2.33
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . . . . . . . 2.34
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.35 – 2.37
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.37
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.38 – 2.52
2.1
Wk26/20
II
INDEX OF NOTICES AND CHART FOLIOS
Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
3103(P)/20 2.43 38 3160(P)/20 2.42 40
3104 2.21 47 3161(P)/20 2.52 86
3105 2.34 71 3162 2.30 58, 60, 63
3106 2.21 52 3163(T)/20 2.50 63
3107 2.35 86 3164(T)/20 2.44 45
3108(P)/20 2.45 52 3165(T)/20 2.38 1
3109(P)/20 2.41 28 3166(T)/20 2.50 65
3110* 2.7 8 3167(P)/20 2.46 50
3111 2.15 24 3168(P)/20 2.43 43
3112 2.21 50 3169 2.31 63
3113* 2.12 9 3170(T)/20 2.40 10
3114 2.15 18 3171 2.34 98
3115* 2.7 7 3172 2.23 50
3116 2.21 50 3173(T)/20 2.38 3
3117 2.10 14 3174 2.32 65
3118 2.36 87 3175(T)/20 2.44 43
3119 2.12 9 3176 2.18 36
3120 2.29 48 3177* 2.18 40
3121 2.13 9 3178 2.16 25
3122(P)/20 2.45 47 3179 2.32 66
3123 2.13 7, 9 3180 2.32 67
3124 2.29 52 3181 2.32 66
3125 2.29 52 3182 2.17 34
3126 2.17 32 3183(P)/20 2.51 95
3127(P)/20 2.42 32 3184 2.33 65
3128* 2.17 40 3185 2.23 47
3129 2.16 24 3186 2.24 50
3130(T)/20 2.39 10 3187 2.24 54
3131(T)/20 2.38 6, 7 3188 2.24 54
3132* 2.7 7 3189 2.25 54
3133(T)/20 2.50 52 3190 2.25 54
3134 2.16 27 3191 2.25 54
3135 2.22 52 3192 2.25 54
3136 2.10 11 3193 2.26 54
3137(T)/20 2.39 10 3194 2.26 54
3138 2.11 10 3195 2.27 54
3139 2.11 11 3196 2.27 54
3140* 2.8 2 3197 2.28 54
3141(T)/20 2.44 45 3198 2.28 53, 54
3142 2.37 81 3199 2.28 53, 54
3143(P)/20 2.39 10 3200 2.29 53
3144 2.34 90 3201(T)/20 2.47 55
3145* 2.18 45 3202(P)/20 2.47 53, 54
3146(P)/20 2.44 45 3203(T)/20 2.48 55
3147(P)/20 2.41 30 3204(T)/20 2.48 55
3148 2.11 10 3205(T)/20 2.48 53
3149 2.13 9 3206(T)/20 2.49 54
3150(T)/20 2.40 9 3207(T)/20 2.49 54
3151(T)/20 2.38 7 3208(T)/20 2.49 54
3152(P)/20 2.42 24 3209(T)/20 2.50 53
3153 2.14 9 3210 2.24 52
3154 2.29 52 3211(T)/20 2.43 40
3155 2.37 87 3212 2.14 9
3156 2.12 10 3213(T)/20 2.51 65
3157* 2.18 40 3214 2.29 52
3158 2.14 9 3215(T)/20 2.51 65
3159 2.7 98 3216* 2.14 9
2.2
Wk26/20
II
INDEX OF NOTICES AND CHART FOLIOS
Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
3217 2.10 14, 15
3218* 2.8 7
3219(T)/20 2.39 1
3220 2.33 65
3221 2.30 60
3222(P)/20 2.46 50
3223(P)/20 2.42 34
3224* 2.14 9
3225 2.33 65
3226* 2.15 9
3227* 2.8 2
3228(P)/20 2.40 9
3229 2.30 58
3230 2.12 10
3231 2.37 83
3232* 2.9 7
3233(P)/20 2.39 3
3234 2.31 46
3235* 2.9 2
3236 2.16 31
3237 2.31 46
3238(T)/20 2.52 87
3239 2.15 9
3240 2.12 10
2.3
Wk26/20
II
INDEX OF CHARTS AFFECTED
Admiralty Chart No. Notices

Notices Admiralty
Admiralty Chart
Chart No.
No. Notices
15 3126, 3127P 1495 3103P

16 3127P 1497 3103P
50 3144 1628 3118, 3238T
86 3114 1632 3123
93 3114 1633 3123, 3158
103 3104 1719 3112
104 3151T 1760 3222P
107 3151T 1826 3173T
108 3218 1840 3227
157 3126 1859 3235
175 3131T 2018 3138
177 3129 2036 3219T
190 3131T 2038 3219T
207 3121 2045 3165T
208 3119 2064 3107
254 3107 2065 3107
266 3232 2073 3136
341 3122P 2085 3139
368 3155 X 2107 3170T
471 3161P X 2108 3130T, 3137T
509 3171 2137 3237
584 3107 2182A 3123, 3232
585 3107 2182B 3232
598 3183P 2234 3236
689 3136 2327 3117
722 3176 2328 3117
742 3176 2370 3156
811 3148 2409 3172, 3222P
820 3148 2450 3165T
823 3175T 2472 3162
826 3175T 2523 3177, 3211T
833 3175T 2532 3230
837 3240 2537 3129
874 3143P 2538 3129
889 3136 X 2589 3137T
X 894 3170T 2619 3167P
932 3234 2682 3217
945 3221 2793 3219T
1008 3124 2812 3182
1025 3107 2816 3138
1065 3125 2837 3211T
1151 3140 2847 3211T
1152 3140 2858 3211T
1163 3154 2873 3237
1166 3235 2886 3211T
1176 3235 2909 3162
1186 3110 2921 3142
1190 3151T 3119 3152P
1191 3232 3136 3217
1199 3116, 3186 3137 3217
1206 3135 3148 3231
1249 3135 3171 3160P
1250 3135 3231 3172, 3222P
1255 3135 3348 3185
1256 3135 3351 3185
1259 3214 3363 3185
1270 3133T 3402 3111
1281 3210 3488 3104
1283 3210 3497 3115, 3132
1294 3106 3520 3157
1305 3116 3626 3120
1312 3237 3708 3128
1320 3173T 3709 3128
1381 3182 3723 3128
1407 3131T 3726 3221
1408 3123 3738 3211T
1422 3212 3746 3233P
1426 3134 3790 3211T
1460 3178 3833 3164T
2.4
Wk26/20
II

Notices Japanese
Chart No.
3852 3231 JP 10 3201T
3892 3104 JP 104 3187, 3188, 3189
4030 3145 JP 127 3208T
4031 3145 JP 129 3208T
4032 3145 JP 142 3191, 3192, 3193, 3194,
4033 3145
4035 3141T, 3145 3195, 3196
4038 3145 JP 151 3198, 3199, 3200
4039 3145, 3164T JP 153 3187, 3188, 3190
4040 3141T, 3145, 3164T JP 179 3202P
4041 3141T, 3145, 3164T JP 201 3202P
4129 3122P JP 214A 3209T
4238 3159 JP 214B 3209T
4486 3229 JP 1056 3205T
4721 3162 JP 1102 3195, 3197, 3198, 3199
4723 3163T JP 1103 3206T, 3207T
8012 3228P JP 1108 3187, 3188, 3190, 3195, 3197
8017 3109P JP 1109 3191
8018 3223P JP 1110 3207T
8036 3183P JP 1112B 3193
8043 3211T JP 1141 3206T
8055 3152P JP 1155A 3204T
8061 3147P JP 1162B 3203T
8065 3238T JP 1195 3201T
8111 3108P JP 1247A 3198, 3199
8175 3146P JP 1247B 3198
JP 1266 3202P
Australian
Notices New Zealand
Chart No. Notices
Chart No.
Aus 24 3169
Aus 28 3169 NZ 61 3105
Aus 143 3213T, 3220 NZ 6142 3105
Aus 155 3213T, 3220
Aus 171 3225 International
Aus 172 3166T, 3215T Chart No.
Notices
Aus 173 3225
Aus 200 3174 INT 552 3104
Aus 235 3181 INT 721 3162
Aus 311 3162 INT 723 3163T
Aus 312 3162 INT 750 3211T
Aus 328 3163T INT 1042 3232
Aus 357 3184 INT 1043 3123, 3232
Aus 389 3180 INT 1044 3212
Aus 487 3184 INT 1045 3150T, 3216
Aus 812 3179 INT 1202 3138
Aus 813 3179 INT 1232 3240
Aus 815 3181 INT 1238 3148
INT 1239 3148
German INT 1240 3136
Notices INT 1301 3170T
Chart No.
INT 1302 3130T, 3137T
DE 4 3149 INT 1319 3143P
DE 42 3153 INT 1355 3156
DE 44 3113 INT 1366 3153
DE 46 3153, 3226 INT 1373 3230
DE 47 3224 INT 1379 3137T
DE 50 3150T, 3216 INT 1417 3123, 3158
DE 90 3239 INT 1420 3123
INT 1452 3113
INT 1453 3153, 3226
Indian INT 1454 3224
Notices
Chart No. INT 1457 3149
INT 1461 3239
IN 3037 3168P INT 1465 3121
IN 3038 3168P INT 1466 3119
INT 1505 3131T
INT 1507 3232
2.5
Wk26/20
II
International
Admiralty Chart No. Notices Admiralty Chart No. Notices
Notices
Chart No.
INT 1508 3151T
INT 1554 3115, 3132
INT 1566 3151T
INT 1607 3173T
INT 1635 3233P
INT 1654 3235
INT 1655 3235
INT 1703 3165T
INT 1730 3219T
INT 1777 3136
INT 2891 3182
INT 3512 3111
INT 3554 3152P
INT 4182 3107
INT 5363 3133T
INT 7006 3126
INT 7017 3211T
INT 7018 3211T
INT 7154 3126, 3127P
INT 7155 3127P
INT 7200 3157
INT 7243 3211T
INT 7250 3177, 3211T
INT 7252 3211T
INT 7254 3211T
INT 7438 3175T
INT 7441 3175T
INT 7442 3175T
INT 7735 3103P
INT 7736 3103P
INT 7741 3176
INT 7742 3176
INT 9311 3217
INT 9313 3217
2.6
Wk26/20
II
3159 MISCELLANEOUS UPDATES TO CHARTS
Source: UKHO
Chart Previous Update Details
4238 4407/19 Effective from 18/06/20

Insert magenta limit and chart number, 4239, as follows:
North: 32° 43´·05S. East: 71° 28´·70W.

South: 32° 47´·27S. West: 71° 35´·10W.
Insert magenta limit and chart number, 4242, as follows:
North: 32° 58´·80S. East: 71° 32´·57W.

South: - West: 71° 39´·22W.
Delete magenta limit and chart number, 4239, in position: 32° 43´·04S., 71° 34´·77W.
Delete magenta limit and chart number, 4242, in position 32° 58´·76S., 71° 39´·05W.
3110* ENGLAND - East Coast - Depths.

Source: Port of London Authority
Chart 1186 (Panel A, Canvey Island to Coalhouse Point) [ previous update 3005/20 ] ETRS89 DATUM
Insert depth, 85 (a) 51° 27´·425N., 0° 26´·387E.
Delete depth, 76, close NW of: (a) above
3115* ENGLAND - East Coast - Depths. Drying height.

Source: ABP Humber
Chart 3497 (INT 1554) [ previous update 3100/20 ] ETRS89 DATUM

Insert drying height, 01, enclosed by 0m low water line 53° 43´·05N., 0° 22´·73W.
depth, 1, enclosed by 2m contour (a) 53° 43´·46N., 0° 22´·64W.
Delete depth, 62, close N of: (a) above
Insert depth, 09, enclosed by 2m contour (b) 53° 43´·54N., 0° 22´·32W.
Delete depth, 66, close W of: (b) above
Insert depth, 49, and extend 5m contour N to enclose (c) 53° 43´·55N., 0° 22´·09W.
Delete depth, 76, close W of: (c) above
3132* ENGLAND - East Coast - Depths. Drying height.

Source: ABP Humber

Insert depth, 05, and extend 2m contour SE to enclose 53° 43´·55N., 0° 18´·96W.
depth, 18, and extend 2m contour SE to enclose (a) 53° 43´·58N., 0° 18´·62W.
2.7
Wk26/20
II
3140* ENGLAND - Bristol Channel - Drying heights. Depths.

Source: Ecospan Environmental Ltd
Chart 1151 [ previous update 5923/19 ] ETRS89 DATUM

drying height, 02, enclosed by 0m low water line 51° 14´·90N., 3° 06´·34W.
(a) 51° 15´·02N., 3° 05´·23W.
Delete depth, 07, close SW of: (a) above
Insert drying height, 3, enclosed by 2m drying contour 51° 15´·36N., 3° 04´·42W.
Replace drying height, 09, with drying height, 18 51° 14´·94N., 3° 03´·90W.
Chart 1152 [ previous update New Edition 04/06/2020 ] ETRS89 DATUM

drying height, 02, enclosed by 0m low water line (a) 51° 14´·90N., 3° 06´·34W.
Insert drying height, 02, enclosed by 0m low water line (b) 51° 15´·02N., 3° 05´·23W.
Delete depth, 07, close SW of: (b) above
Insert drying height, 3, enclosed by 2m drying contour 51° 15´·36N., 3° 04´·42W.
drying height, 18 51° 14´·94N., 3° 03´·90W.
3218* ENGLAND - East Coast - Buoy.

Source: Port of Wells Harbour Master
Chart 108 (Panel, Wells-next-the-Sea) [ previous update 2551/20 ] ETRS89 DATUM

Move
GXQ(9)15s
s from:
52° 59´·69N., 0° 50´·33E.
to: 52° 59´·68N., 0° 50´·24E.

Move
GXQ(9)15s
s from:
52° 59´·69N., 0° 50´·33E.
to: 52° 59´·68N., 0° 50´·24E.
3227* IRELAND - West Coast - Marine farm.

Source: Tim Reardon

Insert limit of marine farm, pecked line, joining: (a) 51° 39´·44N., 9° 47´·51W.
(b) 51° 39´·45N., 9° 46´·88W.
(c) 51° 39´·32N., 9° 46´·86W.
(d) 51° 39´·31N., 9° 47´·51W.
Ì, within: (a)-(d) above
2.8
Wk26/20
II
3232* ENGLAND - East Coast - Wreck.

Source: Humber Coastguard and Trinity House
Chart 266 [ previous update 2658/20 ] WGS84 DATUM

Insert
23, Wk 55° 04´·21N., 1° 20´·38E.

Insert
23, Wk 55° 04´·21N., 1° 20´·38E.
Chart 2182A (INT 1043) [ previous update 3123/20 ] WGS84 DATUM

Insert
23, Wk 55° 04´·2N., 1° 20´·4E.
Chart 2182B (INT 1042) [ previous update 2658/20 ] WGS84 DATUM

Insert
23, Wk 55° 04´·2N., 1° 20´·4E.
3235* ENGLAND - Bristol Channel - Drying heights. Depths.

Source: Bristol Port Company
Chart 1166 (Panel A, Avonmouth to Severn Bridge) [ previous update 2824/20 ] ETRS89 DATUM
Insert depth, 45, enclosed by 5m contour 51° 31´·14N., 2° 43´·64W.
Replace depth, 08, with depth, 02 51° 30´·44N., 2° 43´·26W.

depth, 46, enclosed by 5m contour 51° 30´·86N., 2° 44´·79W.
Replace depth, 07, with depth, 02 51° 30´·44N., 2° 43´·26W.
Chart 1859 (INT 1655) (Panel A, King Road) [ previous update 1420/20 ] ETRS89 DATUM
drying height, 19, enclosed by 0m low water line (a) 51° 30´·847N., 2° 44´·979W.
Delete depth, 6, close W of: (a) above
drying height, 21, enclosed by 0m low water line (b) 51° 31´·019N., 2° 44´·860W.
Delete depth, 31, close NE of: (b) above
depth, 02 51° 30´·440N., 2° 43´·262W.
2.9
Wk26/20
II
3117 NORWAY - West Coast - Light.

Source: Norwegian Notice 9/61488/20 and Norwegian Lights List

Amend light to, Iso.WRG.4s7-6M 68° 18´·97N., 14° 15´·94E.

Amend light to, Iso.WRG.4s7-6M 68° 18´·96N., 14° 15´·92E.
3217 ARCTIC OCEAN - Depths.

Source: ENC NO3C4828

Insert depth, 95, enclosed by 100m contour (a) 79° 53´·6N., 15° 15´·2E.
Delete depth, 166, close SE of: (a) above
Replace depth, 178, with depth, 73, and extend 100m contour NW to
enclose 79° 53´·8N., 15° 44´·3E.
Chart 3136 (INT 9313) [ previous update New Edition 02/01/2020 ] WGS84 DATUM
Insert depth, 128 (a) 79° 57´·9N., 15° 41´·4E.
depth, 157, close S of: (a) above
Insert depth, 149 (b) 79° 56´·2N., 15° 28´·1E.
Delete depth, 179, close S of: (b) above
Insert depth, 73, enclosed by 100m contour (c) 79° 53´·8N., 15° 44´·3E.
Delete depth, 178, close NW of: (c) above
Insert depth, 95, enclosed by 100m contour (d) 79° 53´·6N., 15° 15´·2E.
Delete depth, 170, close SE of: (d) above
Insert depth, 112 (e) 79° 49´·2N., 15° 19´·9E.
Delete depth, 164, close S of: (e) above
Insert depth, 122 (f) 79° 43´·8N., 15° 17´·6E.
Delete depth, 174, close NE of: (f) above
Chart 3137 (INT 9311) [ previous update 2373/20 ] WGS84 DATUM

Replace depth, 42, with depth, 20, enclosed by 20m contour 77° 44´·7N., 20° 23´·8E.
3136 SWEDEN - East Coast - Legends.

Source: Swedish Notice 808/14944/20

Insert legend, N, at pilot boarding place 60° 11´·6N., 18° 55´·2E.
legend, S, at pilot boarding place 60° 08´·5N., 18° 51´·6E.


2.10
Wk26/20
II
3138 BALTIC SEA - Fouls.


Insert
« 55° 42´·23N., 17° 14´·16E.
55° 39´·29N., 17° 16´·00E.
55° 36´·45N., 17° 16´·48E.
55° 34´·19N., 17° 12´·06E.
55° 36´·45N., 17° 06´·22E.
55° 34´·90N., 16° 59´·78E.
55° 37´·33N., 16° 54´·42E.
55° 38´·90N., 17° 00´·97E.
55° 41´·76N., 17° 06´·30E.
55° 43´·23N., 16° 57´·45E.

Insert
« 55° 42´·2N., 17° 15´·8E.
55° 39´·3N., 17° 16´·0E.
55° 36´·4N., 17° 16´·5E.
55° 34´·2N., 17° 12´·1E.
55° 36´·4N., 17° 07´·1E.
55° 34´·9N., 16° 59´·8E.
55° 37´·3N., 16° 54´·4E.
55° 38´·9N., 17° 01´·0E.
55° 42´·0N., 17° 06´·7E.
55° 43´·2N., 16° 57´·4E.
3139 SWEDEN - East Coast - Light.


Delete
¶ Fl.WRG.3s6m6M Sikeå and associated sectors 64° 08´·31N., 20° 59´·13E.
3148 SWEDEN - East Coast - Legends.


Insert legend, 5kn, centred on: 59° 21´·729N., 18° 06´·667E.
59° 21´·620N., 18° 06´·779E.

Insert legend, 5kn, centred on: 59° 21´·78N., 18° 06´·66E.
59° 21´·59N., 18° 06´·81E.
2.11
Wk26/20
II
3156 GERMANY - Baltic Coast - Restricted area.

Source: German Notice 21/1672/20

Delete circular limit of restricted area, entry prohibited, centred on: 54° 09´·680N., 12° 06´·740E.
3230 DENMARK - Islands - NM Block. Depth.

Source: Danish Chart Correction 21/325/20
Chart 2532 (INT 1373) (Panel D, Ærøskøbing) [ previous update 1887/20 ] WGS84 DATUM
Insert the accompanying block, centred on: 54° 54´·0N., 10° 25´·0E.

Delete depth, 129 54° 53´·79N., 10° 25´·09E.
3240 SWEDEN - East Coast - Islet. Light.

Replace symbol, islet with ¶ F R (1 Apr - 31 Oct) 58° 50´·16N., 17° 53´·12E.
3113* GERMANY - North Sea Coast - Depths.

Source: BSH N1 SVE 9171900/19
Chart DE 44 (INT 1452) [ previous update 2970/20 ] WGS84 DATUM

Insert depth, 63 (a) 53° 58´·96N., 8° 34´·35E.
Delete depth, 74, close E of: (a) above
Insert depth, 78 (b) 53° 59´·01N., 8° 35´·31E.
3119 NETHERLANDS - Buoyage. Restricted area.

Source: Netherlands Notice 22-23/167/20

Delete
DfFl.Y.5s MK 1 (a) 51° 54´·68N., 4° 29´·30E.
DfFl(3)Y.10s MK 7 51° 54´·79N., 4° 29´·48E.
DfFl.Y.5s MK 13 (b) 51° 54´·90N., 4° 29´·67E.

limit of restricted area, Ç, joining: 51° 54´·87N., 4° 29´·66E.
51° 54´·70N., 4° 29´·37E.
51° 54´·66N., 4° 29´·33E.
(a) above
(b) above
51° 54´·90N., 4° 29´·68E.
2.12
Wk26/20
II
3121 NETHERLANDS - Buoyage.


Move
BdLFl.R.5s M 4, from: 51° 56´·34N., 4° 04´·30E.
to: 51° 56´·37N., 4° 04´·49E.
Delete
BdLFl.R.8s M 6 51° 56´·27N., 4° 03´·96E.
BdLFl.R.5s M 8 51° 56´·20N., 4° 03´·64E.
3123 NETHERLANDS - NM Block. Restricted areas. Platforms.

Source: Netherlands Notices 22-23/165/20

Delete
¼{ 53° 29´·4N., 4° 11´·7E.
53° 24´·5N., 4° 12´·8E.
53° 23´·6N., 4° 12´·1E.


Delete semi-circular limit of restricted area, Ç, centred on: 53° 29´·42N., 4° 12´·00E.
¼{ L10-D and associated circular limit of restricted area,
Ç, centred on: 53° 24´·53N., 4° 12´·82E.
¼{ L10-C and associated circular limit of restricted area,

Ç, centred on: 53° 23´·59N., 4° 12´·06E.
Chart 2182A (INT 1043) [ previous update 2658/20 ] WGS84 DATUM

Delete
¼{ 53° 29´·5N., 4° 11´·8E.
53° 24´·5N., 4° 12´·7E.
53° 23´·5N., 4° 12´·0E.
3149 GERMANY - North Sea Coast - Depths.


Insert depth, 62 (a) 53° 24´·16N., 8° 29´·60E.
Delete depth, 93, close NE of: (a) above
Chart DE 4 (INT 1457) (Panel A, Reiherplate to Brake) [ previous update 842/20 ] WGS84 DATUM
Insert depth, 62 (a) 53° 24´·16N., 8° 29´·60E.
2.13
Wk26/20
II
3153 GERMANY - North Sea Coast - Dredged depth. Depths.

Source: German Notices 20/42/20 and 20/46/20
Chart DE 42 (INT 1366) (Panel C, Brunsbüttel) [ previous update 2763/20 ] WGS84 DATUM
Amend dredged depth, 14,6m, centred on: 53° 53´·032N., 9° 09´·931E.
Chart DE 46 (INT 1453) (Panel, Brunsbüttel) [ previous update 2763/20 ] WGS84 DATUM
Insert depth, 133 (a) 53° 52´·688N., 9° 10´·905E.

Insert depth, 133 (a) 53° 52´·69N., 9° 10´·91E.
Replace depth, 139, with depth, 135 53° 52´·85N., 9° 13´·77E.
3158 NETHERLANDS - Legend.


Amend legend to, NL 1460/DE 90 (INT 1461), centred on: 53° 43´·50N., 6° 17´·50E.
3212 DENMARK - North Sea Coast - Buoy.


Insert
B;Fl(5)Y.20s Rec.St. 56° 20´·8N., 7° 36´·3E.
3216* NORTH SEA - Netherlands Sector - Platform.

Source: NL 22-23/165/20

Delete
¼{ L10-G 53° 29´·4N., 4° 11´·7E.
3224* GERMANY - North Sea Coast - Lights.

Source: WSA Hamburg 44(T)/20

Insert
·F 53° 41´·24N., 9° 29´·12E.
53° 41´·21N., 9° 29´·18E.
2.14
Wk26/20
II
3226* GERMANY - North Sea Coast - Buoy.

Source: WSA Cuxhaven 61/20

Delete
GlFl(5)Y.20s Mess-G. 53° 51´·83N., 8° 58´·87E.
3239 GERMANY - North Sea Coast - Depths.

Chart DE 90 (INT 1461) [ previous update New Chart 11/06/2020 ] WGS84 DATUM
Insert depth, 14 (a) 53° 33´·99N., 6° 40´·11E.
3114 SPAIN - South West Coast - Obstruction.

Source: Spanish Notice 21/162/20
Note: Former Notice 1586(T)/20 is cancelled.

Insert
åObstn 36° 36´·00N., 6° 23´·85W.

Insert
åObstn 36° 36´·00N., 6° 23´·85W.
3111 LIBYA - Legend.

Source: Libyan Ports and Maritime Transport Authority and UKHO

Amend legend to, see NM 3783(P)/17, centred on: 31° 15´·3N., 16° 24´·7E.
2.15
Wk26/20
II
3129 MALTA - Depths.

Source: ENC MT500177

Insert depth, 33 (a) 35° 54´·878N., 14° 30´·512E.
Insert depth, 45, enclosed by 5m contour (b) 35° 54´·820N., 14° 30´·540E.
Insert depth, 54 35° 54´·378N., 14° 30´·060E.

Insert depth, 33 (a) 35° 54´·88N., 14° 30´·51E.

Insert depth, 33 (a) 35° 54´·88N., 14° 30´·51E.
3134 SLOVENIA - Piles.

Source: ENC SI500001
Chart 1426 (Panel A, Luka Koper) [ previous update 5978/19 ] WGS84 DATUM
Insert pile, ã 45° 33´·285N., 13° 43´·802E.
45° 33´·261N., 13° 43´·758E.
45° 33´·226N., 13° 43´·768E.
45° 33´·204N., 13° 43´·757E.
3178 SPAIN - Mediterranean Sea Coast - Jetty. Lights.

Source: Spanish Notice 21/163/20

Insert jetty, single firm line, joining: 39° 38´·804N., 0° 12´·800W.
(a) 39° 38´·822N., 0° 12´·797W.
·Fl(4)R.11s (a) above

Amend light to, Fl(2+1)R.14·5s 39° 38´·859N., 0° 12´·824W.
3236 UKRAINE - Buoy.

Source: Ukrainian Notice 19/346/20
Chart 2234 [ previous update 2377/20 ] PULKOVO 1942 DATUM

Insert
GUQm 46° 59´·8N., 38° 13´·9E.
2.16
Wk26/20
II
3182 NIGERIA - Depths. Buoyage. Wreck. Lights.

Source: ENC NG525010

Insert depth, 94, enclosed by 10m contour 6° 21´·99N., 3° 25´·33E.

Insert
JbFl.G.2·5s 6° 24´·445N., 3° 24´·097E.
JdFl.R.2·5s 6° 24´·445N., 3° 23´·851E.
´ 6° 27´·334N., 3° 22´·807E.
Amend light to, 2F(vert) 6° 27´·321N., 3° 22´·575E.
6° 27´·435N., 3° 22´·601E.
Move
CnFl(2+1)G.2·5s No 15 , from: 6° 26´·492N., 3° 23´·828E.
to: 6° 26´·576N., 3° 23´·642E.
Delete
¶ Dir Oc(2)WRG.10s6M & Q.G.5M and associated sectors 6° 25´·345N., 3° 24´·362E.
3126 SAUDI ARABIA - Red Sea Coast - Depths.

Source: UKHO

3128* UNITED ARAB EMIRATES - Buoy.

Source: Port of Fujairah Harbour Master

Insert
G;Ff l.Y.10s 25° 11´·80N., 56° 23´·05E.

Insert
G;Ff l.Y.10s 25° 11´·80N., 56° 23´·05E.

Insert
G;Ff l.Y.10s 25° 11´·80N., 56° 23´·05E.
2.17
Wk26/20
II
3157* OMAN - Lights.

Source: UKHO

Delete
¶ Fl.R.5s7m5M & Fl.G.5s7m5M 25° 37´·24N., 56° 16´·60E.
3177* QATAR - Buoyage.

Source: Qatar Ministry of Transport and Communication and UKHO

Amend No 1 light-buoy to, Q(2)5s 26° 27´·21N., 51° 37´·69E.
No 2 light-buoy to, Q(2)5s 26° 26´·80N., 51° 37´·69E.
3176 INDIAN OCEAN - Seychelles - Wreck.

Source: Indian Notice 10/132/20

Replace
5)+ Wk with 4"+ Wk 4° 36´·33S., 55° 28´·51E.

Replace
5)+ Wk with 4"+ Wk 4° 36´·33S., 55° 28´·51E.
3145* SINGAPORE - Depths. Buoyage. Dredged depths. Rocks.

Source: Maritime and Port Authority of Singapore

Insert depth, 226 (a) 1° 13´·500N., 103° 39´·120E.
Amend dredged depth to, 18·7m (2019), centred on: 1° 13´·628N., 103° 40´·362E.
dredged depth to, 18·4m (2019), centred on: 1° 13´·653N., 103° 40´·410E.
Move
BdFl.R.2s Temasek from: 1° 13´·804N., 103° 39´·622E.
to: 1° 13´·782N., 103° 39´·500E.
GdFl(3)R.15s
\ F2-DDJV-4 from:
1° 14´·614N., 103° 39´·289E.
to: 1° 14´·536N., 103° 39´·139E.
GdFl(2)R.5s
\ F2-DDJV-3A from:
1° 15´·142N., 103° 39´·076E.
to: 1° 15´·075N., 103° 38´·883E.
GdF\ l.R.4s, F2-DDJV-3 from: 1° 15´·440N., 103° 38´·870E.

to: 1° 15´·380N., 103° 38´·740E.
2.18
Wk26/20
II
3145* SINGAPORE - Depths. Buoyage. Dredged depths. Rocks. (continued)

Insert depth, 226 (a) 1° 13´·500N., 103° 39´·120E.
Move
BdFl.R.2s Temasek , from: 1° 13´·804N., 103° 39´·622E.
to: 1° 13´·782N., 103° 39´·500E.
GdFl(3)R.15s
\ F2-DDJV-4, from:
1° 14´·614N., 103° 39´·289E.
to: 1° 14´·536N., 103° 39´·139E.
GdFl(2)R.5s
\ F2-DDJV-3A, from:
1° 15´·142N., 103° 39´·076E.
to: 1° 15´·075N., 103° 38´·883E.
GdFl.R.4s,
\ F2-DDJV-3, from:
1° 15´·440N., 103° 38´·870E.
to: 1° 15´·380N., 103° 38´·740E.

Insert
¯(5 ) 4
(a) 1° 14´·489N., 103° 45´·594E.
Delete
¯(5 ) close E of:
8
(a) above

Move
Gd\ Fl.R.4s F2-DDJV-3, from:
1° 15´·440N., 103° 38´·871E.
to: 1° 15´·380N., 103° 38´·740E.
GdF\ l(2)R.5s F2-DDJV-3A, from: 1° 15´·142N., 103° 39´·076E.

to: 1° 15´·075N., 103° 38´·883E.

Insert
¯(5 ) 4
(a) 1° 14´·489N., 103° 45´·594E.
Delete
¯(5 ) close E of:
8
(a) above
2.19
Wk26/20
II
3145* SINGAPORE - Depths. Buoyage. Dredged depths. Rocks. (continued)

Insert depth, 226 (a) 1° 13´·50N., 103° 39´·12E.
Move
to: 1° 13´·78N., 103° 39´·50E.
GdFl(3)R.15s
\ F2-DDJV-4, from:
1° 14´·61N., 103° 39´·29E.
to: 1° 14´·53N., 103° 39´·14E.
GdFl(2)R.5s
\ F2-DDJV-3A, from:
1° 15´·14N., 103° 39´·08E.
to: 1° 15´·08N., 103° 38´·88E.
GdFl.R.4s,
\ F2-DDJV-3, from:
1° 15´·44N., 103° 38´·87E.
to: 1° 15´·38N., 103° 38´·74E.
Delete
RFl.Y.8s BCA-B7A 1° 17´·49N., 103° 37´·02E.

Insert depth, 226 (a) 1° 13´·50N., 103° 39´·12E.

Insert depth, 226 (a) 1° 13´·50N., 103° 39´·12E.
Move
to: 1° 13´·78N., 103° 39´·50E.
GdFl(3)R.15s
\ F2-DDJV-4, from:
1° 14´·61N., 103° 39´·29E.
to: 1° 14´·53N., 103° 39´·14E.
GdF\ l(2)R.5s F2-DDJV-3A, from: 1° 15´·14N., 103° 39´·08E.

to: 1° 15´·08N., 103° 38´·88E.
GdFl.R.4s,
\ F2-DDJV-3, from:
1° 15´·44N., 103° 38´·87E.
to: 1° 15´·38N., 103° 38´·74E.
¯(5 ), with, ¯(5 )

8 4
1° 14´·48N., 103° 45´·59E.
Delete
RFl.Y.8s BCA-B7A 1° 17´·49N., 103° 37´·02E.

Insert depth, 124 (a) 1° 18´·24N., 103° 57´·32E.
Insert depth, 113 1° 18´·29N., 103° 57´·35E.
2.20
Wk26/20
II
3104 CHINA - South Coast - Obstruction.

Source: Chinese Notice 19/655/20
Chart 103 [ previous update 1850/20 ] CGCS 2000 DATUM

Insert
åUnexploded Ordnance PA 20° 06´·1N., 111° 11´·7E.

Insert

Insert
3106 CHINA - Bo Hai - Depths. Fish haven. Obstruction.


Insert
Á(4 ) 5
37° 31´·08N., 119° 17´·71E.
depth, 67, with seabed type, St 37° 32´·98N., 119° 21´·77E.
5%+ Obstn 37° 19´·80N., 119° 35´·78E.

depth, 6 37° 19´·80N., 119° 37´·24E.
depth, 62 37° 20´·41N., 119° 38´·28E.
3112 TAIWAN STRAIT - Light.

Source: UKHO

Amend light to, Oc.R.5s 24° 24´·47N., 118° 25´·42E.
3116 CHINA - East Coast - Wreck.


Insert
11Ó, Wk 30° 14´·7N., 122° 37´·2E.

Insert
11Ó, Wk 30° 14´·69N., 122° 37´·23E.
2.21
Wk26/20
II
3135 CHINA - Bo Hai - Buoyage. Wrecks.

Source: Chinese Notices 19/645-649/20
Note: Virtual Identification System, V-AIS, remains unchanged

Delete
GYo Fl(2)5s 38° 42´·30N., 120° 40´·99E.

Insert
´ 38° 33´·1N., 118° 51´·3E.
38° 49´·8N., 119° 07´·7E.
Delete
GYo Fl(2)5s 39° 15´·3N., 120° 11´·8E.
39° 22´·1N., 120° 33´·3E.
38° 59´·4N., 120° 31´·6E.
38° 42´·3N., 120° 41´·0E.

Insert
´ 38° 33´·1N., 118° 51´·3E.
38° 49´·8N., 119° 07´·7E.
Delete
GYo Fl(2)5s 39° 15´·4N., 120° 11´·8E.
38° 59´·4N., 120° 31´·6E.
38° 42´·3N., 120° 41´·0E.

Delete
GYo Fl(2)5s 38° 59´·4N., 120° 31´·6E.
38° 42´·3N., 120° 41´·0E.

Insert
´ 38° 49´·8N., 119° 07´·7E.
38° 33´·1N., 118° 51´·3E.
2.22
Wk26/20
II
3172 TAIWAN - Depths. Wreck.

Source: UKHO

Insert
´ (a) 24° 03´·10N., 120° 16´·80E.
Insert depth, 68, and extend 10m contour NW to enclose (c) 24° 02´·36N., 120° 18´·84E.
Insert depth, 88, and extend 10m contour NW to enclose 24° 01´·86N., 120° 18´·66E.
Replace depth, 4, enclosed by 5m contour with depth, 08, enclosed by
2m contour 24° 01´·61N., 120° 19´·26E.

Insert
´ (a) 24° 03´·10N., 120° 16´·80E.
Insert depth, 68, and extend 10m contour NW to enclose (c) 24° 02´·36N., 120° 18´·84E.
Insert depth, 88, and extend 10m contour NW to enclose 24° 01´·86N., 120° 18´·66E.
Replace depth, 4, enclosed by 5m contour with depth, 08, enclosed by
2m contour 24° 01´·61N., 120° 19´·26E.
3185 CHINA - South Coast - Depths. Wrecks.


Delete
´ PA 20° 58´·70N., 110° 37´·00E.

Insert depth, 99, with seabed type, R (a) 21° 05´·08N., 110° 33´·37E.
Delete depth, 97, close S of : (a) above
Replace
´ PA Rep (2017) with 1!+ Wk 21° 01´·62N., 110° 36´·53E.
Delete depth, 39, and associated 5m contour 21° 03´·07N., 110° 38´·44E.
depth, 33, and associated 5m contour 21° 02´·65N., 110° 38´·88E.
´ PA 20° 58´·70N., 110° 37´·00E.

Insert depth, 99, with seabed type, R (a) 21° 05´·08N., 110° 33´·37E.
Delete depth, 97, close S of: (a) above
2.23
Wk26/20
II
3186 CHINA - East Coast - Light-beacon.


Insert
TlMo(C)Y.12s7m3M
Ü 31° 33´·2N., 122° 06´·2E.
3210 CHINA - East Coast - Wrecks. Depths. Obstruction.


Replace
´ Rep 2015 PA, with, 8%+ Wk 33° 40´·48N., 121° 02´·59E.

Replace depth, 141, with 13(, Obstn 33° 14´·01N., 120° 52´·74E.
3187 JAPAN - Seto Naikai - Light. Fixed point.

Source: Japanese Notice 22/405/20
Chart JP 104 [ previous update 317/20 ] WGS84 DATUM

Replace
¶ Fl G 5s 11m 5M with è G Lt 34° 12´ 20·0"N., 133° 07´ 19·0"E.

Delete
· Fl G 5s 5M 34° 12´·33N., 133° 07´·32E.

Delete
· Fl G 5s 5M 34° 12´·33N., 133° 07´·32E.
3188 JAPAN - Seto Naikai - Fish haven.


Insert
Á 34° 14´ 01·1"N., 133° 03´ 36·5"E.

Insert
Á 34° 14´·02N., 133° 03´·61E.

Insert
Á 34° 14´·02N., 133° 03´·61E.
2.24
Wk26/20
II
3189 JAPAN - Seto Naikai - Lights.


Insert
è (R Lt) 34° 13´ 14·8"N., 133° 03´ 51·7"E.
è (Y Lt) 34° 13´ 14·1"N., 133° 03´ 55·1"E.

34° 13´ 08·5"N., 133° 03´ 58·1"E.


Insert
Á 34° 01´·45N., 133° 02´·91E.

Insert
Á 34° 01´·45N., 133° 02´·91E.
3191 JAPAN - Seto Naikai - Breakwaters. Fixed points.


Insert breakwater, single firm line, joining: 34° 15´·06N., 132° 29´·76E.
34° 15´·02N., 132° 29´·72E.
and
34° 15´·01N., 132° 29´·75E.
34° 14´·98N., 132° 29´·71E.

Insert breakwater, double firm line, width 5m, joining: 34° 15´ 03·5"N., 132° 29´ 45·6"E.
(a) 34° 15´ 01·3"N., 132° 29´ 43·0"E.
and
(b) 34° 15´ 00·5"N., 132° 29´ 45·2"E.
(c) 34° 14´ 58·5"N., 132° 29´ 42·6"E.
è R Lt (a) above
è Y Lt (b) above
(c) above
3192 JAPAN - Seto Naikai - Fish havens.


Insert
Á (a) 34° 10´·25N., 132° 25´·68E.
Delete
Á, close NW of: (a) above
2.25
Wk26/20
II
3193 JAPAN - Seto Naikai - Submarine power cables.

Note: Former Notice 2942(P)/20 is cancelled.

Insert submarine power cable, ÉÊÉ, joining: 34° 19´·08N., 132° 18´·71E.
34° 19´·00N., 132° 18´·70E.
34° 18´·28N., 132° 19´·48E.
(a) 34° 18´·27N., 132° 19´·52E.
Delete former submarine power cable, ÉÊÉ, joining: 34° 19´·07N., 132° 18´·65E.
34° 18´·86N., 132° 18´·71E.
34° 18´·27N., 132° 19´·44E.
(a) above
Chart JP 1112B [ previous update 6610/19 ] WGS84 DATUM

Insert submarine power cable, ÉÊÉ, joining: 34° 19´ 04·5"N., 132° 18´ 42·4"E.
34° 18´ 59·8"N., 132° 18´ 42·2"E.
34° 18´ 16·8"N., 132° 19´ 28·5"E.
34° 18´ 16·1"N., 132° 19´ 31·5"E.
Delete former submarine power cable, ÉÊÉ, joining: 34° 19´ 04·2"N., 132° 18´ 39·2"E.
34° 18´ 51·6"N., 132° 18´ 42·4"E.
34° 18´ 16·5"N., 132° 19´ 26·3"E.
34° 18´ 15·9"N., 132° 19´ 31·5"E.
3194 JAPAN - Seto Naikai - Piles. Legend.

Note: Former Notice 2702(P)/20 is cancelled

Insert symbol, dotted line, joining: 34° 16´·96N., 132° 17´·10E.
(a) 34° 17´·04N., 132° 17´·12E.
34° 17´·08N., 132° 17´·18E.
34° 17´·11N., 132° 17´·26E.
legend, Piles, close NW of: (a) above
2.26
Wk26/20
II
3195 JAPAN - Seto Naikai - Submarine pipeline. Legend.

Note: Former Notice 2943(P)/20 is cancelled.

Insert submarine pipeline, È, joining: 33° 56´·66N., 132° 21´·24E.
33° 56´·70N., 132° 21´·37E.
(a) 33° 56´·73N., 132° 21´·96E.
(b) 33° 55´·89N., 132° 22´·76E.
33° 55´·56N., 132° 22´·84E.
legend, Water, along: (a)-(b) above

(a) 33° 56´·73N., 132° 21´·97E.
(b) 33° 55´·88N., 132° 22´·77E.
33° 55´·57N., 132° 22´·83E.

(a) 33° 56´·73N., 132° 21´·97E.
(b) 33° 55´·88N., 132° 22´·77E.
33° 55´·57N., 132° 22´·83E.
3196 JAPAN - Seto Naikai - Breakwaters.


Insert breakwater, single firm line, joining: 33° 56´·05N., 132° 24´·36E.
33° 56´·00N., 132° 24´·32E.
and
33° 55´·92N., 132° 24´·30E.
33° 55´·86N., 132° 24´·22E.
and
33° 55´·54N., 132° 22´·78E.
33° 55´·58N., 132° 22´·75E.
and
33° 55´·51N., 132° 22´·73E.
33° 55´·50N., 132° 22´·61E.
33° 55´·52N., 132° 22´·48E.
33° 55´·58N., 132° 22´·36E.
2.27
Wk26/20
II


Insert
Á 33° 40´·46N., 132° 36´·69E.

Insert
Á 33° 40´·46N., 132° 36´·69E.
3198 JAPAN - Seto Naikai - Landmark.


Delete
è Chy (203) 33° 15´·63N., 131° 41´·56E.

Delete
è Chy (203) 33° 15´·63N., 131° 41´·56E.
Chart JP 1247A [ previous update 3023/19 ] WGS84 DATUM

Delete
Í (203) 33° 15´ 39·5"N., 131° 41´ 35·3"E.
Chart JP 1247B [ previous update 4725/19 ] WGS84 DATUM

Delete
Í (203) 33° 15´ 39·5"N., 131° 41´ 35·3"E.
3199 JAPAN - Seto Naikai - Lights.


Amend range of light to, 10M 33° 16´·57N., 131° 42´·67E.

Chart JP 1247A [ previous update 3198/20 ] WGS84 DATUM

Amend range of light to, 10M 33° 16´ 34·3"N., 131° 42´ 40·4"E.
light to, Mo(U) R 12s 33° 16´ 37·9"N., 131° 42´ 33·7"E.
33° 16´ 29·8"N., 131° 42´ 47·1"E.
2.28
Wk26/20
II
3200 JAPAN - Kyūshū - Overhead cable. Vertical clearance.


Insert overhead power cable, pecked line, joining: (a) 33° 05´·86N., 132° 00´·26E.
(b) 33° 05´·72N., 132° 00´·08E.
symbol, vertical clearance 11m, along: (a)-(b) above
3124 KOREA - West Coast - Light.

Source: Korean Notice 21/318/20

3125 KOREA - South Coast - Light.


Insert
¶ Fl.G.5s7M 35° 01´·34N., 128° 43´·26E.
3154 KOREA - South Coast - NM Block.


3214 KOREA - South Coast - Light.

Chart 1259 (Panel B, Busan) [ previous update 2492/20 ] WGS84 DATUM

Insert
·F.G & F.R (Traffic Sig) 35° 05´·15N., 129° 01´·85E.
3120 MALAYSIA - Sabah - Restricted area.

Source: Malaysian Notice 4/66/20

Insert limit of restricted area, Ç, joining: (a) 6° 05´·00N., 116° 05´·62E.
(b) 6° 04´·55N., 116° 05´·62E.
(c) 6° 04´·55N., 116° 05´·92E.
(d) 6° 05´·00N., 116° 05´·92E.
symbol, Å, within: (a)-(d) above
2.29
Wk26/20
II
3162 EAST TIMOR - NM Blocks. Depths.

Source: Australian Notice 11/415/20
Chart Aus 311 [ previous update 1511/20 ] WGS84 DATUM

Insert the accompanying block, centred on: 8° 36´·4S., 127° 20´·2E.
Delete depth, 1752 9° 04´·7S., 127° 15´·0E.
depth, 1918 9° 06´·0S., 127° 12´·3E.
depth, 2023 9° 07´·9S., 127° 15´·0E.
depth, 1900 9° 08´·2S., 127° 12´·5E.
depth, 1939 9° 10´·9S., 127° 12´·8E.
depth, 2955 9° 15´·2S., 127° 13´·9E.
2000m contour, joining: 9° 06´·4S., 127° 16´·7E.
9° 09´·5S., 127° 13´·6E.
9° 13´·3S., 127° 11´·0E.

Insert the accompanying block A, centred on: 8° 44´·8S., 127° 13´·0E.
the accompanying block B, centred on: 9° 14´·5S., 127° 11´·2E.

Insert depth, 112, enclosed by 200m contour 8° 26´·9S., 127° 23´·1E.


3221 INDONESIA - Jawa - Depths.

Source: Indonesian Chart 90

Insert depth, 184, and extend 20m contour NE to enclose (a) 7° 44´·42S., 114° 19´·65E.
Chart 3726 (Panel, Selat Bali) [ previous update 2872/20 ] WGS84 DATUM
Insert depth, 112, and extend 20m contour E to enclose (a) 8° 11´·68S., 114° 24´·13E.

Insert depth, 184, and extend 20m contour NE to enclose (a) 7° 44´·42S., 114° 19´·65E.
3229 PHILIPPINE ISLANDS - Luzon - Light.

Source: Philippines Notice 4/13/20 and NAMRIA

Amend light to, Fl.5s41m17M 12° 49´·88N., 123° 47´·52E.
2.30
Wk26/20
II
3234 INDONESIA - Jawa - Wrecks.

Source: Indonesian Notices 21/245-247/20
Note: Former Notice 2859(P)/20 is cancelled
Chart 932 (Panel B, Approaches to Pelabuhan Tanjungpriok) [ previous update New Edition 11/06/2020 ] WGS84
DATUM
Insert
7(+ Wk (a) 6° 03´·20S., 106° 52´·37E.
Delete
´ close W of: (a) above
Replace
® with 4Ó+ Wk 6° 04´·07S., 106° 53´·85E.
Delete
´ 6° 04´·15S., 106° 52´·40E.
3237 INDONESIA - Java Sea - Depths.

Source: Indonesian Chart 64

Insert depth, 197, enclosed by 20m contour (a) 2° 44´·8S., 107° 14´·6E.


3169 AUSTRALIA - Northern Territory - Wrecks.


Move
5#+ Wk, from: 12° 28´·356S., 130° 50´·618E.
to: 12° 28´·346S., 130° 50´·603E.
Replace symbol, wreck with depth, 121, with symbol, wreck with depth,
124 12° 29´·270S., 130° 49´·110E.

Move
5#+ Wk, from: 12° 28´·356S., 130° 50´·618E.
to: 12° 28´·346S., 130° 50´·603E.
Replace
16&, Wk with 15#, Wk 12° 29´·350S., 130° 52´·370E.
3#+ Wk with 4+ Wk 12° 29´·740S., 130° 53´·820E.
2.31
Wk26/20
II
3174 AUSTRALIA - New South Wales - Wreck.


Insert
10, Wk 33° 48´·28S., 151° 13´·80E.
3179 AUSTRALIA - New South Wales - Light.


Amend light to, Fl(3)14M & F.Bu 29° 25´·95S., 153° 21´·84E.

Amend light to, Fl(3)14M & F.Bu 29° 25´·91S., 153° 21´·91E.
3180 PAPUA NEW GUINEA - Legends.


Amend legend to, PNG 652 2° 38´·6S., 141° 19´·0E.
3° 04´·5S., 142° 32´·7E.
3° 28´·8S., 141° 37´·2E.
3° 31´·6S., 141° 43´·2E.
3181 AUSTRALIA - Queensland - Buoyage.


Move
DfFl.Y.3s FAD, from: 26° 44´·98S., 153° 27´·66E.
to: 26° 44´·76S., 153° 27´·19E.

Insert
DfFl.Y.3s FAD 26° 15´·56S., 153° 19´·75E.
Delete former DfFl.Y.3s FAD
26° 19´·87S., 153° 19´·28E.
Move
to: 26° 32´·15S., 153° 34´·43E.

to: 26° 44´·76S., 153° 27´·19E.
2.32
Wk26/20
II
3184 AUSTRALIA - Victoria - Restricted areas.


Delete limit of restricted area, Ç, centred on: 38° 15´·0S., 147° 29´·1E.
38° 41´·7S., 148° 44´·8E.

Delete limit of restricted area, Ç, centred on: 38° 15´·0S., 147° 29´·1E.
38° 41´·7S., 148° 44´·8E.
3220 AUSTRALIA - Victoria - Buoy.


Move
DfFl.Y.5s,
; from:
38° 01´·80S., 145° 02´·39E.
to: 38° 01´·60S., 145° 03´·20E.

Insert
DfF; l.Y.5s 38° 01´·60S., 145° 03´·20E.
Delete
DfF; l.Y.5s 38° 01´·80S., 145° 02´·39E.
3225 AUSTRALIA - Tasmania - Wreck. Buoy.


Insert
12,û Wk PA (a) 43° 07´·66S., 147° 20´·01E.
symbol, blue and yellow spar buoy, out of position (a) above

Insert symbol, blue and yellow spar buoy 43° 07´·66S., 147° 20´·01E.
2.33
Wk26/20
II
3105 NEW ZEALAND - South Island - Marine farms. Notes. NM Block.

Source: New Zealand Notice 11/44/20
Chart NZ 61 [ previous update New Edition 01/07/2019 ] WGS84 DATUM

Insert the accompanying block, centred on: 40° 42´·5S., 172° 47´·5E.
Ì 41° 00´·84S., 173° 05´·57E.

41° 04´·15S., 173° 07´·70E.
41° 08´·28S., 173° 11´·50E.
Replace the existing note with the accompanying note, MARINE
FARMS, centred on: 41° 04´·74S., 172° 29´·06E.
Delete limit of marine farm, pecked line, joining: 41° 05´·32S., 173° 06´·52E.
41° 04´·10S., 173° 05´·51E.
and
(a) 41° 03´·32S., 173° 07´·21E.
(b) 41° 04´·55S., 173° 08´·23E.
(c) 41° 05´·60S., 173° 05´·91E.
(d) 41° 04´·38S., 173° 04´·89E.
Ì, within: (a)-(d) above
Chart NZ 6142 [ previous update 2843/20 ] WGS84 DATUM

Insert limit of marine farm, pecked line, joining: (a) 41° 07´·90S., 173° 11´·25E.
(b) 41° 08´·33S., 173° 11´·96E.
(c) 41° 09´·05S., 173° 11´·16E.
(d) 41° 08´·95S., 173° 11´·00E.
Ì(see Note), within: (a)-(d) above

the accompanying note, MARINE FARMS, centred on: 41° 15´·63S., 173° 26´·35E.
3144 UNITED STATES OF AMERICA - West Coast - Legend. Dolphin. Floating dock.
Source: ENC US5WA15M
Chart 50 [ previous update 4749/19 ] NAD83 DATUM

Insert legend, Under Construction (2020), centred on: 47° 36´·117N., 122° 20´·285W.
ÿ 47° 35´·322N., 122° 21´·118W.

Delete floating dock, centred on: 47° 35´·262N., 122° 21´·341W.
3171 ECUADOR - Depths. Rocks.

Source: ENC EC510701

Insert
²(3 )8
2° 44´·76S., 80° 16´·80W.
²(3 )5
(a) 2° 44´·52S., 80° 16´·96W.
Delete depth, 48, and associated 5m contour, close W of: (a) above
Replace depth, 153, with depth, 161 2° 41´·53S., 80° 14´·77W.
2.34
Wk26/20
II
3107 WEST INDIES - Leeward Islands - Depths.

Source: Cefas
Chart 254 (Panel B, Barbuda) [ previous update 2064/19 ] WGS84 DATUM

Insert depth, 33, enclosed by 5m contour (a) 17° 44´·25N., 61° 54´·44W.
Insert depth, 72, and extend 10m approximate contour NE to enclose (b) 17° 43´·76N., 61° 48´·39W.
Delete depth , 165, close N of: (b) above
depth, 183, close E of: (b) above
Insert depth, 54, and extend 10m approximate contour NW to enclose(c) 17° 37´·50N., 61° 53´·13W.
Delete depth, 82, close SE of: (c) above
depth, 101, close N of: (c) above
Insert depth, 74, enclosed by 10m contour (d) 17° 34´·24N., 61° 50´·51W.
Delete depth, 11, close SW of: (d) above

Insert depth, 8, and extend 10m contour SE to enclose (a) 17° 00´·70N., 61° 42´·78W.
depth, 105, and extend 20m contour S to enclose 17° 01´·53N., 61° 40´·69W.
depth, 129, and extend 20m contour E to enclose 17° 04´·05N., 61° 38´·89W.
depth, 141, and extend 20m contour W to enclose 17° 12´·51N., 61° 43´·39W.
depth, 106 (b) 17° 12´·22N., 61° 45´·73W.
Delete depth, 183, close E of: (b) above
depth, 54, and extend 10m approximate contour W to enclose (c) 17° 37´·50N., 61° 53´·13W.
Delete depth, 82, close SE of: (c) above
Delete depth, 73, close E of: (d) above
Insert depth, 72, and extend 10m approximate contour NE to enclose (e) 17° 43´·76N., 61° 48´·39W.
Delete depth, 183, close E of: (e) above

Insert depth, 106 (a) 17° 12´·22N., 61° 45´·73W.
Insert depth, 141, and extend 20m contour SW to enclose 17° 12´·51N., 61° 43´·39W.
depth, 105, and extend 20m contour S to enclose 17° 01´·53N., 61° 40´·69W.
depth, 8, and extend 10m contour E to enclose (b) 17° 00´·70N., 61° 42´·78W.
2.35
Wk26/20
II
3107 WEST INDIES - Leeward Islands - Depths. (continued)

depth, 54 17° 37´·5N., 61° 53´·1W.
depth, 74, and extend 10m contour S to enclose (a) 17° 34´·2N., 61° 50´·5W.
Insert depth, 13, and extend 20m contour S to enclose (b) 17° 07´·2N., 61° 39´·7W.
Delete depth, 183, close N of: (b) above
Insert depth, 129, and extend 20m contour E to enclose 17° 04´·0N., 61° 38´·9W.
depth, 105, and extend 20m contour S to enclose (c) 17° 01´·5N., 61° 40´·7W.
Delete depth, 128, close N of: (c) above
Delete depth, 25, close N of: (d) above
Insert depth, 8 (e) 17° 00´·7N., 61° 42´·8W.
Delete depth, 88, close W of: (e) above

Insert depth, 106 (a) 17° 12´·22N., 61° 45´·73W.
Delete depth, 31, and associated 30m contour, close SW of: (b) above
depth, 105, enclosed by 20m approximate contour (c) 17° 01´·53N., 61° 40´·69W.
Delete depth, 40, close SW of: (d) above
Insert depth, 8, and extend 10m contour SE to enclose (e) 17° 00´·70N., 61° 42´·78W.
Delete depth, 88, close NW of: (e) above
depth, 11, close N of: (e) above
depth, 11, close S of: (e) above

Insert depth, 106 (a) 17° 12´·22N., 61° 45´·73W.
Delete depth, 31, and associated 30m contour, close SW of: (b) above
3118 VENEZUELA - Depths.

Source: ENC VE500319

Insert depth, 24 (a) 10° 31´·35N., 68° 05´·53W.
Insert depth, 295 (b) 10° 31´·96N., 68° 04´·97W.
Delete depth, 32, close NE of: (b) above
2.36
Wk26/20
II
3155 WEST INDIES - Windward Islands - Wreck.

Source: French Notice 21/260/20

Insert
´ 14° 35´·178N., 61° 01´·710W.
3231 UNITED STATES OF AMERICA - Gulf of Mexico - Depths. Buoy.

Source: ENCs US4FL60M and US3GC06M

Insert depth, 1, enclosed by 6ft contour 29° 52´·75N., 85° 22´·91W.
depth, 2, enclosed by 6ft contour 29° 41´·39N., 85° 23´·26W.

Delete
GdFl.R.4s ’24’ 29° 51´·5N., 84° 10´·7W.
3142 UNITED STATES OF AMERICA - East Coast - Depths.

Source: ENC US4MD20M
Chart 2921 (Panel 1) [ previous update 2420/20 ] NAD83 DATUM

Insert depth, 21 38° 12´·56N., 76° 07´·34W.
depth, 17, and extend 18ft contour S to enclose 38° 12´·65N., 76° 08´·13W.
2.37
Wk26/20
II
3131(T)/20 SCOTLAND - East Coast - Scientific instruments. Buoyage.

Source: Natural Power
1. Scientific instruments, marked by light-buoys, have been established on the seabed in the following positions:
56° 15´·67N., 2° 16´·94W.

56° 16´·60N., 2° 17´·21W.
56° 17´·68N., 2° 15´·07W.
56° 19´·99N., 2° 14´·42W.
2. Mariners are advised to navigate with caution in the area.
(ETRS89 DATUM)
Charts affected - 175 - 190 - 1407 (INT 1505)
3151(T)/20 ENGLAND - East Coast - Buoyage.

Source: ABP Humber Notice 67/20
1. The west cardinal light-buoy Q(9)15s Mid New Sand, in position 53° 36´·72N., 0° 21´·19E. has been temporarily replaced
with a red lateral light-buoy, Q.R.
(ETRS89 DATUM)
Charts affected - 104 (INT 1566) - 107 - 1190 (INT 1508)
3165(T)/20 ENGLAND - South Coast - Wreck.

Source: UKHO
1. A wreck has been reported in position 50° 38´·49N., 0° 52´·27W.
(ETRS89 DATUM)
Charts affected - 2045 - 2450 (INT 1703)
3173(T)/20 ENGLAND - West Coast - Buoyage.

Source: Ørsted
1. The following light-buoys have been reported unlit:
Characteristic Buoy Type Position

* Q(6)+LFl.15s South Cardinal 54° 03´·42N., 3° 44´·99W.
Q(9)15s West Cardinal 54° 06´·63N., 3° 55´·34W.
VQ(6)+LFl.10s South Cardinal 54° 00´·21N., 3° 34´·66W.
2. Former Notice 1116(T)/20 is cancelled.
*Indicates new or revised entry
(ETRS89 DATUM)
Charts affected - 1320 - 1826 (INT 1607)
2.38
Wk26/20
II
3219(T)/20 ENGLAND - South Coast - Scientific instruments.

Source: ABP Southampton Notice 22(T)/20
1. Scientific instruments have been deployed on the seabed in the following positions:
50° 47´·073N., 1° 19´·372W.

50° 46´·432N., 1° 17´·569W.
(ETRS89 DATUM)
Charts affected - 2036 (INT 1730) - 2038 - 2793
3233(P)/20 SCOTLAND - Firth of Clyde - Works. Lights.

Source: Queen’s Harbour Master, Clyde
1. Works are taking place to establish new aids to navigation in the approaches to Glenmallan Jetty. As part of these works,
the following lights have been temporarily established on piles:
Characteristic Designation Position

Fl(2)6s Mallan No 1 56° 06´·800N., 4° 51´·098W.
Fl(2)6s Mallan No 2 56° 07´·199N., 4° 49´·583W.
Fl(2)6s Mallan No 3 56° 07´·52N., 4° 49´·22W.
Fl(2)6s Cnap Point 56° 07´·375N., 4° 50´·194W.
2. Chart 3746 will be updated when full details are available.
(ETRS89 DATUM)
Chart affected - 3746 (INT 1635)
3130(T)/20 DENMARK - East Coast - Wreck. Buoy.

1. A wreck, depth 12m, marked by an emergency wreck marking light-buoy, Al.Oc.BuY.3s, exists in position
56° 21´·25N., 11° 02´·41E.
(WGS84 DATUM)
Chart affected - X 2108 (INT 1302)
3137(T)/20 DENMARK - East Coast - Buoy.

Source: Danish Chart Corrections 20/281/20 and 20/291/20
1. The safe water pillar light-buoy, LFl.10s No 5, in position 56° 12´·73N., 11° 05´·54E. has been withdrawn.
(WGS84 DATUM)
Charts affected - X 2108 (INT 1302) - X 2589 (INT 1379)
3143(P)/20 SWEDEN - West Coast - Buoyage.

1. Changes to lateral buoyage have taken place in the entrance to the port of Varberg (57° 06´·725N., 12° 14´·374E.).
2.39
Wk26/20
II
3143(P)/20 SWEDEN - West Coast - Buoyage. (continued)
3. These changes will be included in a New Edition of Chart 874 to be published 9 July 2020.
(WGS84 DATUM)
3170(T)/20 DENMARK - East Coast - Buoy.

Source: Danish Chart Corrections 20/280/20 and 20/288/20
1. The safe water pillar light-buoy, Iso.4s No 7, in position 56° 50´·93N., 10° 48´·00E. has been withdrawn.
(WGS84 DATUM)
Charts affected - X 894 - X 2107 (INT 1301)
3150(T)/20 GERMANY - North Sea Coast - Buoy.

Source: German Notice 20/50(T)/20
1. The special light-buoy, Oc(2)9s, in position 54° 20´·6N., 6° 02´·9E. has been temporarily withdrawn.
(WGS84 DATUM)
Chart affected - DE 50 (INT 1045)
3228(P)/20 BELGIUM - Marine Reserves. Restricted areas. Mine laying practice area.
Source: Belgian Notices 7/137-141/20 and 7/143/20 and UKHO
1. A marine reserve area has been established, bounded by the following positions:
51° 31´·34N., 3° 08´·23E.

51° 29´·03N., 3° 12´·66E.
51° 26´·95N., 3° 17´·71E.
51° 26´·17N., 3° 18´·35E.
51° 25´·47N., 3° 11´·86E.
51° 30´·12N., 3° 06´·27E.
2. Marine reserve areas have been updated. The limits have been changed as follows:
Update Positions
Insert 51° 14´·51N., 2° 55´·46E.
51° 20´·70N., 2° 47´·01E.
51° 28´·86N., 2° 34´·68E.
Delete 51° 16´·70N., 2° 52´·46E.
51° 28´·86N., 2° 34´·68E.
Delete 51° 08´·25N., 2° 30´·32E.
51° 16´·75N., 2° 52´·54E.
51° 14´·47N., 2° 54´·99E.
3. A restricted area, anchoring and fishing prohibited, has been established, bounded by the following positions:
51° 17´·63N., 2° 37´·69E.

51° 17´·49N., 2° 38´·14E.
51° 16´·73N., 2° 37´·51E.
51° 16´·87N., 2° 37´·07E.
2.40
Wk26/20
II
3228(P)/20 BELGIUM - Marine Reserves. Restricted areas. Mine laying practice area. (continued)
4. The limits of a mine-laying practice area, NBH-10 (Wenduine), have been updated to the following positions:
Update Positions
Insert 51° 21´·00N., 2° 53´·00E.
51° 21´·00N., 2° 59´·49E.
51° 18´·53N., 2° 53´·00E.
Delete 51° 21´·00N., 2° 57´·10E.
51° 21´·00N., 3° 00´·70E.
51° 18´·70N., 2° 55´·80E.
51° 19´·80N., 2° 54´·50E.
5. A restricted area, entry prohibited, marine reserve, bounded by the following positions has been deleted:
51° 21´·63N., 3° 13´·25E.

51° 21´·60N., 3° 14´·20E.
51° 21´·35N., 3° 13´·97E.
51° 21´·09N., 3° 13´·60E.
7. These changes are included in a New Edition of Chart 1873 published 4 June 2020.
8. Charts 2449 and 1630 have been updated by Notice to Mariners.
9. Former notice 2317(P)/20 is cancelled.
10. NOTE: Content of Notice unchanged, re-issued to include Charts 1872 and 1874.
(WGS84 DATUM)
Chart affected - 8012
3109(P)/20 GREECE - Aegean Sea Coast - Legend.

Source: Greek Notice 4/52/20
1.
Update Feature Position

Insert legend, Works in progress (2020), centred on: 37° 56´·04N., 23° 37´·17E.
3147(P)/20 ISRAEL - Mediterranean Sea Coast - Works.

Source: Israeli Notices 116/17, 46/18 and UKHO
1. Works are in progress to dismantle the North Qishon Harbour breakwater 32° 49´·05N., 35° 01´·37E. These works are
marked by buoys.
2. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
3. Former Notice 2428(P)/18 is cancelled.
2.41
Wk26/20
II
3152(P)/20 EGYPT - North Coast - Works. Restricted area. Anchor berths.

Source: ENC EG5EGM18
1. Works are taking place in the vicinity of the Coal Basin within the Port of Alexandria.
2. A restricted area, entry prohibited, has been established bounded by the following positions:
31° 10´·793N., 29° 51´·713E.

31° 11´·302N., 29° 52´·139E.
31° 11´·242N., 29° 52´·273E.
31° 11´·060N., 29° 52´·516E.
31° 10´·543N., 29° 52´·082E.
3. The following anchor berths, and their associated swinging circles have been deleted:
Anchor berth Position

SA1 31° 10´·634N., 29° 52´·042E.
SA2 31° 10´·758N., 29° 52´·202E.
SA5 31° 10´·739N., 29° 51´·861E.
SA6 31° 10´·859N., 29° 52´·013E.
4. These and other changes will be included in the next New Editions of Chart 3119 and 8055.
(WGS84 DATUM)
Charts affected - 3119 (INT 3554) - 8055
3223(P)/20 NIGERIA - Lights.

Source: ENC NG525010
1.

Delete lights and associated sectors 6° 25´·345N., 3° 24´·362E.
3127(P)/20 SAUDI ARABIA - Red Sea Coast - General information.

Source: UKHO
1. Changes to aids to navigation at Jizan (16° 53´·43N., 42° 33´·20E.) have been reported.
2. Significant changes to aids to navigation for the southern approach, Pearly Gates (16° 19´·80N., 41° 52´·55E.), have also
been reported. Mariners are strongly advised to use the North Approach Route.
3. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
4. Charts 15 and 16 will be updated when full details are available.
(WGS84 DATUM)
Charts affected - 15 (INT 7154) - 16 (INT 7155)
3160(P)/20 UNITED ARAB EMIRATES - Lights.

Source: UKHO
1. The lights, Fl.R.5s7m5M and Fl.G.5s7m5M in position 25° 37´·24N., 56° 16´·60E. have been removed.
2.42
Wk26/20
II
3160(P)/20 UNITED ARAB EMIRATES - Lights. (continued)
2. These changes will be included in a New Edition of Chart 3171 to be published mid 2020.
3. Chart 3520 will be updated by Notice to Mariners.
(WGS84 DATUM)
3211(T)/20 BAHRAIN - Buoy.

Source: Pakistani Nav Warning 150/20
1. The safe water light-buoy, LFl.10s Bahrain, in position 26° 33´·00N., 51° 03´·58E. is reported to be unlit.
(WGS84 DATUM)
Charts affected - 2523 (INT 7250) - 2837 (INT 7017) - 2847 (INT 7018) - 2858 (INT 750) - 2886 (INT 7243) - 3738
(INT 7254) - 3790 (INT 7252) - 8043
3103(P)/20 INDIAN OCEAN - La Réunion - Submarine cable. Restricted area.

Source: French Notice 21/14(P)/20
1. A submarine cable has been laid joining the following positions:
21° 00´·28S., 55° 16´·37E.

21° 00´·20S., 55° 15´·82E.
21° 00´·00S., 55° 15´·50E.
20° 59´·47S., 55° 14´·90E.
2. The limits of the restricted area, anchoring prohibited, centred on position 20° 59´·48S., 55° 16´·22E. have been amended.
The new area is bounded by the following positions:
21° 00´·45S., 55° 15´·55E.

21° 00´·20S., 55° 16´·05E.
21° 00´·00S., 55° 16´·30E.
20° 59´·70S., 55° 16´·49E.
20° 59´·57S., 55° 16´·53E.
20° 59´·30S., 55° 16´·00E.
20° 59´·90S., 55° 15´·68E.
20° 59´·70S., 55° 15´·35E.
20° 59´·70S., 55° 14´·90E.
3. Charts 1495 and 1497 will be updated when full details are available.
(WGS84 DATUM)
Charts affected - 1495 (INT 7736) - 1497 (INT 7735)
3168(P)/20 INDIA - East Coast - Dredging area. Channel limits. Buoyage.

Source: Indian Notice 10/136(P)/20
1. Dredging is taking place on the southern side of the approach channel to Dhamra Port in order to widen the channel.
2. All port-hand buoys between No 2 in position 20° 54´·822N., 87° 06´·178E. and No 16 in position
20° 50´·978N., 86° 59´·478E. will not be in their charted positions.
2.43
Wk26/20
II
3168(P)/20 INDIA - East Coast - Dredging area. Channel limits. Buoyage. (continued)
3. Mariners are advised to navigate with caution in the area and to contact the local port authority for the latest information.
4. If necessary, charts will be updated when works are complete.
(WGS84 DATUM)
Charts affected - IN 3037 - IN 3038
3175(T)/20 BURMA - Wreck.

Source: Myanmar Navy Notice 18/20
1. A dangerous wreck has been reported in position 16° 22´·00N., 96° 21´·00E.
(WGS84 DATUM)
Charts affected - 823 (INT 7438) - 826 (INT 7441) - 833 (INT 7442)
3141(T)/20 SINGAPORE - Obstruction.

1. An obstruction, depth 5·6m, exists in position 1° 15´·798N., 103° 49´·076E.
(WGS84 DATUM)
Charts affected - 4035 - 4040 - 4041
3146(P)/20 SINGAPORE - Dredged depths.

1.

Amend dredged depth to, 18·4m, centred on: 1° 13´·66N., 103° 40´·40E.
dredged depth to, 18·7m, centred on: 1° 13´·63N., 103° 40´·36E.
3164(T)/20 SINGAPORE STRAIT - Wrecks.

Source: Indonesian Notices 21/250-251/20 and UKHO
1. Stranded wrecks have been reported to exist in the following positions:
1° 11´·283N., 103° 52´·867E.

1° 07´·530N., 103° 41´·929E.
(WGS84 DATUM)
Charts affected - 3833 - 4039 - 4040 - 4041
2.44
Wk26/20
II
3108(P)/20 CHINA - Bo Hai - Obstructions.

1.

Delete obstruction 39° 55´·27N., 119° 39´·83E.
39° 55´·16N., 119° 39´·71E.
3122(P)/20 CHINA - South Coast - Marine Reserve. Buoyage. Depths. Obstruction.

Source: Hong Kong Notices 10/21-25/20
1. Southwest Lantau Marine Park has been established, marked by yellow light-buoys, in areas bounded by the following
positions:
22° 13´·03N., 113° 50´·31E.

22° 14´·11N., 113° 50´·31E.
22° 14´·11N., 113° 49´·73E.
22° 14´·00N., 113° 49´·68E.
22° 13´·03N., 113° 49´·90E.
22° 12´·09N., 113° 50´·11E.
22° 11´·80N., 113° 50´·69E.
22° 13´·02N., 113° 50´·31E.
and
22° 11´·81N., 113° 50´·86E.
22° 11´·76N., 113° 51´·34E.
22° 12´·02N., 113° 53´·00E.
22° 12´·23N., 113° 53´·00E.
22° 13´·15N., 113° 52´·97E.
2. The 6·5m obstruction in position 22° 18´·65N., 113° 50´·06E., is now 6·3m.
3. Shoal depths exist as follows:
Depth Position
8m 22° 14´·83N., 114° 07´·35E.
6·4m 22° 14´·94N., 114° 05´·89E.
6m 22° 14´·69N., 114° 05´·42E.
6·5m 22° 14´·21N., 114° 04´·72E.
5. These changes will be included in New Editions of charts 4129 and 341 to be published mid 2020.
(WGS84 DATUM)
Charts affected - 341 - 4129
2.45
Wk26/20
II
3167(P)/20 TAIWAN - Depths.

Source: : Taiwanese Chart 353
1. Depths less than charted exist within Chi-Lung Port. The most significant are as follows:
Depth (m) Position

9·5 25° 09´·551N., 121° 45´·000E.
2·8 25° 09´·380N., 121° 45´·058E.
2. Alongside depths within Chi-Lung Port have changed. The most significant are as follows:
Depth (m) Position

7·6 25° 09´·043N., 121° 44´·689E.
6·9 25° 08´·735N., 121° 45´·600E.
11·7 25° 08´·582N., 121° 45´·418E.
11·7 25° 08´·511N., 121° 45´·288E.
4·5 25° 08´·435N., 121° 44´·561E.
(WGS84 DATUM)
3222(P)/20 TAIWAN - Buoyage. Anchorage areas. Works.

Source: UKHO
1. Windfarm construction works are taking place within areas bounded by the following positions:
23° 57´·90N., 120° 12´·78E.

23° 57´·18N., 120° 14´·16E.
24° 00´·29N., 120° 16´·08E.
24° 01´·01N., 120° 14´·70E.
and
23° 52´·16N., 120° 05´·63E.

23° 51´·98N., 120° 05´·99E.
23° 51´·62N., 120° 08´·29E.
23° 55´·68N., 120° 11´·22E.
23° 56´·07N., 120° 08´·83E.
and
23° 31´·15N., 119° 59´·48E.

23° 31´·93N., 120° 01´·97E.
23° 33´·63N., 120° 03´·31E.
23° 39´·20N., 120° 04´·11E.
23° 39´·17N., 120° 01´·93E.
23° 37´·50N., 120° 00´·14E.
23° 33´·46N., 119° 59´·45E.
and
23° 57´·02N., 119° 51´·32E.

24° 02´·67N., 119° 55´·67E.
24° 02´·55N., 119° 40´·89E.
24° 01´·82N., 119° 40´·58E.
2. Some of the construction areas are marked by buoyage.
3. A cable laying area has been established between the following positions:
23° 57´·56N., 120° 12´·96E.

23° 56´·44N., 120° 18´·27E.
2.46
Wk26/20
II
3222(P)/20 TAIWAN - Buoyage. Anchorage areas. Works. (continued)
4. A pre-laid mooring anchor for jacket offloading activities, radius approximately 750m (0·4M), has been established in
position: 23° 59´·54N., 120° 13´·63E.
5. Temporary anchorages, associated with the windfarm construction have been established in the following positions:
23° 58´·60N., 120° 12´·80E.

24° 00´·90N., 120° 14´·20E.
23° 58´·60N., 120° 15´·40E.
7. Charts will be updated when full details are available.
(WGS84 DATUM)
Charts affected - 1760 - 2409 - 3231
3201(T)/20 JAPAN - Hokkaidō - Works.

Source: Japanese Notice 22/5264(T)/20
1. Submarine power cable inspection works are taking place, until 31 July 2020, within an area bounded by the following
positions:
41° 40´·6N., 140° 43´·9E.

41° 40´·6N., 140° 46´·4E.
41° 35´·1N., 140° 46´·4E.
41° 34´·4N., 140° 47´·1E.
41° 33´·6N., 140° 46´·0E.
41° 32´·5N., 140° 45´·6E.
41° 34´·4N., 140° 43´·9E.
(WGS84 DATUM)
Charts affected - JP 10 - JP 1195
3202(P)/20 JAPAN - Honshū - Submarine power cable.

Source: Japanese Notice 22/5265(P)/20
1. A submarine power cable has been laid, joining the following positions:
34° 05´·28N., 130° 52´·73E.

34° 05´·09N., 130° 52´·56E.
34° 04´·60N., 130° 51´·64E.
34° 04´·52N., 130° 51´·06E.
34° 04´·51N., 130° 50´·22E.
34° 05´·03N., 130° 47´·61E.
34° 05´·22N., 130° 47´·46E.
34° 05´·83N., 130° 47´·47E.
34° 06´·00N., 130° 47´·52E.
3. Charts will be updated by Notice to Mariners.
(WGS84 DATUM)
Charts affected - JP 179 - JP 201 - JP 1266
2.47
Wk26/20
II
3203(T)/20 JAPAN - Honshū - Works.

1. Breakwater restoration works are taking place, until 30 October 2020, within an area bounded by the following positions:
36° 46´ 57"N., 137° 06´ 46"E.

36° 46´ 52"N., 137° 06´ 53"E.
36° 46´ 59"N., 137° 06´ 54"E.
36° 47´ 00"N., 137° 06´ 48"E.
(WGS84 DATUM)
Chart affected - JP 1162B

1. Breakwater construction works are taking place, until 4 December 2020, within an area bounded by the following positions:
37° 58´ 05·0"N., 139° 04´ 11·0"E.

37° 58´ 01·8"N., 139° 04´ 22·6"E.
37° 57´ 52·6"N., 139° 04´ 18·6"E.
37° 57´ 55·8"N., 139° 04´ 07·0"E.
(WGS84 DATUM)
Chart affected - JP 1155A

1. Dredging works are taking place, until 30 July 2020, within an area bounded by the following positions:
34° 49´ 29·5"N., 136° 56´ 45·7"E.

34° 49´ 26·7"N., 136° 56´ 41·1"E.
34° 49´ 44·1"N., 136° 56´ 42·7"E.
34° 49´ 44·7"N., 136° 56´ 34·1"E.
34° 49´ 00·5"N., 136° 56´ 30·0"E.
34° 49´ 00·0"N., 136° 56´ 38·6"E.
34° 49´ 09·1"N., 136° 56´ 39·5"E.
(WGS84 DATUM)
Chart affected - JP 1056
2.48
Wk26/20
II
3206(T)/20 JAPAN - Seto Naikai - Works.

1. Dumping works are taking place, until 20 August 2020, within an area bounded by the following positions:
34° 29´ 32·3"N., 135° 22´ 00·8"E.

34° 29´ 36·0"N., 135° 22´ 01·8"E.
34° 29´ 52·6"N., 135° 22´ 01·7"E.
34° 29´ 59·2"N., 135° 21´ 30·2"E.
34° 29´ 21·4"N., 135° 21´ 18·7"E.
34° 29´ 13·8"N., 135° 21´ 55·2"E.
(WGS84 DATUM)
3207(T)/20 JAPAN - Seto Naikai - Works.

1. Dredging works are taking place, until 31 July 2020, within an area bounded by the following positions:
34° 33´ 21"N., 135° 22´ 09"E.

34° 33´ 21"N., 135° 22´ 20"E.
34° 33´ 14"N., 135° 22´ 38"E.
34° 33´ 10"N., 135° 22´ 36"E.
34° 33´ 10"N., 135° 22´ 25"E.
34° 33´ 17"N., 135° 22´ 09"E.
(WGS84 DATUM)
3208(T)/20 JAPAN - Seto Naikai - Depths.

1. Depths less than charted exist in the following positions:
Depth Position
12m 33° 48´ 12·7"N., 131° 01´ 35·7"E.
12·2m 33° 48´ 11·1"N., 131° 01´ 37·6"E.
11·7m 33° 48´ 09·7"N., 131° 01´ 24·9"E.
(WGS84 DATUM)
2.49
Wk26/20
II
3209(T)/20 JAPAN - Kyūshū - Works.

1. Construction works are taking place, until 30 March 2021, on and in the vicinity of a line joining the following positions:
31° 32´ 42·9"N., 130° 33´ 03·4"E.

31° 32´ 37·3"N., 130° 33´ 14·5"E.
31° 32´ 44·2"N., 130° 33´ 31·6"E.
(WGS84 DATUM)
Charts affected - JP 214A - JP 214B
3133(T)/20 KOREA - West Coast - Buoyage.

Source: Korean Notice 21/327(T)/20
1. The following special mark light-buoys, Fl(4)Y.8s, have been temporarily moved to the following positions:
Designation Former Position New Position

A 37° 04´·83N., 126° 08´·11E. 37° 06´·05N., 126° 11´·07E.
B 37° 04´·27N., 126° 08´·68E. 37° 05´·45N., 126° 11´·07E.
C 37° 03´·20N., 126° 07´·40E. 37° 04´·70N., 126° 10´·07E.
D 37° 03´·38N., 126° 07´·22E. 37° 06´·05N., 126° 08´·95E.
(WGS84 DATUM)
3163(T)/20 AUSTRALIA - Western Australia - Works.

Source: Australian Notice 11/436(T)/20
1. MV Skandi Singapore and support vessels will be conducting subsea operations in positions 20° 06´·9S., 115° 02´·4E. and
20° 08´·9S., 115° 02´·5E.
2. Clearance of 0·27M is requested.
(WGS84 DATUM)
Charts affected - 4723 (INT 723) - Aus 328
3166(T)/20 AUSTRALIA - Tasmania - Pipe. Buoyage.

1. A floating pipeline marked by red buoys exists in the vicinity of position 42° 49´·75S., 147° 19´·02E.
2. *A special light-buoy, Fl.3s, exists in position 42° 49´·74S., 147° 19´·03E.
* Indicates new or revised entry.
(WGS84 DATUM)
Chart affected - Aus 172
2.50
Wk26/20
II
3213(T)/20 AUSTRALIA - Western Australia - Platform.

1. Drill rig, Ocean Onyx, is moored in position 37° 58´·73S., 144° 46´·54E.
2. A 500m exclusion zone exists around the drill rig.
(WGS84 DATUM)
Charts affected - Aus 143 - Aus 155
3215(T)/20 AUSTRALIA - Tasmania - Works.

1. Works associated with the construction of a pier are in progress in the vicinity of position 42° 52´·43S., 147° 21´·88E.
2. The area is marked by buoys with flashing yellow lights. The outermost buoy is positioned at 42° 52´·42S., 147° 21´·80E.
(WGS84 DATUM)
Chart affected - Aus 172
3183(P)/20 BRAZIL - East Coast - Piers. Depths. Coastline. Alongside depths.

Radio reporting lines.
Source: Source: ENC BR601401 and Brazilian Chart 1401
1. Piers have been established on Ilha da Fumaça in the following positions:
20° 19´·226S., 40° 18´·762W.

20° 19´·207S., 40° 18´·743W.
2. Alongside depths less than charted exist within Porto de Vitoria. The most significant are as follows:
Alongside Depth Position

8·2m 20° 19´·488S., 40° 20´·018W.
9·2m 20° 19´·503S., 40° 20´·244W.
8·7m 20° 19´·506S., 40° 20´·344W.
3. Depths less than charted exist within Porto de Vitoria. The most significant are as follows:
Depth Position
15m 20° 19´·261S., 40° 18´·996W.
10·2m 20° 19´·520S., 40° 20´·688W.
2·8m 20° 19´·429S., 40° 20´·462W.
12·8m 20° 19´·425S., 40° 20´·316W.
4. Depths of rocks have been amended as follows:
Depth Position
9·5m 20° 19´·500S., 40° 20´·747W.
9·4m 20° 19´·494S., 40° 20´·732W.
11·2m 20° 19´·472S., 40° 20´·414W.
5. The coastline has changed between Cais de Paul and Cais de Capuaba between positions:
20° 19´·490S., 40° 20´·067W.

20° 19´·501S., 40° 20´·226W.
6. Dolphins have been established in the following positions:
20° 19´·457S., 40° 20´·719W.

20° 19´·440S., 40° 20´·745W.
2.51
Wk26/20
II
3183(P)/20 BRAZIL - East Coast - Piers. Depths. Coastline. Alongside depths.
Radio reporting lines. (continued)
7. *Radio reporting lines have been established, joining the following positions:
20° 17´·059S., 40° 14´·837W.

20° 18´·522S., 40° 16´·745W.
and
20° 18´·690S., 40° 16´·727W.

20° 19´·318S., 40° 16´·673W.
9. These and other changes will be included in a New Edition of Chart 598 to be published mid 2020 and the next New Edition
of Chart 8036.
*Indicates new or revised entry.
(WGS84 DATUM)
3161(P)/20 DOMINICAN REPUBLIC - Depths. Berths. Lights.

Source: Haina International Terminals, mv UBC Sagunto and Dragados del Caribe, S.A.S
1. *A survey in May 2020 in Puerto de Haina, from the breakwaters northward, has shown that depths are deeper than charted
throughout most of the port.
2. * Depths are 9m or more alongside the numbered berths and within the basin on the east side of the port in the vicinity of
position 18° 25´·245N., 70° 00´·999W.
3. * Berth number 4W, between positions 18° 25´·251N., 70° 01´·207W. and 18° 25´·168N., 70° 01´·220W., has a minimum
alongside depth of 9·8m.
4. * Berth number 6E, between positions 18° 25´·545N., 70° 01´·055W. and 18° 25´·266N., 70° 01´·096W., has been
expanded into A, B and C berths with a minimum alongside depth of 11·3m.
5. Two white lights have been established in approximate position 18° 24´·376N., 70° 01´·233W. on the mooring dolphin at
the east end of the Itabo Jetty.
* Indicates new or revised entry.
(WGS84 DATUM)
3238(T)/20 VENEZUELA - Buoy.

Source: Venezuelan Notice 38(T)/20
1. The safe water light-buoy, Fl.3s, in position 10° 30´·00N., 67° 59´·92W. is reported missing.
(WGS84 DATUM)
2.52
Wk26/20
To accompany Notice to Mariners 3105/20
On Chart NZ 61
MARINE FARMS
Marine farms presenting a hazard to
navigation may be encountered. Farm extents
may be subject to seasonal change and may
be marked by buoys, beacons and lights.
Mariners are warned that not all farms may be
shown on this chart.
To accompany Notice to Mariners 3105/20
On Chart NZ 6142
MARINE FARMS
Marine farms presenting a hazard to
navigation may be encountered. Farm extents
may be subject to seasonal change and may
be marked by buoys, beacons and lights.
Mariners are warned that not all farms may be
shown on this chart.
Wk26/20
To accompany Notice to Mariners 3105/20. Image Size (mm) 111.8 by 91.2
Wk26/20
To accompany Notice to Mariners 3123/20. Image Size (mm) 103 by 86.7
Wk26/20
To accompany Notice to Mariners 3154/20. Image Size (mm) 89.8 by 119
Wk26/20
Wk26/20
Wk26/20
Wk26/20
To accompany Notice to Mariners 3230/20. Image Size (mm) 96.7 by 57
Wk26/20
III
NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2016 Edition). It is recommended that the warnings reprinted below should be kept in a file or
book, followed by subsequent weekly reprints. Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via SafetyNET and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@ukho.gov.uk
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA
Co-ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 26, published on the UKHO website 15 Jun 20.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 26
The following NAVAREA I warnings were in force at 150500 UTC Jun 20.
2020 series: 053 055 060 063 069 076 078 079.
Summary of Navarea I warnings issued since Weekly Edition 25:
078 1. Navarea I warnings in force at 121000 UTC Jun 20. 2. Cancel 075/20.
079 1. RIGLIST. Correct at 150500 UTC Jun 20.
Southern North Sea: 51N to 55N

51-43.6N 002-57.9E Seafox 7 ACP Borssele Beta
53-03.3N 001-41.2E Valaris 72 ACP Hewett Gas Field
53-14.0N 003-14.5E 590021
NEW 53-19.1N 002-05.8E Ensco 92 ACP South Valiant Gas Field
53-30.9N 003-25.1E Seafox 4 ACP Nam Field
NEW Vlissingen Energy Endeavour
54-24.4N 002-48.9E Maersk Resolve ACP D12-B
North Sea: 55N to 60N, East of 5W

55-43.4N 004-48.0E Maersk Guardian ACP Tyra Gas Field
56-15.0N 003-20.9E Maersk Invincible ACP Valhall Oil Field
56-16.8N 003-24.0E Maersk Reacher ACP Valhall Oil Field
56-43.5N 002-12.5E Ensco 120 ACP Jasmine Gas Field
56-48.4N 000-42.3E Valaris Gorilla VI
56-58.0N 001-52.2E Rowan Gorilla 5 ACP Franklin Gas Field
57-01.9N 001-57.3E Valaris 122 ACP Shearwater Oil Field
57-06.6N 002-50.8E Maersk Integrator ACP Ula Oil Field
57-10.1N 002-15.5E Ocean Endeavor
57-11.7N 001-54.8E Maersk Highlander ACP Culzean Gas Field
57-29.5N 002-18.0E Rowan Viking
57-50.7N 000-54.7W COSL Pioneer
58-04.4N 000-26.2E Wilphoenix
NEW Dundee Ensco 101
58-50.7N 001-44.6E Rowan Stavanger ACP Gudrun Oil and Gas Field
59-29.4N 001-33.5E Ocean Patriot
59-32.8N 002-01.1E Deepsea Nordkapp
59-35.4N 001-03.4E Noble Lloyd Noble ACP Mariner Oil Field
59-53.9N 001-16.9E Stena Don
Wk26/20 3.1
III
Norwegian Sea: 60N to 65N, East of 5W
60-03.6N 003-59.5W Transocean Leader
60-20.2N 004-02.4W Deepsea Aberdeen
60-30.4N 002-00.9E Maersk Intrepid
60-45.3N 003-26.5E Transocean Endurance
60-49.9N 003-36.1E Transocean Equinox
60-56.2N 002-37.2E West Hercules
60-56.7N 003-34.7E COSL Promoter
NEW 61-20.7N 002-04.2E Deepsea Atlantic
61-23.9N 002-03.9E Transocean Norge
61-24.0N 004-04.0E Deepsea Yantai
61-32.1N 002-14.7E Transocean Spitsbergen
NEW Feda, Norway Borgland Dolphin
64-01.8N 006-44.6E West Phoenix
64-52.0N 006-50.3E Transocean Enabler
64-56.8N 006-57.1E West Mira
South and West Coasts of the British Isles.

53-34.0N 003-27.3W Irish Sea Pioneer ACP Hamilton Gas Field
53-49.0N 003-33.6W Borr Ran ACP South Morecambe Gas Field.
NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform.
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no
2. Cancel 077/20.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Cumulative list of other NAVAREA I Warnings in-force at 150500 UTC Jun 20
2020 Series:
053 NORTH SEA, UK SECTOR. Chart GB 278
Safety Zone, radius 500 metres established at 57-21.54N 000-49.98E
055 NORTH SEA, NORWEGIAN SECTOR. Utsira Ground Southwards. Chart GB 2182C (INT 1041).
Seismic survey in progress by M/V SW Amundsen, towing 9 x 3500 metre long cables within area bounded by
58-48.3N 001-34.8E, 58-48.3N 003-29.2E, 58-04.6N 003-29.8E, 58-04.6N 002-04.4E, 58-09.2N 001-44.1E and
58-25.6N 001-28.9E. Berth of 3 miles ahead and abeam and 4 miles astern requested.
Vessels M/V Mainport Pine and M/V Astra-G in attendance.
060 NORWEGIAN SEA. Chart GB 4101 (INT 101).

Seismic survey in progress by M/V Polarcus Adira, towing 12 x 11000 metre long cables within an area bounded by
64-45N 001-50E, 64-13N 004-50E, 63-25N 003-52E and 63-56N 000-50E. Wide berth of 7 miles astern and 3 miles
ahead and abeam is requested.
063 NORTH SEA, NORWEGIAN SECTOR . Bergen Ground Eastwards. Chart GB 2182C (INT 1041).
Seismic survey in progress by M/V Ramform Vanguard towing 14 x 5.4 mile long cables within area bounded by
59-17.5N 001-48.6E, 59-23.4N 001-53.6E, 59-38.2N 002-33.4E, 59-36.7N 002-40.3E, 59-17.7N 002-44.2E,
59-11.7N 002-39.0E, 58-57.0N 001-59.7E and 58-58.5N 001-53.0E. Berth of 7.5 miles astern and 3 miles ahead and
abeam requested. Vessels Thor Magni, Thor Alpha and Sanco Scorpio in attendance.
069 NORTH SEA, NORWEGIAN SECTOR. Utsira Ground. Chart GB 274.

Underwater operations in progress by cableship Ile de Batz within area bounded by
58-50N 002-29E, 58-52N 002-36E, 58-45N 002-51E and 58-40N 002-34E. Wide berth requested.
076 BALTIC SEA, DANISH STRAITS AND KATTEGAT. Chart GB 295.

1. Multinational military exercise Baltops 20, using ships, submarines and aircraft, in progress from 070100 UTC Jun
within sea area bounded by 56-29N 010-00E, 54-28N 010-15E, 54-00N 011-15E, 54-00N 014-30E, 54-59N 018-40E,
57-46N 021-52E and 58-04N 019-32E.
Vessels within the exercise area may be contacted by naval units.
2. For more information contact Deployed NCAGS Element Kiel on telephone number +49 431 71745 2686 or email
deunavyncagsbaltops@bundeswehr.org.
3. Cancel this message 18 Jun 20.
3.2 Wk26/20
IV
[26/20]
UPDATES TO ADMIRALTY SAILING DIRECTIONS
NP28 Dover Strait Pilot (2017 Edition) NP61 Pacific Islands Pilot Volume 2
(2017 Edition)
Belgium -- Dover Strait -- Kwintebank —
Prohibited anchorage
Tonga -- Nomuka Group -- Ava Fonuaiki —
60 Directions; clearing lines
After Paragraph 2.47 1 line 8 Insert:

386
Prohibited anchorage
2.47a Paragraph 12.116 3 lines 1--12 Delete
1 A prohibited anchorage area (511721N 23763E)
lies NW of Kwintebank. ENC TO500403(1.000) [NP61--No 58--Wk 26/20]
GB Chart 1873/20 [NP28--No 54--Wk 26/20]

Tonga -- Ha’apai Group --
Ha’afeva anchorage — Directions
NP30 China Sea Pilot Volume 1 (2018 Edition)
388
Vietnam -- Gulf of Tonkin -- Paragraph 12.134 1--2 Replace by:

Approaches to Song Ca — Anchorage
1 From a position S of Trerise Patch (195994S
1744924W), steep--to, the track leads ESE through
205 the passage between Doyland Reef and Tungua
(12.132), passing:
After Paragraph 6.88 3 line 6 including existing Section IV SSW of Kito (195972S 1744724W) (12.135),
Notice Week 03/20 Insert: from where a light (12.136) is exhibited, thence:
SSW of a dangerous rock (200165S
Anchorage. Two designated anchorage areas lie 1744695W), over which blind rollers break
SE of Cua Lac Giang, centred on 195781N occasionally, thence:
1061444E and 195714N 106 1620E; mud, 2 NNE of Doyland Reef (200280S 1744570W),
depths from 11 to 16 m. thence:
SSW of the SE extremity of reef fringing Tungua
Vietnamese Notice 85/20 [NP30--No 147--Wk 26/20] (200080S 1744600W), thence:
NNE of a small detached reef awash (200305S
1744495W).
NP32B China Sea Pilot Volume 4 (2019 Edition) Thence the track joins the N/S track W of Nukulei.
(Directions for N/S track are given at 12.118)
ENC TO500403(1.000) [NP61--No 59--Wk 26/20]

China -- Haizhou Wan --
Dongjiakou — Anchorages
NP68 East Coast of the United States Pilot
61 Volume 1 (2018 Edition)
Paragraph 2.79 1 lines 1--5 Replace by:

1 Outer anchorage. Designated anchorages are as Massachusetts -- Buzzard Bay -- Cleveland
follows: Ledge Channel — Anchorages; obstructions
Area No 1 (352800N 1195300E); quarantine.
Area No 2 (351962N 1200371E); dangerous
155
cargo.
No 1 anchor berth (352070N 1200323E); 700 m After Paragraph 5.144 1 line 3 Insert:
in radius; large vessels.
No 2 anchor berth (352070N 1200420E); 700 m Caution. Several rocks and obstructions lie within
in radius; large vessels; quarantine. both anchorage areas.
Chinese Notice 21/721/20 [NP32B--No 132--Wk 26/20] US Chart 13236/20 [NP68--No 32--Wk 26/20]
Wk26/20 4.1
IV
New York -- Long Island -- 2 Controlling depth. The channel (162947N

Northport — Anchorage; wrecks 882381W) leading to Big Creek has a dredged
depth of 109 m.
195 Tidal levels. Mean maximum range about 02 m;
mean minimum range about 01 m. See information in
After Paragraph 6.232 2 line 3 Insert: ADMIRALTY Tide Tables Volume 2.
3 Northport Anchorage Ground (405770N Pilotage is compulsory. Pilots board in the vicinity
731500W) is centred on a position 4 miles W of the of 162166N 882402W.
3 Directions. From the vicinity of the pilot boarding
terminal. Anchorage may be obtained in 15 to 20 m
place the track leads generally N, passing:
(50 to 65 ft). Two wrecks lie in the NW of the
W of an underwater rock (162217N 882362W)
anchorage.
(5.33), and:
E of Monkey Shoal (162273N 882492W) (5.33),
US Chart 12364H/20 [NP68--No 31--Wk 26/20]
thence:
W of Penguin Shoals (162545N 882317W)
(5.33), thence:
NP69A East Coasts of Central America and W of a 7 m patch (162607N 882385W), thence:
Gulf of Mexico Pilot (2019 Edition) 4 W of Middle Shoal (162643N 882297W),
marked close NNW by 1B Light Buoy
(non--IALA), thence:
Close E of a shoal (162781N 882359W), marked
Belize -- Gulf of Honduras -- Big Creek — close S by 1C Light Buoy (non--IALA).
Directions; pilotage Thence the track leads NNE, passing:
ESE of Harvest Cay (162872N 882416E), an
103--104 island with a coral bank extending SE.
The track then leads NNW to Big Creek through
Paragraph 5.35 including existing Section IV Notices Week the dredged channel marked by light buoys (lateral).
26/19 and Week 46/19 Replace by: 5 Anchorage may be obtained 4 cables SSE of
Placencia Point, in 6 m.
1 Description. There are two small ports on the Berths:
shores of Placencia Lagoon (163190N 882255W), Big Creek has two berths with a dredged depth
described below. alongside of 109 m.
Big Creek (163086N 882428W), situated at the A small jetty (6 cables NE of Placencia Point), well
W side of the entrance to the lagoon, has a quay and sheltered by Placencia Cay, has a depth
turning basin reached by a dredged channel from alongside of 4 m.
deep water. Supplies: fish; limited quantities fresh water and
Placencia fishing harbour (163078N 882187W) fuel.
lies NE of Placencia Point (163051N 882243W),
also at the entrance to the lagoon. Belize Port Authority [NP69A--No 54--Wk 26/20]
4.2 Wk26/20
IV
[26/20]
UPDATES TO ADMIRALTY SAILING DIRECTIONS
In force 25th June 2020
Weekly
NP no Page(s) Title Edition
NP1 Africa 1 18th Edition (2017) 47/17
v Africa Pilot Volume 1 — Closure Date 47/17
79 Arquipélago da Madeira -- Ilha da Madeira — Ponta de São Lourenço Nature 52/19
Reserve
84 Portugal -- Ilha da Madeira -- Funchal — Wreck 46/19
94 Spain -- Islas Canarias -- Lanzarote -- Puerto de los Mármoles — Pilotage; depths 06/20
94 Spain -- Islas Canarias -- Lanzarote -- Puerto de Naos — Depths 06/20
114 Spain -- Islas Canarias -- Isla de la Gomera — Wreck 42/18
121 Arquipélago de Cabo Verde — Regulations; anchorage 18/18
122 Cabo Verde -- Ilha do Sal — Directions; shoal 34/18
130 Arquipélago de Cabo Verde -- Ilha de São Vicente -- Baía de San Pedro — 18/18
Anchorage
132 Arquipélago de Cabo Verde -- Ilha de São Vicente -- Porto Grande — Depths 18/18
133 Arquipélago de Cabo Verde -- Ilha de Santo Antão -- Porto Novo — Anchorage 18/18
137 Arquipélago de Cabo Verde -- Ilha de Santiago -- Baía do Tarrafal — Anchorage 18/18
141 Arquipélago de Cabo Verde -- Ilha Brava -- Porto de Furna — Anchorages 18/18
147 Morocco -- West coast -- Larache — Pilotage 36/18
152 Morocco -- Mohammadia — Directions; oil terminal 36/18
152 Morocco -- West coast -- Mohammedia — Directions; light buoys 06/19
152--153 Morocco -- Mohammadia — Directions; inner port 36/18
153 Morocco -- West coast -- Mohammedia — Directions; light buoys 06/19
153 Morocco -- West coast -- Approaches to Mohammedia — Light buoy 06/19
154 Morocco -- Casablanca — Directions; buoyage 34/18
154 Morocco -- Casablanca — Draughts 12/20
154 Morocco -- Casablanca — Outer anchorages; wrecks 33/18
154--155 Morocco -- Casablanca — Pilotage 34/18
155 Morocco -- Casablanca — Buoyage 38/18
156 Morocco -- Casablanca — Berths 18/18
156 Morocco -- Casablanca — Berths 01/19
156 Morocco -- West coast -- Casablanca — Depths alongside 06/19
159 Morocco -- Jorf Lasfar — Anchorages 12/18
160 Morocco -- Jorf Lasfar — Directions; buoyage 02/18
160 Morocco -- Jorf Lasfar — Directions; light 11/19
161 Morocco -- Safi — Draughts 12/20
161 Morocco -- Safi — Regulations 12/20
162 Morocco -- West coast -- Safi — Wreck 06/19
163 Morocco -- Cap Hadid — Major light 52/18
163 Morocco -- Essaouira -- Cap Hadid — Directions; light 15/19
163 Morocco -- Cap Hadid — Directions; light 18/19
163 Morocco -- Cap Hadid — Directions; major light 52/18
163 Morocco -- Essaouira -- Cap Hadid — Directions; light 15/19
163 Morocco -- Cap Hadid — Directions; light 18/19
166 Morocco -- Agadir — Prohibited areas 18/19
166 Morocco -- Agadir -- Port D’Anza — Development 18/19
169 Morocco -- South of Agadir -- Oued Sous — Directions 11/19
Wk26/20 4.3
IV
Weekly
173 Morocco -- Laâyoune — Directions; major light 13/19
175 Morocco -- West coast -- Laâyoune — Pilotage 47/18
175 Morocco -- West coast -- Laâyoune — Directions; leading marks 47/18
175 Morocco -- Laâyoune — Directions; useful marks 13/19
183 Morocco -- Ad Dakhla — Arrival information; outer anchorages 51/17
189 Mauritania -- Nouadhibou -- Point Central to Pointe de Cansado — Directions 05/18
189 Mauritania -- Nouadhibou -- Baie de Cansado — Directions; wrecks; buoy 05/18
191 Mauritania -- Banc d’Arguin -- Basse Garrigues — Directions; wreck 42/19
191--192 Mauritania -- Cap Blanc to Port de L’Amitié — Directions; wrecks; depths 07/19
194 Mauritania -- Port de l’Amitié — Anchorage 40/18
194 Mauritania -- Port de l’Amitié — Directions; leading lights 40/18
214 The Gambia -- Banjul — Depth 09/19
215 The Gambia -- Banjul -- Kotu Point — Directions 09/19
216 The Gambia -- Banjul -- Kotu Point — Directions, depth 09/19
218 The Gambia -- River Gambia -- Devil’s Point to Bombale Creek — Vertical clearance 44/19
223 Senegal -- Rivière Casamance — Directions; wreck 12/19
231 Guinea--Bissau -- Canal do Geba -- Ponta Biombo — Submarine cable 07/20
242 Republic of Guinea -- Port Kamsar — Harbour; jetty 17/20
244 Republic of Guinea -- Port Kamsar — Berths; jetty 17/20
244 Guinea -- Approaches to Port Kamsar — Anchorage terminal 08/19
269 Liberia -- Monrovia — Depths 16/19
270 Liberia -- Monrovia — Port operations 16/19
270 Liberia -- Monrovia — Pilotage 16/19
270 Liberia -- Monrovia — Wrecks; buoyage 16/19
275 Liberia -- Buchanan — Pilotage; buoyage 16/19
275 Liberia -- Buchanan — Depths 16/19
276 Liberia -- Buchanan — Directions; buoyage 16/19
277 Liberia -- Buchanan — Depths 16/19
278 Liberia -- Greenville — Directions; obstruction 44/19
296 Africa -- Ivory coast -- Abidjan — Limiting conditions; depth 50/18
311 Ghana -- Port of Tema — Regulations; anchorage 12/20
312 Ghana -- Port of Tema — Directions; rock 12/20
314--316 Ghana -- Port of Tema — Port development 12/20
323 Togo -- Port de Lomé — Anchorages 02/19
323 Togo -- Port de Lomé — Regulations 02/19
323 Togo -- Port de Lomé — Directions; wreck 18/18
325 Togo -- Kpémé — Anchorages 02/19
326 Republic of Benin -- Cotonou — Outer anchorages; obstruction 33/18
354 Nigeria -- Bonny River — Directions 46/19
357 Nigeria -- Bonny River -- Port Harcourt — Regulations 46/19
357 Nigeria -- Bight of Biafra — Offshore terminals 23/18
6 Republic of South Africa — Regulations; PSSA 28/18
6 South Atlantic -- Tristan da Cunha Group — Regulations 09/20
84 South Atlantic -- Tristan da Cunha Group — Regulations; ATBA 08/20
84 South Atlantic -- Tristan da Cunha Group — Regulations 09/20
90 South Atlantic -- Gough Island — Regulations; ATBA 08/20
99 Isla de Bioko -- Puerto de Malabo — Berths; depths 07/18
131 Cameroon -- Kribi — Marine terminal 02/19
131 Cameroon -- Kribi -- Sanaga Marine Terminal — Anchorage 19/20
4.4 Wk26/20
IV
Weekly
133 Equatorial Guinea -- Bata — Directions; light buoy; wreck 22/19
147 Gabon -- Owendo — Berths 06/19
152 Gabon -- Cap Lopez — Anchorage 47/19
159 Gabon -- South--south--west of Pointe Tishibobo — Terminal 34/18
171 Angola -- Malongo Terminal — Pilotage 48/17
173 Angola -- Futila Terminal — Directions; buoyage 39/17
185 Angola -- River Congo -- Ponta Kimongoa — Directions; caution 21/18
193 Angola -- Kaombo Field — Restricted areas 01/18
196 Angola -- Palanca Terminal — Pilotage 39/17
226 Namibia -- Walvis Bay — Limiting conditions; controlling depths 02/20
226 Namibia -- Walvis Bay — Arrival information; VTS; regulations 02/20
226 Namibia -- Walvis Bay — Wreck; barge 11/19
226 Namibia -- West coast -- Walvis Bay — Pilotage 38/19
226 Namibia -- West coast -- Walvis Bay — Harbour; development 38/19
226 Namibia -- West coast -- Walvis Bay — Harbour; development 38/19
227 Namibia -- Walvis Bay — Directions 02/20
227 Namibia -- West coast -- Walvis Bay — Berths 38/19
227 Namibia -- Walvis Bay — Berths 02/20
229 Namibia -- Walvis Bay — Directions; current meter 22/20
263 Republic of South Africa -- Saldanha Bay — Prohibited area 47/17
263 Republic of South Africa -- Saldanha Bay — MBM; submarine gas pipeline 47/17
265 Republic of South Africa -- Saldanha Bay — Directions 03/20
266 Republic of South Africa -- Saldanha Bay — Anchorage 03/20
266 Republic of South Africa -- South--west coast -- Saldanha Bay Harbour — Berths; 19/20
depths
3 Somalia and Kenya — Piracy 20/19
95 South Africa -- South coast -- Port Elizabeth — Berths; alongside depths 19/20
156 Mozambique -- Maputo — Pilotage 43/19
156 Mozambique -- Maputo — Pilotage 19/20
165 Mozambique -- Beira — Limiting conditions; controlling depth 16/19
166 Mozambique -- Beira — Limiting conditions; maximum size of vessel handled 16/19
166 Mozambique -- Beira — Anchorages 41/19
166 Mozambique -- Beira — Arrival information; pilotage 16/19
167 Mozambique -- Beira — Directions; shoals 41/19
167 Mozambique -- Beira — Directions; approach 41/19
167 Mozambique -- Beira -- Canal do Macúti — Directions; caution 41/19
183 Mozambique -- Nacala — Directions; Leading lights 02/20
239 Tanzania -- Pangani Bay to Tanga — Light 49/19
240 Tanzania -- Pangani Bay to Tanga — Directions 49/19
241 Tanzania -- Tanga — Pilotage 49/19
242 Tanzania -- Tanga — Directions; leading lights 49/19
242 Tanzania -- Tanga -- Tanga Bay — Directions 49/19
242--243 Tanzania -- Tanga -- Tanga Bay — Directions; leading lights 49/19
243 Tanzania -- Tanga -- Tanga Bay — Directions; leading lights 49/19
243 Tanzania -- Tanga -- Tanga Bay — Anchorages 49/19
243 Tanzania -- Tanga to Moa Bay — Directions; light 49/19
Wk26/20 4.5
IV
Weekly
272 Kenya -- Lamu -- Manda Bay — Pilotage 02/20
274 Kenya -- Lamu -- Manda Bay — Pilotage 02/20
NP4 South--East Alaska 8th Edition (2015) 16/15
146 Alaska -- Sumner Strait -- Kuiu Island -- Cape Decision — Directions; light 43/19
168 Alaska -- Frederick Sound -- The Five Fingers — Directions; light 43/19
169 Kake -- Security Bay — Patch 41/17
257 Alaska -- Cross Sound -- Cape Spencer — Light 08/20
257 Alaska -- Cross Sound -- Cape Spencer — Directions; light 08/20
261 Alaska -- Cross Sound -- Cape Spencer — Light 08/20
365 Cook Inlet -- Approaches to Anchorage — Directions; V--AIS 47/15
NP5 South America 1 19th Edition (2017) 22/17
6 Brazil — Regulations; Extractive Reserves 24/18
71 Brazil -- South coast -- Porto de Santos — Marine exploration 48/18
71 Brazil -- Penedos de São Pedro e São Paulo — Environmental Protection Area 15/19
73 Brazil -- Vitória--Trindade Seamount Chain — Environmental Protection Areas 15/19
78 Brazil -- North coast -- Cabo Orange — Directions; light 40/19
81 Brazil -- Rio Amazonas — Regulations 48/17
83 Brazil -- North--east coast -- Approaches to Rio Amazonas -- Banco do Meio — 05/20
Directions; wreck
88 Brazil -- Porto de Santana — Berths; anchorage 41/17
88 Brazil -- North coast -- East of Ilha Do Oiapoque — Directions 50/17
93 Brazil -- North coast -- Rio Pará -- Ilha dos Guarás — Directions; light 31/18
93 Brazil -- North coast -- Rio Pará -- Ponta Taipu — Directions; light 11/19
93 Brazil -- Rio Pará -- Canal do Espadarte — Directions; depths 48/17
93 Brazil – Rio Pará – Canal do Espadarte — Directions; depth 29/19
93 Brazil -- North coast -- Rio Pará -- Ponta Taipu — Directions; light 11/19
94 Brazil -- Rio Pará — Directions; wreck 05/20
94 Brazil -- North coast -- Rio Pará -- Salinópolis to Chapéu Virado — Directions 05/18
96 Brazil -- North coast -- Porto de Belém — Directions; wreck 11/19
97 Brazil -- Belém -- Ilha do Mosqueiro — Directions; shoal depth 22/18
99 Brazil -- Rio Pará -- Baía de Marajó — Directions; wreck 01/18
99 Brazil -- North coast -- Rio Pará -- Porto de Vila do Conde — Directions; buoy 05/19
101 Brazil -- Rio Pará -- Porto de Vila do Conde — Directions; wreck 01/18
109--110 Brazil -- River Amazon -- Ilha das Garças — Directions; depths 48/17
4.6 Wk26/20
IV
Weekly
115 Brazil -- Rio Negro -- Porto de Manaus — Vertical clearance 48/17
115 Brazil -- Rio Negro -- Porto de Manaus — Anchorages 48/17
115 Brazil – Porto de Manaus — Anchorages; traffic regulations 25/19
116 Brazil -- Rio Negro -- Porto de Manaus — Bridge 48/17
125 Brazil -- North coast -- Cabo Gurupi — Directions; wreck 14/19
125 Brazil -- North coast -- Cabo Gurupi — Directions; wreck 14/19
125 Brazil -- North coast -- Cabo Gurupi to Ilhas de São João — Directions; wreck 30/18
126 Brazil -- North coast -- Ilha Mangunça — Directions; light 29/18
127 Brazil -- North coast -- Baía de São Marcos -- Ilha do Medo — Directions; light 07/19
129 Brazil -- Baía de São Marcos -- Terminal da Ponta da Madeira — Berth 23/17
133 Brazil -- North coast -- Approaches to Rio das Preguiças -- Barra das Preguiças — 17/20
Directions; wreck
137 Brazil -- Pecém Terminal — Anchorages; berths 50/17
137 Brazil -- North coast -- Porto de Mucuripe — Wreck 07/19
141 Brazil -- North coast -- Approaches to Fortaleza — Directions; wreck 07/19
162 Brazil -- East coast -- South of Recife — Directions; wreck 27/18
162 Brazil -- East coast -- Porto de Recife to Porto de Pedras — Directions; wrecks 49/19
163 Brazil -- East coast -- Puerto de Suape — Anchorages 02/20
171 Brazil -- East coast -- Aracaju -- Sergipe Terminal — Pilotage 01/19
171 Brazil -- Aracaju -- Sergipe Terminal — Anchorage 39/18
175 Brazil -- East coast -- Salvador — Anchorages; pilotage 36/18
175 Brazil -- East coast -- Porto de Salvador — Anchorages 38/18
188 Brazil -- East coast -- Porto de Ilhéus — Controlling depths 31/18
199 Brazil -- Barra do Riacho — Anchorage 20/18
199 Brazil -- Terminal de Barra do Riacho — Prohibited anchorage; harbour 01/18
200 Brazil -- Terminal de Barra do Riacho — Berths 01/18
200 Brazil -- East coast -- South--south--west of Rio Doce -- Regência — Wreck 21/19
201 Brazil -- Porto de Vitória —Vessel traffic service 01/18
202 Brazil -- Porto de Vitória —Vessel traffic service 01/18
209 Brazil -- East coast -- Guaxindiba — Directions; lights 46/17
210 Brazil -- East coast -- Approaches to Porto do Açu — Danger area 31/18
211 Brazil -- Porto do Açu — Directions; light beacons; buoys 24/18
214 Brazil -- Cabo Búzios -- Enseada de Búzios — Anchorage 46/17
219 Brazil -- East coast -- Baía de Guanabara — Wreck 09/19
223 Brazil -- Rio de Janeiro -- Approaches to Baía de Guanabara — Directions; wreck 19/20
227 Brazil -- Porto de Rio de Janerio — Directions 50/17
228 Brazil -- Porto de Rio de Janeiro — Anchorages 01/18
228 Brazil -- Rio de Janeiro — Anchorages; wrecks 42/19
234 Brazil -- East coast -- Ponta de Castelhanos — Directions; pilot 05/18
236 Brazil -- Baía de Sepetiba -- Porto de Itaguaí — Directions; channels 52/17
236 Brazil -- Baía de Sepetiba -- Porto de Itaguaí — Directions; channels; depths 52/17
237 Brazil -- East coast -- Baía de Sepetiba — Directions; wreck 12/18
236--237 Brazil -- Baía de Sepetiba — Directions; wreck 03/19
237 Brazil -- South coast -- Porto de Itaguaí — Depths 25/18
237 Brazil -- South coast -- Porto de Itaguaí — Depth 29/19
237 Brazil -- Porto de Itaguaí — Anchorages 52/17
237 Brazil -- South coast -- Porto de Itaguaí — Depth 29/19
Wk26/20 4.7
IV
Weekly
242 Brazil -- South coast -- Baía da Ilha Grande — Anchorages 45/19
246 Brazil -- South coast -- Canal de São Sebastião — Traffic regulations 05/20
254 Brazil -- Approaches to Porto de Santos — Directions; wreck 17/18
256 Brazil -- East coast -- Barra de Icapara — Directions; light 01/18
257 Brazil -- East coast -- Barra de Icapara — Directions; light 01/18
257 Brazil -- East coast -- Ilha do Cardoso — Wreck 09/19
260 Brazil -- East coast -- Porto de Antonina — Position; limiting conditions; berths 22/18
265 Brazil -- South--east coast -- Porto de Itajaí — Depths 22/20
266 Brazil -- South coast -- Itajaí — Terminals; alongside berths 26/18
270 Brazil -- South east coast -- Porto de Imbituba — Arrival information; speed limit 02/20
273 Brazil -- South coast -- Barra do Rio Grande Approaches — Directions; wrecks 27/18
276 Brazil -- South coast -- Porto do Rio Grande — Anchorages; foul ground 17/20
276 Brazil -- Porto Do Rio Grande — Berths 43/17
285 Uruguay -- Canal de Lobos -- East of Punta del Este — Anchorage 01/20
287 Uruguay -- José Ignacio Terminal — Restricted area 01/20
290 Uruguay -- Isla de Flores — ESSA 39/18
290 Uruguay -- Río de La Plata — Directions; wreck 27/17
294 Uruguay -- Montevideo -- Antepuerto — Depth 11/18
295 Uruguay -- Puerto de Montevideo — Prohibited area 45/17
298 Uruguay -- Montevideo -- Antepuerto — Depth 11/18
298 Uruguay -- Puerto de Montevideo — Alongside berths; Muelle C 23/17
300 Uruguay -- Río de La Plata — Under keel clearance 46/18
303 Argentina -- Río de La Plata — Directions; Canal Punta Indio Sudeste 22/17
304 Argentina -- Puerto La Plata — Anchorages 46/18
307 Uruguay -- West--north--west of Montevideo — ESSA 39/18
308 Uruguay -- Bahía de Montevideo to Rada de Colonia — Directions 41/19
309--310 Uruguay -- Bahía de Montevideo to Rada de Colonia -- Puerto de Colonia — 41/19
Directions
318 Uruguay -- Río Uruguay -- Puerto De Colonia to Isla Martín García -- Isla Farallón — 41/19
Directions
319 Uruguay -- Río de La Plata -- Paso de San Juan and Pozos de San Juan — 22/17
Directions; emergency anchorage; passing areas
320 Uruguay -- Río Uruguay -- Paso de San Juan — Emergency anchorage 41/19
326 Uruguay -- Río Uruguay -- Puerto de Nueva Palmira — Light; berths 41/17
335 Argentina -- Puerto Bunge Ramallo — Directions; name change; new route 41/17
336 Argentina -- Puerto Bunge Ramallo — Name change 41/17
336 Argentina -- Río Parana -- Puerto San Nicolás — Anchorages 13/18
337 Argentina -- Río Paraná -- Punta Alvear — Terminals 47/18
337 Argentina -- Río Paraná -- Puerto Rosario — Berths 47/18
352 Argentina -- Bahía Blanca -- Puerto Galván — Berths 16/18
353 Argentina -- Bahía Blanca — Anchorages 16/18
353 Argentina -- East coast -- Bahía Blanca — Anchorage; obstruction 37/19
95 Falkland Islands -- East Falkland -- Berkley Sound — Directions; wreck 14/20
179 Chile -- South coast -- Canal Beagle -- Punta Waller to Punta Navarro — Directions; 51/19
shoal
335 Chile -- Estrecho de Magallanes -- Paso del Mar — Directions; V--AIS 20/20
357 Chile -- Canal Mayne — Traffic regulations 03/20
359 Chile -- Canal Gray — Traffic regulations 03/20
422 Chile -- Canal Picton — Traffic regulations 03/20
4.8 Wk26/20
IV
Weekly
97 Chile -- Archipiélago de los Chonos -- Canal Pulluche — Directions; shoals 37/19
157 Chile -- Isla Chiloé -- Canal Chacao — Directions; V--AIS 20/20
193 Chile -- North--west of Puerto San Vicente — Directions; buoy 22/19
194 Chile -- Puerto San Vicente — Directions; lights 04/20
194 Chile -- Puerto San Vicente — Directions; lights 04/20
195 Chile -- Puerto San Vicente — Terminal 04/20
197 Chile -- Puerto Talcahuano — Light beacon 04/20
198 Chile -- Puerto Talcahuano — Directions 04/20
204 Chile -- Puerto San Antonio — Berth draught 49/18
204--205 Chile -- Puerto San Antonio — Prohibited areas; outer anchorage; pilotage 49/18
205--206 Chile -- Puerto San Antonio — Moorings; berths 49/18
220 Chile -- Punta Lengua de Vaca to Punta Tortuga — Directions; major light 37/19
222 Chile -- Guayacán — Directions; major light 37/19
222 Chile -- Guayacán — Directions; leading lights 41/19
223 Chile -- Coquimbo — Directions; major light 37/19
224 Chile -- Punta Lengua de Vaca to Punta Carrizal -- Coquimbo — Directions; berths 23/19
224 Chile -- Punta Tortuga to Punta Totoralillo — Directions; major light 37/19
258 Chile -- Bahia Chiquinata -- Punta Gruesa — Prohibited area 49/18
260 Chile -- Bahia Chiquinata -- Punta Gruesa — Prohibited area 49/18
260--261 Chile -- Iquique — Anchorages 50/19
261 Chile -- Iquique — Directions; terminal 28/19
261 Chile -- Iquique — Berths 28/19
266 Chile -- Arica — Anchorages 43/19
266 Chile -- Arica — Pilotage 42/19
271 Peru -- Puerto Ilo — Outer anchorages 22/19
275 Peru -- Matarani — Outer anchorages; directions 22/19
279 Peru -- San Juan — Anchorage 09/19
281 Peru -- Approaches to Puerto San Nicolás — Anchorage; wreck 02/20
289 Peru -- Melchorita LNG Terminal — Port 01/20
290 Peru -- Melchorita LNG Terminal — Port 01/20
291 Peru -- Callao -- Ensenada de Chorrillos — Anchorage 49/18
291--292 Peru -- Callao — Anchorages 49/18
293 Peru -- Callao — Directions; wrecks 19/20
299 Peru -- Bahía del Callao -- La Pampilla — Prohibited area 02/20
299 Peru -- Puerto Chancay — Anchorages 49/18
300 Peru -- Puerto Chancay — Berths 49/18
300 Peru -- Puerto Huacho — Outer anchorage 51/18
305 Peru -- Chimbote — Anchorages 05/19
305 Peru -- North--west coast -- Chimbote — Berths; anchorage 13/19
305 Peru -- Chimbote — Anchorages 05/19
307 Peru -- Bahía Coishco — Anchorages 05/19
308 Peru -- Salaverry — Arrival information; outer anchorages 18/19
313 Peru -- North--west coast -- Eten Offshore Terminal — Arrival information; anchorage 13/19
313 Peru -- North--west coast -- Pimentel — Arrival information; anchorage 13/19
314 Peru -- North--west coast -- Santa Rosa — Anchorage 13/19
314 Peru -- North--west coast -- Pimentel -- San José — Anchorages 13/19
317 Peru -- Caleta Tierra Colorada — Anchorage 18/19
317 Peru -- Paita — Arrival information; outer anchorages 18/19
321 Peru -- North--west coast --Talara — Outer anchorages 13/19
Wk26/20 4.9
IV
Weekly
324 Peru -- Puerto Zorritos — Anchorage 09/19
324 Ecuador -- Outer approaches to Guayaquil -- Golfo de Guayaquil — Directions 10/20
327 Ecuador -- Approaches to Guayaquil -- Canal del Morro — Reference 10/20
328 Ecuador -- Approaches to Guayaquil -- Canal de Jambelí — Directions; wreck 10/20
329 Ecuador -- Outer approaches to Guayaquil -- DW approach W of Isla Puná — Route 10/20
330 Ecuador -- Punta Chapoya to Isla Santa Clara — Directions; light buoy; wreck 10/20
332 Ecuador -- Approaches to Guayaquil -- Golfo de Guayaquil — Controlling depths 10/20
332 Ecuador -- Guayaquil — Vertical clearance 02/19
332 Ecuador -- Golfo de Guayaquil -- Guayaquil — Vertical clearance 02/20
332 Ecuador -- Golfo de Guayaquil -- Guayaquil — Vertical clearance 16/20
332 Ecuador -- Guayaquil — Horizontal clearance 02/19
333 Ecuador -- Approaches to Guayaquil -- Golfo de Guayaquil — Outer anchorages 10/20
333 Ecuador -- Guayaquil — Arrival information; reference; traffic regulations 10/20
334 Ecuador -- Golfo de Guayaquil -- Posorja — Development 10/20
334 Ecuador -- Approaches to Guayaquil -- Canal del Morro — Natural conditions; 10/20
reference
334 Ecuador -- Approaches to Guayaquil -- Golfo de Guayaquil — Directions; approaches 10/20
334 Ecuador -- Guayaquil — Directions; wreck 03/20
334 Ecuador -- Approaches to Guayaquil -- Canal del Morro — Directions; rocks 10/20
334 Ecuador -- Approaches to Guayaquil -- Canal del Morro to Punta Mandinga — 10/20
Directions
334--335 Ecuador -- Approaches to Guayaquil -- Punta Mandinga to Puerto Buenavista — 10/20
Directions
335 Ecuador -- Approaches to Guayaquil -- Río Guayas -- Isla Matorrillos — Directions; 10/20
wreck
335--336 Ecuador -- Guayaquil — Berths 02/19
337 Ecuador -- Approaches to Guayaquil -- Estero Salado and Estero Mogón — 10/20
Anchorages
337 Ecuador -- Guayaquil -- Estero del Muerto — Traffic regulations 10/20
337 Ecuador -- Isla Trinitaria -- Guayaquil — Harbour 10/20
337--338 Ecuador -- Approaches to Guayaquil -- Canal del Morro to Roca Seiba — Directions; 10/20
TSS
338 Ecuador -- Approaches to Guayaquil -- Roca Seiba to Punta Escalante — Directions 10/20
338 Ecuador -- Approaches to Guayaquil -- Punta Escalante to Isla Santa Ana — 10/20
Directions
338 Ecuador -- Isla Santa Ana to Puerto Marítimo de Guayaquil — Directions 10/20
338 Ecuador -- Isla Trinitaria -- Guayaquil — Berths 10/20
338 Ecuador -- Puerto Marítimo De Guayaquil -- Estero Santa Ana and Estero del Muerto 10/20
— Berths
338 Ecuador -- Approaches to Guayaquil -- Posorja — Port 10/20
341 Ecuador -- Manta — Directions; light 51/18
342 Ecuador -- Monteverde — Pilotage; anchorages; berths 02/19
346 Ecuador -- Esmeraldas — Anchorage; pilotage; traffic regulations 08/19
346 Ecuador -- Esmeraldas — Anchorages 16/19
346 Ecuador -- Esmeraldas — Anchorage; pilotage; traffic regulations 08/19
4.10 Wk26/20
IV
Weekly
347 Ecuador -- Esmeraldas — Directions; buoy 02/19
347 Ecuador -- Approaches to Esmeraldas — Directions 08/19
348 Colombia -- Cabo Manglares — Marine reserve; prohibited area 42/19
355 Colombia -- West coast -- Bahía de Buenaventura — Outer anchorages; wreck 36/19
355 Colombia -- West coast -- Buenaventura — Restricted area 21/19
356 Colombia -- West coast -- Bahía de Buenaventura — Inner anchorages 36/19
356 Colombia -- Buenaventura — Anchorages; obstructions 06/20
357 Colombia -- Buenaventura -- Bahía de Málaga — Light buoy 25/19
357 Colombia -- Buenaventura -- Bahía de Málaga — Directions; light buoy 25/19
365 Panamá -- Gulf of Panamá -- Balboa — Cruise terminal 22/19
NP7A South America 4 8th Edition (2018) 51/18
59 Brazil -- North coast -- Cabo Orange — Directions; light 40/19
68 Suriname -- Approaches to Suriname River — Ship to ship transfer areas 18/19
79 Guyana -- Georgetown -- Approach to Demerara River — Depth 17/19
79 Guyana -- Georgetown -- Demerara River — Pilotage 17/19
81--82 Guyana -- Georgetown -- Approach to Demerara River — Directions; pilotage; wrecks 17/19
82 Guyana -- Georgetown — Anchorages; caution 17/19
84 Guyana -- Essequibo River — Directions; wreck 44/19
85 Guyana -- Essequibo River entrance — Directions; wreck 16/19
90 Guyana -- Waini River — Directions; wreck 01/19
93 Venezuela -- Boca Grande -- South Channel — Light buoy 51/18
94 Venezuela -- Boca Grande -- South Channel — Light buoy 51/18
94 Venezuela -- Boca Grande -- South Channel — Light buoy; precautionary area 51/18
95 Venezuela -- Boca Grande -- South Channel — Controlling depths 51/18
95 Venezuela -- Río Orinoco -- Boca Grande -- South Channel — Aids to navigation; 11/20
light buoy
95 Venezuela -- Boca Grande -- South Channel — Directions; wreck; light buoy 51/18
95 Venezuela -- Río Orinoco -- Boca Grande -- South Channel — Directions; light buoy 11/20
95 Venezuela -- Boca Grande -- South Channel — Directions; light buoy 51/18
98 Venezuela -- Río Grande -- San Felix — Directions; leading lights 51/18
98 Venezuela -- Río Orinoco — Anchorages 51/18
98 Venezuela -- Río Orinoco -- Punta de Piedra — Anchorage 51/18
98 Venezuela -- Río Orinoco -- Los Castillos — Anchorage 51/18
98 Venezuela -- Río Orinoco -- San Félix — Anchorages 51/18
98 Venezuela -- Río Orinoco -- San Félix — Directions; leading light 51/18
99 Venezuela -- Río Orinoco -- Puerto Matanzas — Anchorage 51/18
116 Trinidad and Tobago -- Gulf of Paria -- Chaguaramas bay — Pilotage 11/19
129 Venezuela -- Gulf of Paria -- Puerto de Guiria — Anchorages 09/19
154 Venezuela -- Cumaná — Directions; light 47/19
160 Venezuela -- Bahía de Pozuelos — Directions 09/19
160 Venezuela -- Puerto La Cruz -- Bahía de Bergantín — Directions 37/19
161 Venezuela -- Bahía de Pozuelos -- Los Cocos — Directions 09/19
162 Venezuela -- Bahía de Barcelona -- Puerto Jose — Pilotage 09/19
221 Venezuela -- Bahía de Amuay — Anchorage 51/18
242 Colombia -- North coast -- Puerto Bolivar — Pilotage; buoyage 27/19
242 Colombia -- North coast -- Puerto Bolivar — Directions; light buoy 27/19
250 Colombia -- Approaches to Puerto Barranquilla — Anchorages 02/20
252 Colombia -- North coast -- Puerto Barranquilla -- Terminal Maritimo — Directions; 51/18
leading lights
Wk26/20 4.11
IV
Weekly
252 Colombia -- Puerto Barranquilla — Directions; anchorages 04/20
256 Colombia -- Cartagena — Depths 04/20
256 Colombia -- North coast -- Bahía de Cartagena — Restricted areas 21/19
260 Colombia -- Cartagena — Anchorage; wreck 04/20
262 Colombia -- Bahía de Cartagena to Golfo de Morrosquillo — Traffic regulations 33/19
263 Colombia -- North coast -- Golfo de Morrosquillo — Directions; track 03/19
266 Colombia -- Golfo de Urabá -- Outer part — Directions; light 33/19
267 Colombia -- Golfo de Urabá -- Inner part — Directions; light 33/19
267 Colombia -- Golfo de Urabá -- Inner part — Directions; light 33/19
272 Colombia -- North coast -- Cabo Tiburón — Directions; ODAS buoy 19/20
277 Panama -- Bahía de San Cristobal to Bahía de Portobelo — Marine reserve 51/18
278 Panama -- Bahía de Portobelo — Marine reserve 51/18
284 Panama -- Colón -- Bahía Manzanillo — Directions; leading lights 17/20
291 Panama -- Puerto de Cristóbal — Anchorage 02/19
293 Panama -- Puerto de Cristóbal — Berths 02/19
297 Panama -- Panama Canal -- Gatún Lake — Anchorage 52/18
297 Panama -- Gatún Lake -- Gatún Anchorage West Side — Depths 32/19
297 Panama -- Panama Canal -- Gamboa Reach — Tie--up stations 52/19
NP8 Pacific Coasts of 15th Edition (2019) 43/19
Central America and
United States
139 Mexico -- Salina Cruz — Development 10/20
189 Mexico -- Golfo de California -- La Paz — Directions; leading lights 43/19
241 United States of America -- California -- San Diego Bay — Controlling depth 11/20
241 United States of America -- California -- San Diego Bay — Anchorage 43/19
NP9 Antarctic 9th Edition (2019) 24/19
26 Antarctic -- Regulations — Marine Protected Areas 10/20
230 Antarctic Peninsula -- Bransfield Strait – Deception Island — Directions; depth 28/19
249 South Shetland Islands -- Desolation Island -- Blythe Harbour — Directions; rock 05/20
249 South Shetland Islands -- Desolation Island -- Blythe Bay — Directions; rock 15/20
289 Antarctica -- Graham Land -- Trinity Peninsula -- Hope Bay — Directions 36/19
291 Graham Land -- Bransfield Strait -- North of Cape Leguillou — Directions; position 07/20
376 Antarctica -- Graham Land -- Adelaide Island -- Avian Island — Anchorage 28/19
455 Australian Antarctic Territory -- Mac. Robertson Land -- Mawson — Approach 48/19
456 Australian Antarctic Territory -- Mac. Robertson Land -- Mawson — Directions 48/19
456 Australian Antarctic Territory -- Mac. Robertson Land -- Mawson — Directions 05/20
NP10 Arctic 1 9th Edition (2016) 07/16
8 Navigation and Regulations -- Russian pilotage — Icebreaker pilotage 32/16
86 Kara Sea -- Ostrov Belyy — Directions; recommended routes 48/18
275 Obskaya Guba -- Mys Belyy to Mys Drovyanov — Directions; anchorages and 52/16
harbours
275 Kara Sea -- Mys Belyy to Mys Drovyanoy — Directions; recommended route 48/18
275 Mys Drovyanov to Mys Shtormovoy — General information; directions 52/16
276 Mys Drovyanov to Mys Shtormovoy — General information; directions 52/16
277 Mys Shtormovoy to Mys Khonarasalya — Directions 52/16
278 Kara Sea -- Obskaya Guba -- Port Sabetta — Development 12/17
278 Russia -- Kara Sea -- Obskaya Guba -- Port Sabetta — Port development 10/20
278--279 Kara Sea -- Obskaya Guba — Directions; DW route; landmarks; depths 29/17
279--280 Kara Sea -- Obskaya Guba — Directions; DW route; wreck; landmarks 29/17
289 Kara Sea -- South Part — Aids to navigation; lights 04/17
289 Russia -- Kara Sea -- Ostrov Vil’kitskogo -- Vil’kitskiy — Directions; light 02/20
4.12 Wk26/20
IV
Weekly
311 Reka Yenisey -- Mouth of river to Igarka — General information; navigation; lights 04/17
319 Kara Sea -- Reka Yenisey -- Mys Krestovskiy to Dudinka — Pilot boarding positions; 16/16
anchorages
322 Kara Sea -- Reka Yenisey -- Mys Krestovskiy to Dudinka — Pilot boarding positions; 16/16
anchorages
322 Kara Sea -- Reka Yenisey -- Dudinka to Igarka — Pilot boarding position 16/16
441 Russia -- Laptev Sea -- Reka Lena -- Protoka Bykovskaya — Directions; leading 24/20
lights
473 Reka Kolyma -- Protoka Kamennaya — Depths; directions 07/16
474 Reka Kolyma – Protoka Kamennaya — Depths; directions 07/16
479 East Siberian Sea -- Chaunskaya Guba — Directions; aids to navigation 16/19
94 Iceland -- South coast -- Þorlákshöfn— Directions; leading lights 17/20
115 Iceland – Reykjavík — Limiting conditions; controlling depths 25/19
118 Iceland -- Reykjavíc — Directions; light 28/19
126--127 Iceland -- Akranes — Directions; lights 45/18
138--139 Iceland -- BreiÉafjörÉur -- Stykkishólmur — Directions; light sectors 14/20
139 Iceland -- BreiÉafjörÉur -- Stykkishólmur — Directions; depth 51/19
247 Svalbard -- Spitsbergen -- Adventfjorden — Anchorage 34/18
322 Greenland -- Kong Christian IX Land -- Kap Gustav Holm — Directions; shoal 49/18
9--10 Canada — Regulations 17/19
10 Canada — Regulations 17/19
136 Greenland -- Narluneq -- Avartmuit -- Ikerasatsiaq — Directions; wreck 10/20
136 Greenland -- Narluneq -- Avatarmiut -- Ikerasatsiaq — Directions; wreck 18/20
137 Greenland -- Kap Desolation – Kitsissut — Regulations 10/20
181 Greenland -- West coast -- Sarfartoq -- Kangerlussuaq — Berth 42/18
438 Canada -- Northwest Territories -- Tuktoyaktuk — Directions; lights 36/19
463 Canada -- North coast -- Coronation Gulf -- Edinburgh Channel — Depths 19/20
NP13 Australia 1 5th Edition (2017) 17/17
10 Australian Regulations — Protection of historic features and areas 36/18
97 Queensland -- Gulf of Carpentaria -- Albatross Bay -- Amrun Port — Port 52/18
114 Melville Bay -- Gove Harbour — Outer anchorages 08/18
129 Arnhem Land -- North and north--east of Maningrida — Outlying dangers; wrecks 08/18
130 Northern Territory -- Arafura Sea -- South Goulburn Island — Depths 45/17
146 Western Australia -- Ashmore Reef — Prohibited area 35/18
147 Western Australia -- North coast -- Browse Island — FLNG Terminal 19/18
155 Northern Territory -- Port Darwin -- Middle passage — Depth 28/19
156 Northern Territory -- Port Darwin — Regulations; restricted areas 21/18
159 Northern Territory -- Port Darwin -- Wickham Shoal — Wreck 26/18
166 Australia -- North coast -- Cambridge Gulf — Pilotage 08/18
168 Western Australia -- Cambridge Gulf -- Cawston Bay — Directions; depth 01/18
168 Western Australia -- Cambridge Gulf -- Wyndham Wharf — Directions; light buoys 49/18
183 Western Australia -- Brunswick Bay -- Hanover Bay — Anchorage 17/17
213 Western Australia -- Broome — Directions; controlling depth 46/18
Wk26/20 4.13
IV
Weekly
213 Western Australia -- Roebuck Bay -- Broome — Controlling depths 50/19
214 Western Australia -- North coast -- Broome — Regulations; pilotage 32/19
214 Western Australia -- Roebuck Bay -- Broome — Tidal streams; rock 50/19
216 Western Australia -- Roebuck Bay and Broome — Directions; buoys 34/19
216 Western Australia -- Roebuck Bay -- Broome — Directions; shoals 50/19
216 Western Australia -- Roebuck Bay and Broome — Directions; buoys 34/19
216 Western Australia -- Broome — Directions; depths 27/19
216 Western Australia -- Roebuck Bay -- Broome — Directions; shoals 50/19
220 Western Australia -- North--west coast -- Port Hedland — Controlling depths 20/20
220--221 Western Australia -- North--west coast -- Port Hedland — Anchorages 20/20
221 Western Australia -- Port Hedland — Traffic Regulations 38/17
222 Western Australia -- North--west coast -- Port Hedland — Directions; major light 27/19
223 Western Australia -- Port Hedland -- Goldsworthy Front — Directions; light 35/18
223 Western Australia -- Port Hedland — Berths 38/17
224 Western Australia -- Port Hedland — Tug haven 48/17
227 Western Australia -- North West Cape -- Muiron Islands — Marine terminals 22/19
231 Western Australia -- North West Cape — Natural conditions 22/19
231 Western Australia -- North West Cape -- Muiron Islands — Racon 22/19
231--232 Western Australia -- North West Cape -- Muiron Islands — Marine terminals 22/19
232 Western Australia -- North West Cape — Natural conditions 22/19
233 Western Australia -- East of Dampier Archipelago — Marine protected area 36/19
235 Western Australia -- Port Walcott — Pilot boarding place 17/17
236 Port Walcott -- Outer North Channel — Emergency waiting areas 42/17
241 Western Australia -- Dampier -- East Intercourse Island -- Radome 17/17
257 Western Australia -- Mary Anne passage to Onslow — Hazards; submarine pipelines 39/19
258 Western Australia -- Mary Anne passage to Onslow -- Ripple Shoals to Penguin Bank 39/19
— Directions; oil platform
260 Western Australia -- Onslow -- North--east approaches — Directions; oil platform 39/19
261 Western Australia -- Ashburton — Controlling depths 39/19
262 Western Australia -- Ashburton — Pilotage; speed limit 39/19
263 Western Australia -- Ashburton -- North--east approach — Directions; oil platform; 39/19
depth; pilot boarding position
263 Western Australia -- Ashburton -- Entrance channel — Directions; leading lights 39/19
279 Western Australia -- Shark Bay -- Denham Sound — Directions; wreck 28/18
281 Geelvink Channel -- Shoal Point — Directions; Racon 44/17
284 Geelvink Channel -- Shoal Point — Directions; Racon 44/17
291 Western Australia -- Port Denison — Directions; leading lights 37/17
326 Western Australia -- South coast -- Albany — Directions; light 12/19
328 Western Australia -- South coast -- Albany — Directions; light 12/19
329 Western Australia -- King George Sound -- Albany — Anchorages 16/19
332 Western Australia -- South coast --Albany — Directions; light 12/19
333 South coast of Australia -- Cape Vancouver -- Lookout Point — Wreck 03/19
338 South coast of Australia -- Cape Le Grand -- Pasco Island — Directions; shoal 03/19
347 South Australia -- Great Australian Bight -- Cape Adieu — Environmentally sensitive 37/18
sea area
4.14 Wk26/20
IV
Weekly
356 South Australia -- Streaky Bay -- Blanche Port — Directions 11/18
359 South Australia -- Great Australian Bight -- Venus Bay — Directions 11/18
363 South Australia -- Spencer Gulf — Regulations; ESSA 36/19
379 South Australia -- Spencer Gulf -- Whyalla — Traffic regulations; ESSA 36/19
381 South Australia -- Spencer Gulf -- Port Bonython — Depths; anchorage; pilotage 36/19
382 South Australia -- Spencer Gulf -- Port Bonython — Directions 36/19
383 South Australia -- Germein Bay — ESSA 40/18
383 South Australia -- Spencer Gulf -- Germein Bay — ESSA; directions 36/19
383 South Australia -- Spencer Gulf -- Port Pirie — Pilotage; ESSA 36/19
383 South Australia -- Germein Bay -- Port Pirie — ESSA 40/18
398 South Australia -- Kangaroo Island -- Hog Bay — Anchorage 35/17
400 South Australia -- Port Adelaide approaches — Directions; wrecks 52/19
401 Gulf of Saint Vincent -- Port Stanvac — Port description 08/19
402 South Australia -- Port Adelaide -- Port Adelaide River — Vertical clearances 52/19
403--404 South Australia -- Port Adelaide — Directions; leading lights 50/19
405 South Australia -- Port Adelaide — Directions; light beacons 50/19
405 South Australia -- Port Adelaide -- Inner Harbour — Directions 52/19
101--102 Australia -- Victoria -- Cape Otway to Point Grey -- Apollo Bay — Directions 38/19
102--103 Australia -- Victoria -- Cape Otway to Point Grey -- Apollo Bay — Directions 38/19
176 Victoria -- South coast -- Lakes Entrance -- Bullock Island — Prohibited anchorage 25/19
199--200 Tasmania – Devonport — Berths; depths 31/19
200 Tasmania – Devonport — Berths; depths 31/19
205 Tasmania -- North coast -- River Tamar -- Long Reach — Directions; marine farm 07/20
264 Tasmania -- South coast -- Storm Bay — Directions; marine farm 07/20
275 Tasmania -- East coast -- Maria Island — Directions; ODAS 16/20
97 Nouvelle--Calédonie -- Récifs et Iles Chesterfield — Anchorage 18/19
112 Australia -- East coast -- Approach to Newcastle — Restricted area 27/19
112 Australia -- New South Wales -- Newcastle -- Stockton Bight — Pilotage 40/18
124 Australia -- New South Wales -- Perpendicular Point — Directions; ESSA 42/18
129 Australia -- East coast -- Coffs Harbour to Evans Head — Environmentally Sensitive 41/18
Sea Area
130 Australia -- East coast -- New South Wales -- Ballina — Major light 21/19
135 Australia -- East coast -- New South Wales -- Ballina — Directions; major light 21/19
139 Australia -- Queensland -- Brisbane -- North Stadbroke Island — Directions; ODAS 16/20
152 Australia -- Queensland -- Brisbane — Port regulations 45/19
156 Australia -- Queensland -- Moreton Bay -- St Helena Island — Directions; wreck 24/18
167 Australia -- East coast -- Queensland -- Wide Bay Harbour — Directions; light 38/19
178 Australia -- Queensland -- Port Bundaberg — Directions; lights 47/18
208 Australia -- Queensland -- Approaches to Mackay — Directions; alignment; position 09/20
226 Australia -- Queensland -- Approaches to Mackay — Pilotage; position 09/20
227--228 Australia -- Queensland -- Approaches to Mackay — Directions; leading lights; depth; 09/20
shoal
228 Australia -- Queensland -- Approaches to Mackay — Directions; shoal; position 09/20
241 Australia -- East coast -- Whitsunday Passage — Tidal streams 27/18
251 Australia -- Queensland -- Whitsunday Passage -- Grassy Island — Anchorage 42/18
255 Australia -- East coast -- Queensland -- Abbot Point — Pilotage 27/19
266 Australia -- East coast -- Queensland -- Lucinda — Pilotage 27/19
Wk26/20 4.15
IV
Weekly
266 Australia -- East coast -- Queensland -- Lucinda — Directions; pilotage; lights 27/19
266--267 Australia -- Queensland -- Lucinda — Directions; lights 24/18
266--267 Australia -- East coast -- Lucinda — Directions; shoal 08/19
266--267 Australia -- East coast -- Lucinda — Directions; pilotage; light 27/19
266--267 Australia -- Queensland -- Lucinda — Directions; lights 45/19
268 Australia -- East coast -- Queensland -- Hinchinbrook Channel — Directions; leading 52/18
lights
279 Australia -- Queensland -- Mourilyan — Anchorages 40/19
291 Australia -- Queensland -- Cairns — Pilotage 12/19
291 Australia -- East coast -- Queensland -- Approaches to Cairns — Pilotage 27/19
292 Australia -- Queensland -- Cairns — Directions; lights 42/19
306--307 Australia -- Queensland -- Cape Melville -- Pipon Islets — Directions; two--way route 40/19
307 Australia -- Queensland -- Cape Melville — Directions 40/19
317 Australia -- Queensland -- Cape Melville -- Fairway Channel — Routes 40/19
318 Australia -- Queensland -- King Island to First Three Mile Opening — Directions 40/19
318--319 Australia -- Queensland -- King Island to Eden Reef — Directions 40/19
359--360 Papua New Guinea -- Batumata Point to Buruma Point — Directions 44/19
360 Papua New Guinea -- Buruma Point to Dedele Point — Directions 44/19
360 Papua New Guinea -- Rothery Passage — Directions 44/19
362 Papua New Guinea -- Dedele Point — Anchorage 44/19
362--363 Papua New Guinea -- Dedele Anchorage — Directions 44/19
364 Papua New Guinea -- Dedele Point to Cape Rodney — Directions 44/19
364 Papua New Guinea -- Cape Rodney to Whitish Reef — Directions; lights 44/19
364 Papua New Guinea -- Whitish Reef to Aroma Passage — Directions; lights 44/19
366 Papua New Guinea -- Toveli Entrance — Directions; light 44/19
367 Papua New Guinea -- McFarlane Harbour — Directions; lights 44/19
368 Papua New Guinea -- McFarlane Harbour — Directions; light 44/19
369 Papua New Guinea -- Port Moresby — Directions; lights 24/18
372 Papua New Guinea -- South coast -- Port Moresby — Basilisk Passage — Controlling 05/20
depths
373 Papua New Guinea -- South coast -- Port Moresby — Submarine cable 21/19
396 Australia -- North coast -- Torres Strait -- Hockings Patches to Dalrymple Islet — 27/19
Pilotage
NP18 Baltic 1 18th Edition (2018) 43/18
88 Sweden -- Approaches to Göteborg -- Trubaduren to Tistlarna — Directions; light 50/19
101 Sweden -- Approaches to Göteborg -- Tistlarna to Valö — Directions; light 50/19
107 Sweden -- Southern approaches to Göteborg — Directions; light 50/19
110 Sweden -- West coast -- Göteborg -- Marieholmsbron — Regulations 11/19
110 Sweden -- West coast -- Göteborg -- Marieholmsbron — Regulations 17/20
118 Denmark -- Skagen Havn — Prohibited areas; development 31/19
120 Denmark -- Kattegat -- Frederikshavn — Prohibited areas 44/19
129 Denmark -- Kattegat -- Anholt — Prohibited areas 14/19
135 Sweden -- Varberg — Restricted area 21/19
144 Denmark -- Kattegat -- Sjællands Odde — Directions; light 02/19
144--145 Denmark -- Kattegat -- Sjællands Odde — Directions; light 02/19
155 Denmark -- Kattegat -- Roskilde Fjord -- Kulhus Rende — Directions; leading beacons 25/20
156 Denmark -- Frederikssund -- Roskilde Fjord -- Kronprins Frederiks Bridge — 31/19
Navigable width; vertical clearance
4.16 Wk26/20
IV
Weekly
156 Denmark -- Frederikssund -- Roskilde Fjord -- Kronprinsesse Mary’s Bridge — 31/19
Vertical clearance
156 Denmark -- Roskilde Fjord -- Hyldeholm — Vertical clearance 31/19
162 Denmark -- Kattegat -- Anholt — Directions; obstruction 02/20
166 Denmark -- Kattegat -- Svitringen Rende to south of Anholt — Directions; obstructions 02/20
167 Denmark -- Kattegat West -- Gjerrild Bugt — Anchorage 41/19
189 Sweden -- West coast -- Flintrännan — Controlling depth 09/19
199 Sweden -- The Sound -- Helsingborg to Landskrona — Recommended route 12/20
199--200 Sweden -- The Sound -- Helsingborg to Landskrona -- East of Ven — Directions 12/20
204 Denmark -- Københavns — Vertical clearance 22/19
206 Denmark -- København — Traffic regulations; prohibited areas 21/19
209 Denmark -- København -- Frederiksholmsløbet — Vertical clearance 03/19
210 Denmark -- København — Basins and berths; prohibited areas 21/19
212 Sweden -- Approaches to Malmö — Directions; obstruction 32/19
216 Sweden -- West coast -- Flintrännan — Controlling depth 09/19
237 Denmark -- Samsø Bælt -- Sejerø Bugt — Prohibited area 52/19
265 Denmark -- Storebælt northern part -- Storebæltsbroen — Vertical clearance 21/20
265 Denmark -- Storebælt -- Storebælt Link — Vertical clearance 24/20
270 Denmark -- Storebælt -- Kalundborg — Harbour 27/19
270 Denmark -- Storebælt -- Kalundborg — Berths 27/19
274 Denmark -- Storebælt -- Korsør Havn — Depth 43/19
278 Denmark -- Langelandsbælt -- Gulstav Flak — Prohibited area; wreck 45/19
310 Denmark -- Lillebælt -- Sønderborg — Prohibited area 09/19
314 Denmark -- Lillebælt southern part -- North--west of Skarø — Directions; obstruction 37/19
315 Denmark -- Lillebælt -- Fyn -- Faaborg Fjord — Submarine cables 14/19
325 Denmark -- Lillebælt southern part -- Skjoldnæs to Egholm Flak — Directions; 37/19
obstructions
333--334 Denmark -- Smålandsfarvandet western part -- Kirkegrund to Knudsskov Rev — 37/19
Directions
337 Denmark -- Skælskør -- Stigsnæsværkets Havn — Pilotage; berths 08/19
339 Denmark -- Smålandsfarvandet -- Karrebæksminde Bugt — Directions; light sector 37/19
341 Denmark -- Smålandsfarvandet -- Karrebæksminde — Directions; light sector 37/19
349 Denmark – Smålandsfarvandet – Southern passage — Pilotage 35/19
349 Denmark -- Smålandsfarvandet -- Storstrøm — Prohibited area 06/20
349 Denmark -- Smålandsfarvandet -- Storstrøm -- South of Masnedø — Prohibited area 12/20
350 Denmark -- Smålandsfarvandet -- Storstrøm -- Orehoved — Directions; light 16/20
350 Denmark -- Smålandsfarvandet -- Storstrøm — Directions; prohibited area 06/20
350 Denmark -- Storstrøm -- North--east of Orehoved Havn — Directions; prohibited area 50/19
352 Denmark -- Falster -- Orehoved Havn — Prohibited area 21/19
352 Denmark -- Storstrøm -- North--east of Orehoved Havn — Directions; prohibited area 50/19
352 Denmark -- Smålandsfarvandet -- Storstrøm -- Orehoved Havn — Directions 10/20
353 Denmark -- Smålandsfarvandet -- Masnedø -- Vordingborg Havn — Depths 37/19
353 Denmark – Smålandsfarvandet – Northern passage — Pilotage 35/19
354 Denmark -- Smålandsfarvandet -- Masnedsund — Prohibited area; bridge 43/19
354--355 Denmark -- Smålandsfarvandet -- Knudsskov Rev to Skippergrund — Directions; 37/19
buoyed channel
355 Denmark -- Smålandsfarvandet -- Sjælland--Farøbroen — Directions; buoyed channel 37/19
357 Denmark -- Smålandsfarvandet -- Masnedø -- Vordingborg Havn — Name; depths 37/19
357 Denmark -- Smålandsfarvandet -- Vordingborg Sydhavn — Directions 37/19
361 Denmark -- Guldborg Sund -- Østre Mærker — Directions 38/19
363 Denmark -- Fehmarn Belt -- Rødbyhavn — Prohibited area 25/20
Wk26/20 4.17
IV
Weekly
369 Germany -- Kieler Forde — Prohibited areas 34/19
372 Germany -- Kieler Bucht — Firing area; prohibited area 34/19
372 Germany -- Kieler Bucht -- Hohwachter Bucht — Anchorage 34/19
373 Germany -- Fehmarn -- Fehmarnsund--Brücke — Vertical clearance 07/20
377 Germany -- Die Schlei and Approaches -- Schleisand — Prohibited anchorage 07/20
379 Germany -- Die Schlei and Approaches -- Schleisand — Prohibited anchorage 07/20
386 Denmark -- Egernsund -- Egernsundbroen — Vertical clearance 43/18
398 Germany -- Lübecker Bucht -- Neustädter Bucht — Prohibited area 14/20
398 Germany -- Neustädter Bucht -- Hafen von Neustadt — General information; 10/19
prohibited area
401 Germany -- Baltic Sea -- Lübeck — Horizontal clearances 21/20
403 Germany -- North--north--east of Warnemünde — Restricted area; explosives 32/19
dumping ground
403 Germany -- Baltic Sea -- Warnemünde approaches — Prohibited area 49/19
403 Germany -- Baltic Sea -- Warnemünde approaches — Restricted area 01/20
403 Germany -- North--east of Warnemünde — Restricted area; explosives dumping 20/20
ground
404 Germany -- Baltic coast -- Rostock — Anchorage; wreck 39/19
404 Germany -- Rostock -- Warnemünde Reede — Anchorage 23/20
406 Germany -- Warnemünde -- Neuer Strom — Prohibited area 17/20
406 Germany -- Rostock -- Breitling — Prohibited area 19/20
411 Denmark -- Møn -- Hjem Bugt — Anchorage; obstructions 16/19
86 Poland -- Baltic Sea -- North of Rozewie — Submarine pipeline 36/18
92 Denmark – Bornholm – Rønne — Limiting conditions; dredged depth 35/19
92 Denmark -- Bornholm -- Rønne — Directions; buoy 15/18
92 Denmark -- Bornholm -- Rønne — Prohibited area 10/18
92 Denmark – Bornholm – Rønne — Harbour; general layout 35/19
92 Denmark -- Bornholm -- Rønne — Directions; buoy 15/18
93 Denmark – Bornholm – Rønne — Directions; south basin 35/19
93 Denmark – Bornholm – Rønne — Basins and berths; south basin 35/19
96 Denmark -- Bornholm -- Gudhjem — Pilotage 26/18
96 Denmark -- Bornholm -- Gudhjem — Directions; leading light 14/20
97 Denmark -- Bornholm -- Rønne — Directions; wreck, shoal, pilotage 23/18
97 Denmark -- Bornholm -- Bakkegrund — Directions; dangerous wreck 50/18
105 Sweden -- Gotland -- Visby — Pilotage 45/19
105 Sweden -- Gotland -- Visby — Development; pier 19/18
124 Sweden -- Hanöbukten -- Simrishamn — Directions; leading line 25/19
126 Sweden -- Åhus — Photograph 13/18
140 Sweden -- Approaches to Ronneby — Directions; lights; beacons; alignment 31/18
144 Sweden -- Approaches to Karlskrona -- Hasslö -- Hasslöbron — Horizontal clearance; 44/18
lights
153 Sweden -- Kalmarsund -- Degerhamn — Harbour; depths 13/19
155 Sweden -- Kalmarsund -- Kristianopel — Directions; alignment 19/18
167 Sweden -- North Kalmarsund -- Jättersön — Directions; buoys 27/18
174 Sweden -- Öland -- East coast — Restricted Area 47/19
181 Sweden -- East coast -- Oxelösund — Pilotage 19/20
181 Sweden -- Landsort — Pilotage 25/19
205 Sweden -- Approaches to Norrköping — Directions; leading lights 03/19
4.18 Wk26/20
IV
Weekly
213 Sweden -- Bråviken -- Norrköping -- Pumpushamnen — Directions; leading lights 45/19
215 Sweden -- Oxelösund -- Ljungskär — Directions; light sector 05/19
216 Sweden -- East coast -- Oxelösund — Berths; depths 26/19
230 Sweden -- Landsort -- Svärdsfjärden — Directions; light sectors 43/19
234 Sweden -- Södertälje Kanal — Traffic regulations 49/19
236 Sweden -- East coast -- Södertälje — Prohibited anchorage 18/19
241 Sweden -- Mälaren -- Stockholm -- Hässelby — Prohibited anchorage 43/19
246 Sweden -- Mälaren -- Hjulstafjärden -- Hästskär — Light sectors 31/19
257 Sweden -- Stockholms Skärgård -- Söderarm — Draught 30/18
258 Sweden -- Nynäshamn -- Norviks Hamn — General information; port 19/20
262 Sweden -- Stockholms Skärgård -- Landsort entrance — Traffic regulations 30/18
263 Sweden -- Mysingen -- Mysingeholm — Directions; light sector 19/20
264 Sweden -- North of Landsort -- Grisskär — Directions; light sector 19/20
265 Sweden -- Nynäshamn -- Furholmen — Restricted area 22/18
266 Sweden -- Nynäshamn — Development 19/20
266 Sweden -- Approach to Nynäshamn — Directions; channel; pilotage 25/19
267 Sweden -- Nynäshamn -- Norviks Hamn — Directions; route 19/20
268 Sweden -- Nynäshamn -- Norviks Hamn — General information; limiting conditions; 19/20
arrival information; directions; berths; port services
274 Sweden -- Stockholms Skärgård -- Approaches to Sandhamn — Traffic regulations 30/18
275 Sweden -- Stockholms Skärgård -- Approaches to Sandhamn — Traffic regulations 30/18
281 Sweden -- Stockholms Skärgård -- Oxdjupet — Directions; wreck 30/18
285 Sweden -- Stockholm -- Lidingöbron -- Vertical clearance 02/20
285--286 Sweden -- Stockholm -- Lidingöbron — Speed limit 25/20
287 Sweden -- Stockholm -- Karl Johansslussen — Restricted area 31/18
287 Sweden -- Stockholm — Regulations 12/18
288 Sweden -- Stockholm -- Södrahamnen — Development 12/18
289 Sweden -- Stockholm -- Ulvsundasjön — Directions; vertical clearance 06/18
289 Sweden -- Stockholm -- Frihamnen — Depth 31/19
290 Sweden -- Port of Stockholm — Basins and berths; alongside depth 19/18
296 Sweden -- Stockholms Skärgård -- Söderarm entrance — Traffic regulations 30/18
296 Sweden -- Stockholms Skärgård -- Tjärven fairway — Traffic regulations 30/18
299 Sweden -- East coast -- Kapellskär — Berths 37/18
299 Sweden -- East coast -- Kapellskär — Depths 27/19
304 Sweden -- Stockholms Skärgård -- Simpnäs fairway — Traffic regulations 30/18
307 Sweden -- East coast -- Norrtälje — Bridge 16/20
312 Poland -- Arkona to Rozewei -- South of Ławica SÞupska — Directions; rock 38/19
312 Germany -- Baltic Sea -- Adlergrund — Prohibited area 02/19
312 Germany -- Kap Arcona -- West of Adlergrund — Prohibited area 47/19
313 Germany -- Baltic Sea -- Sassnitz — Prohibited areas 29/19
313 Germany -- Baltic Sea -- Prorer Wiek -- Sassnitz — Prohibited areas 51/19
321 Germany -- Strelasund -- Stralsund east — Draughts 44/19
323 Germany -- Approaches to Wolgast — Speed limit 42/18
325 Germany -- Wolgast Hafen — Speed limit 42/18
328 Germany -- Baltic South Shore -- Zatoka Pomorska — Prohibited area 51/18
340 Poland -- Szczecin -- Parnica — Berths; depths 36/18
341 Poland -- West and north--north--west of Mrzeÿyno — Directions; wrecks 10/18
341 Poland -- Dziwna to Port DarÞowo — Directions; wrecks 28/19
Wk26/20 4.19
IV
Weekly
345 Poland -- Rowy to Łeba — Nature reserve 24/18
355 Poland -- Gdynia — Pilotage 36/18
355 Poland -- Gdynia — Tugs 36/18
355 Poland -- Gdynia — Restricted area 40/18
357 Poland -- Gdynia — Obstructions 36/18
357 Poland -- Gdynia — Berths; obstructions 40/18
358 Poland -- Gdamsk -- Martwa Wisla — Vertical clearance 45/19
358 Poland -- Gdamsk — Anchorage; wreck 29/18
358 Poland -- Gdamsk — Anchorage; foul ground 18/20
359 Poland -- Gdamsk — Pilotage 36/18
361 Poland -- PóÞnocny — Pilotage 36/18
361--362 Poland -- Port PóÞnocny -- Basen Paliw PÞynnych — Draughts 13/18
362 Poland -- Gdamsk -- Rzeka WisÞa ©miaÞa — Bridge clearances 07/19
374 Russia -- Southern Baltic -- Kaliningrad -- Pionerskiy — Terminal information 16/19
376 Lithuania -- KlaipÌda — Directions 21/19
383 Latvia -- West coast -- Approaches to Liepºja — Directions; buoyed channel 21/20
384 Latvia -- South--south--west of Ventspils -- Banka Somnitelnaja sÏklis — Directions; 32/19
buoy
385 Latvia -- Ventspils — Prohibited anchorage 32/19
398 Latvia -- SalacgrØva — Controlling depths 36/18
404 Estonia -- Saaremaa -- Suur Katel — Directions; wrecks 31/18
405 Estonia -- Roomassaare — Directions; light sector 01/19
414 Estonia -- Saaremaa -- Veere — Pilotage 09/20
419 Estonia -- Outer approaches to Väinameri -- Osmussaar — Directions; wreck 02/20
420 Estonia -- Noarootsi -- Voosi kurk — Directions; underwater rock 27/19
423 Estonia -- East of Muhu -- Suur väin — Directions; wreck 17/19
423 Estonia -- Väinameri -- Vormsi -- Sviby — Pilotage 11/19
424 Estonia -- Muhu Väin -- Rohuküla — Pilotage 11/19
425 Estonia -- Muhu Väin -- Hiiumaa -- Heltermaa — Pilotage 11/19
86 Finland -- Gulf of Bothnia -- Norra Kvarken — Directions; shoal 29/19
89 Russia -- Gulf of Finland -- Ostrov Sommers to Ostrov Seskar — Directions; 43/19
regulated areas
96 Estonia -- Osmussaar — Directions; wreck 02/20
97 Estonia -- Paldiski — Prohibited area 23/20
98 Estonia -- Paldiski — Directions; lights; buoys 43/19
98 Estonia -- Paldiski — Anchorages 43/19
98 Estonia -- Paldiski — Anchorage 23/20
108 Estonia -- North coast -- Eru Laht -- Muuga Sadam to Letipea Neem — Directions; 19/20
wreck
111 Russia -- Gulf of Finland -- Ostrov Seskar -- Winter Channel — Depth 42/19
117 Russia -- Gulf of Finland -- Approaches to Luzhskaya Guba — Directions; regulated 43/19
area
118 Russia -- Gulf of Finland -- Ust’--Luga — Directions 47/19
119 Russia -- Gulf of Finland -- Approaches to Ust’--Luga — Anchorages 45/19
119 Russia -- Gulf of Finland -- Ust’--Luga — Anchorage 47/19
127 Russia -- Sankt Peterburg -- Kronshtadtskiy Korabel’nyy Farvater — Directions; 43/19
regulated area
151 Finland -- Gulf of Finland -- Tärngrundet -- Träskö — Directions; lights 29/19
167 Finland -- Gulf of Finland -- Approaches to Helsinki — Directions 15/20
167 Finland -- Helsinki -- Tiirakari Tirgrund — Directions; leading lights 01/20
4.20 Wk26/20
IV
Weekly
168 Finland -- Gulf of Finland -- Approaches to Helsinki — Directions; regulations 30/19
168 Finland -- Helsinki -- Lokkiluoto — Directions; leading lights 01/20
169 Finland -- Gulf of Finland -- Helsinki — Directions; regulations 30/19
174 Finland -- Gulf of Finland -- Approaches to Vuosaari — Directions; 110 m channel 16/20
174 Finland -- Gulf of Finland -- Approaches to Vuosaari — Directions; regulations 30/19
177 Finland -- Gulf of Finland -- Approaches to Vuosaari — Directions; 110 m channel 16/20
192 Finland -- Loviisa, Valko and approaches — Directions; leading lights 38/19
193 Finland -- Gulf of Finland -- Approaches to Kokta — Pilotage 30/19
194 Finland -- Gulf of Finland -- Kotka — Directions; light 08/20
198 Finland -- Gulf of Finland -- Approaches to Kokta — Directions; regulations 30/19
204 Finland -- Gulf of Finland -- Approaches to Hamina — Directions; regulations 30/19
207 Finland – Hamina — Basins and berths; draught; navigation marks 29/19
215 Russia -- Gulf of Finland -- Vysotsk — LNG terminal 01/20
220 Russia -- Approaches to Primorsk -- East of Ostrov Seskar — Outer anchorages; 19/20
obstruction
221 Russia -- Gulf of Finland -- Approaches to Primorsk — Directions; regulated areas 43/19
239 Finland -- Saaristomeri -- Utö -- Svartgrund — Prohibited anchorage 29/19
242 Finland -- Utö to Lövskär -- Svartgrund — Prohibited anchorage 29/19
243 Finland -- Saaristomeri -- Lövskär to Orhisaari — Directions; regulations 30/19
248 Finland -- South west coast -- Rödhamnsfjärden — Directions; regulations 30/19
251 Finland -- Gulf of Finland -- Ahvenanmaa -- Hässlö channel — Directions; regulations 30/19
256 Finland -- South--west coast -- Isokari to Laupunen — Directions; leading light 35/19
258 Finland -- Saaristomeri -- Laupunen to Rajakari — Directions; regulations 30/19
261 Finland -- South west coast -- Turku and approaches — Regulations 30/19
266 Finland -- Åland Islands -- Maarianhamina — Directions 02/20
268 Finland -- Ålands Hav -- Ahvenanmaa — Directions; light 29/19
321 Finland -- Gulf of Bothnia -- Pietarsaari — Regulations 30/19
323 Finland -- Gulf of Bothnia -- Kokkola — Traffic regulations 30/19
328 Finland -- Gulf of Bothnia -- Raahe — Regulations 30/19
333 Finland -- Gulf of Bothnia -- Approaches to Oulu — Directions; regulations 30/19
334 Finland -- Gulf of Bothnia -- Oulu--Toppila — Draught 33/19
335 Finland -- Gulf of Bothnia -- Oulu--Toppila — Directions; draught 33/19
336 Finland -- Gulf of Bothnia -- Approaches to Oulu — Directions; regulations 30/19
340 Finland -- Gulf of Bothnia -- Kemi — Regulations 30/19
341 Finland -- Gulf of Bothnia -- Kemi and approaches — Directions; draught 19/20
342 Finland -- Gulf of Bothnia -- Kemi to Röyttä — Traffic regulations 30/19
346 Sweden -- Entrance to the Gulf of Bothnia -- Ålands Hav -- Grisslehamn — Pilotage 50/19
347 Sweden -- Entrance to the Gulf of Bothnia -- Ålands Hav -- Svartklubben — Pilotage 50/19
354 Sweden -- Entrance to the Gulf of Bothnia -- Ålands Hav -- Hargshamn — Pilotage 50/19
354 Sweden -- Gulf of Bothnia -- Hargshamn — Depth 32/19
355 Sweden -- Entrance to the Gulf of Bothnia -- Ålands Hav -- Hallstavik — Pilotage 50/19
357 Sweden -- Entrance to the Gulf of Bothnia -- Ålands Hav -- Väddö Kanal — Pilotage 50/19
429 Sweden -- Gulf of Bothnia -- Järnäshamn — Directions; beacons 29/19
446 Sweden -- Gulf of Bothnia -- Sikeå — Directions; beacon 25/20
448 Sweden -- Gulf of Bothnia -- Piteå — Pilotage 06/20
452 Sweden – Skelleftehamn – Gåsören to Sörfjärden — Directions; lights 29/19
461 Sweden -- Gulf of Bothnia -- Luleå — Directions; leading beacon; speed limit 29/19
463 Sweden -- Luleå -- Sandöleden — Regulations 03/20
Wk26/20 4.21
IV
Weekly
NP21 Bay of Bengal 13th Edition (2019) 20/19
71 India -- East coast -- Cuddalore — Anchorage; terminal 20/19
77 India -- East coast -- Kamarajar Port — Outer anchorages; pilotage 19/20
78 India -- East coast -- Approaches to Chennai -- Port of Kattupalli — STS area 06/20
78--79 India -- East coast -- Kattupalli Port — Directions; lights 45/19
85 India -- East coast -- Gangavaram Port — Anchorages 20/19
87 India -- East coast -- Visºkhapatnam — Depths 20/19
87 India -- East coast -- Visºkhapatnam — Depths 03/20
87 India -- East coast -- Visºkhapatnam — Anchorages 20/19
118 India -- North--east coast -- The Sandheads to Matla River -- Matla River — 20/19
Directions; wreck
121--122 Bangladesh -- Pussur River to Sandwip Channel — Directions 20/19
153 Burma -- Gulf of Martaban -- Yangon River — Directions; platform 30/19
154 Burma -- Gulf of Martaban -- Yangon River approaches — Pilotage 30/19
155 Burma -- Gulf of Martaban -- Yangon River approaches — Directions; platform 30/19
156 Burma -- Gulf of Martaban -- Yangon River approaches — Pilotage 30/19
156 Burma -- Port of Yangon — Development; bridge 50/19
NP22 Bay of Biscay 14th Edition (2019) 28/19
66 France – Anse de Bénodet -- Loctudy -- L’Odet River — Pilotage 28/19
190--191 France -- Bay of Biscay -- Port Autonome de Bordeaux — Pilotage 21/20
197 France -- West coast -- Bay of Biscay -- La Garonne — Vertical clearance 48/19
206 France -- Bay of Biscay -- Bassin d’Arcachon — Pilotage 21/20
237 Spain -- Bay of Biscay -- Bilbao — Vertical clearance 10/20
240 Spain -- Bay of Biscay -- Bilbao — Directions; vertical clearance 10/20
250 Spain -- Bay of Biscay -- Santander — Anchorage; caution 50/19
250 Spain -- Bay of Biscay -- Santander — Traffic regulations 50/19
252 Spain -- Bay of Biscay -- Santander -- Ría de Astillero — Regulations 50/19
254 Spain -- North coast -- Ría de Suances — Wreck 38/19
270 Spain -- Ría de Avilés -- Dársena de San Agustín — Directions; wreck 07/20
276 Spain -- North coast -- Ría de Ribadeo — Pilotage 28/19
279--280 Spain -- North coast -- Ensenada de San Cibrao -- San Cibrao — Pilotage 08/20
282 Spain -- North coast -- Ría de Viveiro — Anchorage 35/19
NP23 Bering Sea and Strait 9th Edition (2019) 30/19
137 United States of America -- Alaska -- Alaska Peninsula -- Cape Kumlik -- Sutwik 17/20
Island -- Foggy Cape — Wreck
219 United States of America -- Aleutian Islands -- Atka Island — Wreck 40/19
380 Russia -- Bering Sea -- Anadyrskiy Gulf -- Port Provideniya — Pilotage 40/19
396 Russia -- Siberia -- Kolyuchinskaya — Nature reserve 02/20
NP24 Black Sea and Sea of 6th Edition (2019) 07/17
Azov
72 Turkey -- Çanakkale BoÔazÝ -- ™ntepe Liman — Anchorage 51/19
79 Turkey -- Çanakkale BoÔazÝ -- ™nce Burnu — Anchorages 04/20
79 Turkey -- Marmara Denizi -- ™nce Burnu — Anchorages 05/20
87 Turkey -- Marmara Denizi -- BandÝrma Körfezi — Directions; buoy 40/19
87 Turkey -- Marmara Denizi -- BandÝrma Körfezi -- Mola BankÝ — Directions; buoy 17/20
94--95 Turkey -- Marmara Denizi -- AmbarlÝ LimanÝ — Outer anchorages 15/20
97 Turkey -- ™zmit Körfezi -- Hereke — Anchorages 46/19
97 Turkey -- Marmara Denizi -- ™zmit Körfezi — Anchorages 50/19
103 Turkey -- ™stanbul BoÔazÝ -- Kadiköy— Outfall pipe 43/19
121 Turkey -- Black Sea -- ¬ile — Anchorages; pipeline 42/19
131 Turkey -- Usta Burnu to ™nce Burun -- AyancÝk — Anchorage 12/20
4.22 Wk26/20
IV
Weekly
135 Turkey -- Samsun Körfezi to Yasun Burnu -- Fatsa Körfezi — Anchorage 12/20
139 Turkey -- Black Sea -- Görele — Anchorages 05/20
149 Georgia -- Black Sea -- P’ot’i — Anchorages 15/20
163 Bulgaria -- Black Sea -- Varna — Pilotage 37/19
204 Ukraine -- Black Sea -- Port Yuzhnyy (Port Pivdennyi) — Name 05/20
204 Ukraine -- Black Sea -- Port Yuzhnyy (Port Pivdennyi) — Depth 05/20
205 Ukraine -- Black Sea -- Port Yuzhnyy (Port Pivdennyi) — Obstructions 05/20
205 Ukraine -- Black Sea -- Port Yuzhnyy — Anchorage 47/19
205 Ukraine -- Black Sea -- Port Yuzhnyy (Port Pivdennyi) — Harbour 05/20
207 Ukraine -- Black Sea -- Port Yuzhnyy — Anchorages 47/19
231 Black Sea -- Crimean Peninsula -- Ozero Donuzlav — Submarine cable 47/19
272 Ukraine -- Black Sea -- Kerch Strait -- Kerch--Yenikal Channel — Vertical clearance 25/20
274 Russia -- Black Sea -- Kerch Strait -- Port Taman’ — Directions 10/20
277 Black Sea -- Kerch--Yenikal Channel — Anchorage 10/20
280 Black Sea -- Kerch--Yenikal Channel — Anchorage 10/20
292 Russia -- Sea of Azov -- Port Temryuk — Anchorages 13/20
NP25 British Columbia 1 17th Edition (2019) 38/19
72 Canada -- Vancouver Island -- Esquimalt Harbour -- Inskip Island — Directions; 41/19
leading lights
165 Canada -- Vancouver Island -- Saanich Inlet — Platform 19/20
165 Canada -- Vancouver Island -- Saanich Inlet — Directions; platform 19/20
173 Canada -- Strait of Georgia -- Nanaimo -- Dodd Narrows — Vertical clearance 19/20
211 Canada -- Vancouver Island -- Nanaimo — Pilotage 41/19
251 Canada – Desolation Sound east side -- Lancelot Inlet — Anchorages; wreck 38/19
330 Canada -- Barkley Sound -- Trevor Channel — Directions; light sector 02/20
NP26 British Columbia 2 11th Edition (2017) 11/17
112 Douglas Channel -- Gertrude Point — Directions; light 22/17
136 British Columbia -- Approaches to Prince Rupert -- Chatham Sound — Directions; 19/20
ODAS
137 Prince Rupert — Port information 33/19
137 Prince Rupert — Port information; under--keel clearance 33/19
138 Prince Rupert Harbour — Pilotage 33/19
138 Prince Rupert Harbour — Regulations 33/19
140 Prince Rupert Harbour — Depths 33/19
141 Prince Rupert Harbour — Depths 33/19
158 Queen Charlotte Sound -- Calvert Island — General information; traffic regulations 22/17
176 Hecate Sound -- Price Island — General information; traffic regulations 22/17
180 Hecate Strait -- Bonilla Island — General information; traffic regulations 22/17
188 British Columbia -- Pitt Island -- Otter Channel — Light 44/17
190 British Columbia -- Pitt Island -- Otter Channel — Lights 44/17
197 Canada -- Hecate Strait -- Browning Entrance to Dundas Island — Directions; shoal; 23/17
buoyage
213 British Columbia -- Moresby Island -- Juan Perez Sound -- Matheson Inlet — Depth 30/18
242 British Columbia -- West coast of Graham Island — Caution; depths 30/18
NP27 Channel 12th Edition (2018) 45/18
iii Preface page 45/18
4 Jersey -- Bay of Granville — Fishery limits 18/20
4 United Kingdom -- Channel Islands — Fishery limits 11/19
Wk26/20 4.23
IV
Weekly
13 France -- North coast — Navigation in Internal Waters; Prefectural Order 23/20
107 England -- South coast -- Saint Austell Bay — Directions; shoal 03/20
165 England -- South coast -- Portland — Prohibited area 08/20
192 United Kingdom -- South coast -- Southampton — Regulations; towage 25/20
199 England -- The Solent -- Beaulieu River — Anchorage 43/19
210 England -- Portsmouth — Regulations 44/19
212 England -- Portsmouth — Traffic signals 29/19
217 England -- Portsmouth -- Haslar Lake — Depths 24/19
218 England -- Portsmouth -- Haslar Lake — Depths 24/19
225 England -- South coast -- Isle of Wight -- Cowes — Controlling depth 38/19
225 England -- Isle of Wight -- Cowes — Regulations 22/20
226 England -- South coast -- Isle of Wight -- Cowes — Regulation; channel name 38/19
227 England -- South coast -- Isle of Wight -- Cowes — Channel name; directions 38/19
228 England -- South coast -- Isle of Wight -- Cowes — Watersports area 38/19
229 United Kingdom -- South coast -- Southampton — Regulations; towage 25/20
247 France -- West coast -- Île d’Ouessant -- Chenal du Four — Directions; depth 35/19
248 France -- West coast -- Île d’Ouessant -- Chenal du Four — Directions; depths 35/19
255 France -- Avant--Goulet de Brest -- Waiting area to Brest — Buoyage 45/18
258 France -- West coast -- Brest — Outer anchorages; submarine cables 48/19
265 France -- West coast -- Douarnenez — Pilotage 45/18
282 France -- North--west coast -- Roscoff — Pilotage 05/20
286 France -- North--west coast -- Baie de Morlaix — Pilotage 05/20
342 Channel Islands -- Guernsey — Anchorages 03/19
342 Channel Islands -- Guernsey -- Saint Peter Port — Anchorages 14/19
342 Channel Islands -- Guernsey -- Saint Peter Port — Anchorages 14/19
375 Channel Islands -- Jersey -- Saint Catherine’s Bay — Anchorage 51/18
383 France -- Cherbourg -- Cap de Flamanville — Obstructions 16/20
387 France -- North coast -- Cherbourg — Pilotage 05/20
390 France -- Approaches to Cherbourg — Pilotage 11/19
390 France -- North coast -- Cherbourg — Prohibited areas 05/20
390 France -- North coast -- Cherbourg — Development; prohibited area 05/20
391 France -- Cherbourg — Directions; obstructions 22/19
392 France -- Cherbourg — Anchorages; depths 22/19
393 France -- Approaches to Cherbourg — Terminal 11/19
394 France -- Approaches to Cherbourg — Terminal 11/19
398 France -- North coast -- Baie de Seine -- Pointe du Hoc — Traffic regulations 10/19
Last page Last page 45/18
NP28 Dover Strait 12th Edition (2017) 34/17
12 France -- North coast — Navigation in Internal Waters; Prefectural Order 23/20
12 France -- North coast — Regulation of navigation in internal waters; prefectural order 25/20
60 England -- Dover Strait -- North--west of Sandettié Bank — Unexploded ordinance 28/18
60 Belgium -- Dover Strait -- Kwintebank — Prohibited anchorage 26/20
61 Belgium -- Westhinder — Obstructions 49/17
61 Belgium -- Dover Strait -- Oostdyck — Anchorage; obstruction 25/20
63 Netherlands -- North Hinder Junction — Directions; wreck 44/19
66 England -- Dover Strait -- North--west of Sandettié Bank — Directions; unexploded 28/18
ordinance
4.24 Wk26/20
IV
Weekly
73 England -- Littlehampton — Directions; caution 45/18
83 England -- South coast -- Beachy Head — Directions; light 37/18
86 England -- South coast -- Beachy Head — Directions; light 37/18
94 England -- South--east coast -- Dover — Regulations 14/18
94 England -- Dover Harbour — Traffic regulations; speed 04/19
111 France -- North coast -- Fécamp — Pilotage 25/19
113 France -- North coast -- Dieppe — Prohibited area 40/19
114 France -- North coast -- Approaches to Fécamp — Directions; wrecks 07/19
126 France -- North coast -- Boulogne--sur--Mer — Regulations; speed limits 23/20
127 France -- North coast -- Boulogne--sur--Mer — Pilotage 25/19
128 France -- North coast -- Boulogne--sur--Mer — Regulations; speed limits 25/20
139 France -- Calais — Basins and berths; depths 47/17
145 France -- Dunkerque — Pilotage 06/20
161--162 Belgium -- Thornton Bank — Buoyage 35/17
162 Belgium -- North Sea -- Thornton Bank and Lodewijbank — Wind farms 17/18
162 Belgium -- North Sea -- North west of Oostende — Pilotage 23/18
162 Netherlands -- North Sea -- Schouwenbank Junction -- Steenbank — Pilot station 46/17
163 Belgium -- Westerschelde and approaches — Shore based pilotage 07/20
163 The Netherlands -- Westerschelde -- Westkapelle — Pilotage 45/18
166 Belgium -- Thornton Bank — Buoyage 35/17
167 Belgium -- Approaches to Zeebrugge — LNG tanker regulations 23/18
167 Belgium -- Wandelaar pilot station to Rede van Vlissingen -- Zeebrugge — LNG 07/20
regulations
168 Belgium -- Approaches to Westerschelde — Directions; light buoys 02/19
176 Netherlands -- North Hinder Junction — Directions; buoyage 35/17
188 Belgium -- Gent--Terneuzen Canal -- Zelzate — Vertical clearance 40/19
190 Netherlands -- Westerscheldt -- Hansweert -- Zuidergat — Traffic regulations; cross 02/20
currents
190 Netherlands -- Westerscheldt -- Hansweert -- Zuidergat — VTS; cross current 02/20
195 Belgium -- Antwerp — Overhead power cables 51/18
195--196 Belgium -- Antwerp -- Kieldrechtsluis — Lock dimensions 13/18
203 Netherlands -- Schouwendiep — Directions; buoyage 47/17
210 Netherlands -- Moerdijk — Harbour; depths 34/19
224 Netherlands -- North Sea -- North Hinder Junction — Anchorage; wreck; foul ground 49/19
224 Netherlands -- North Sea -- Maas West Outer TSS — Anchorages; obstructions 51/19
227 Netherlands -- Rotterdam -- Nieuwe Maas — Depths 40/19
228 Netherlands -- Rotterdam -- Willemsbrug — Vertical clearance 40/19
243 England -- Thames Estuary — Pilotage 35/17
244 England -- Thames Estuary — Pilotage 35/17
244 England -- Thames Estuary — Draught, pilotage 45/18
273 England -- Felixstowe -- Sledway — Anchorage 42/18
294 England -- River Colne -- Brightlingsea — Directions; buoy 22/18
307 River Thames -- Sea Reach -- Canvey Island — Berths 32/18
309 England -- River Thames -- Tilbury — Chimney 43/17
310 England -- River Thames -- Tilbury Power Station — Depths 47/17
315 England -- River Thames -- Long Reach Esso Terminal — Depths 47/17
327 England -- River Medway -- Isle of Grain — Berths 42/17
335 England -- The Swale -- Kingsferry Bridge — Vertical clearance 47/17
Wk26/20 4.25
IV
Weekly
NP30 China Sea 1 11th Edition (2018) 29/18
6 China -- Approaches to Hong Kong — Traffic Separation Scheme 44/18
6 China — National regulations 05/19
7 Malaysia — Regulations; National Heritage Zones 29/18
88 Malaysia -- East coast -- Pulau Tioman — Marine nature reserves 07/19
96 Malaysia -- East coast -- Kuantan — Controlling depths 06/19
96 Malaysia -- East coast -- Kuantan Port — Anchorages; pilotage 49/18
96 Malaysia -- East coast -- Kuantan — Prohibited anchoring 06/19
96 Malaysia -- East coast -- Kuantan — Breakwaters 06/19
97 Malaysia -- East coast -- Kuantan — Directions; breakwaters 06/19
97 Malaysia -- East coast -- Kuantan — Directions; deepwater terminal 06/19
103 Malaysia -- East coast -- Pulau Bidung Laut — Directions; National Heritage Zone 29/18
105 Malaysia -- Pulau Redang — Marine park 29/18
114 Thailand -- West coast -- Laem Na Tham to Ko Phangan — Directions; lights; depth 22/19
115 Thailand -- West coast -- Laem Na Tham to Ko Phangan — Directions; lights 22/19
116 Thailand -- West coast -- Ko Samui — Berths; light 22/19
116 Thailand -- West coast -- Chong Ko Tao — Directions; light 22/19
122 Thailand -- Laem Phak Bia to Bangkok Bar Light — Wreck 22/19
141 Vietnam – Dao Phu Quoc – Directions; wreck 03/20
144 Vietnam -- West coast -- Quan--Dao Hai Tac — Vertical clearance 03/20
145 Vietnam -- West coast -- Quan--Dao Hai Tac — Vertical clearance 03/20
156 Vietnam -- Approaches to Mekong River -- Long Khanh Point to Mui Vung Tau — 19/20
Directions; wreck
159 Vietnam -- South coast -- Can Tho — Depths 49/18
159 Vietnam -- Mekong River -- Can Tho — Directions; channel 14/19
159 Vietnam -- South coast -- Mekong River -- Can Tho — Anchorages 12/20
161 Vietnam -- Song Sai Gon -- Cua Soirap — Depths 29/18
162 Vietnam -- Approaches to Ho Chi Minh City -- Nha Be River — Vertical clearances 14/20
164 Vietnam -- Approaches to Ho Chi Minh City -- Song Sai Gon — Directions; wreck 14/20
165 Vietnam -- South coast -- Song Sai Gon -- Cua Soirap — Directions; light 08/20
165 Vietnam -- Approaches to Ho Chi Minh City -- Nha Be River — Directions; light; 14/20
vertical clearance
166 Vietnam -- Song Cai Mep — Berth; depth 29/18
167 Vietnam -- Vung Tau — Anchorages; wrecks 03/20
167 Vietnam -- South coast -- Vung Tau — Berths; depths 25/19
170 Vietnam -- South--east coast -- Ho Chi Minh City — Depths 30/19
172 Vietnam -- South--east coast -- Mui Vung Tau — Directions; wreck 13/19
185 Vietnam -- East coast -- Approaches to Quy Nhon — Directions; wreck 03/20
186 Vietnam -- Quy--Nhon — Depths 29/18
186 Vietnam -- Quy--Nhon — Depths 24/19
186 Vietnam -- South central coast -- Quy--Nhon — Directions; anchorages 48/19
186 Vietnam -- East coast -- Quy--Nhon — Directions; wreck 38/19
187 Vietnam -- Vung Xuan Dai — Anchorage 18/20
190 Vietnam -- East coast -- Approaches to Œa Nang — Directions; light 17/20
190 Vietnam -- South China Sea -- Dung Quat — Depths; anchorage; pilotage 21/19
190 Vietnam -- North--east coast -- Dung Quat — Restricted area 34/19
190 Vietnam -- South central coast -- Dung Quat — Directions 03/19
193 Vietnam -- East coast -- Ky Ha--Quang Nam Port — Pilotage 10/20
193 Vietnam -- East coast -- Approaches to Œa Nang -- Cu Lao Cham — Anchorages; 17/20
rocks
196 Vietnam -- North--west of Œa Nang -- Vung Chan May — Directions; major light 36/19
4.26 Wk26/20
IV
Weekly
196 Vietnam -- Gulf of Tonkin -- Mui Lay — Directions; light 24/19
198 Vietnam -- Gulf of Tonkin -- Mui Lay — Directions; light 24/19
198 Vietnam -- Gulf of Tonkin -- Mui Lay to Mui Ron Ma — Directions; wreck 17/20
202 Vietnam – Gulf of Tonkin – Nghi Son — Anchorages; pilotage; restricted and 03/20
prohibited areas
202 Vietnam – Gulf of Tonkin – Nghi Son — Directions; wreck 03/20
202 Vietnam – Gulf of Tonkin – Nghi Son — Berths 03/20
203 Vietnam – Gulf of Tonkin – Hon Mé — Anchorages 03/20
205 Vietman -- Gulf of Tonkin -- Lach Truong to Hon Dau — Directions; wrecks 44/19
205 Vietnam – Gulf of Tonkin – Approaches to Song Ca — Anchorage 03/20
205 Vietnam – Gulf of Tonkin – Approaches to Song Ca — Anchorage 26/20
207 Vietnam -- Hai Phong — Depth 29/18
207 Vietnam -- North--east coast -- Hai Phong — Depths 33/19
207 Vietnam -- Haiphong -- Luong Hai Phong — Vertical clearance 37/18
207 Vietnam -- Hai Phong — Vertical clearance 31/18
207 Vietnam -- North--east coast -- Approaches to Hai Phong — Vertical clearances 22/19
207 Vietnam -- North--east coast -- Approaches to Hai Phong — Vertical clearance 24/19
207 Vietnam -- Approaches to Hai Phong — Vertical clearances 03/20
207 Vietnam -- North--east coast -- Hai Phong — Anchorage 07/19
207 Vietnam -- North--east coast -- Hai Phong — Anchorages 04/20
207 Vietnam -- North--east coast -- Hai Phong — Pilotage 33/19
208 Vietnam -- North--east coast -- Hai Phong — Prohibited area; submarine pipeline 22/19
208 Vietnam -- North--east coast -- Approaches to Hai Phong — Development 22/19
209 Vietnam -- Approaches to Hai Phong — Directions; pilotage; buoyage 03/20
210 Vietnam -- Haiphong -- Luong Hai Phong — Anchorages 34/18
209--210 Vietnam -- Approaches to Hai Phong — Anchorages and moorings 03/20
210 Vietnam -- Outer Approaches to Hai Phong -- Cat Hai — Directions; development 37/18
212 Vietnam -- Gulf of Tonkin -- Approaches to Quang Ninh — Directions; wreck 38/18
213 Vietnam -- Gulf of Tonkin -- Quang Ninh — Depth 34/18
213 Vietnam -- Quang Ninh Port — Berths 47/18
216 Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi Long -- Passe du Casque — 14/20
Anchorage
216 Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi Long — Directions; light 49/18
218 Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi Long — Directions; light 49/18
219 China -- Gulf of Tonkin -- Fangcheng Gang — Anchorages; wreck 29/18
227 China -- Gulf of Tonkin -- Beihai Gang — Depth 33/19
229 China -- Gulf of Tonkin -- Tieshan Gang — Controlling depths; pilot boarding; harbour 36/19
229 China -- Gulf of Tonkin -- Tieshan Gang — Anchorage 35/18
229 China -- Gulf of Tonkin -- Tieshan Gang — Controlling depths; pilot boarding; harbour 36/19
229--230 China -- Gulf of Tonkin -- Tieshan Gang — Directions 36/19
230 China -- Gulf of Tonkin -- Tieshan Gang — Side channel; basin and berths 36/19
230 China -- Gulf of Tonkin -- Tieshan Gang — Directions; buoyage; depths 16/20
232 China -- Hainan Dao -- Qiongzhou Haixia — Traffic regulations 18/20
235 China -- Hainan Dao -- Macun Gang — Pilotage 45/18
235 China -- Qiongzhou Haixia -- Chengmai Wan -- Macun Gangqu — Directions 09/19
238 China -- Hainan Dao -- North coast -- Puqian Wan — Anchorage 33/19
241 China -- Yulin Jiao -- Basuo Gang and approaches — Directions; wreck 29/18
242 China – Hainan Dao -- Basuo — Outer anchorages; wreck 31/19
242 China -- Gulf of Tonkin -- Hainan Dao -- Basuo Gang — Pilotage 16/20
242 China -- Gulf of Tonkin -- Hainan Dao -- Basuo Gang — Pilotage 23/20
244 China -- South coast -- Yangpu — Pilotage 49/19
Wk26/20 4.27
IV
Weekly
246 China -- South coast -- Yangpu to Lingao Jiò — Directions; wreck 29/18
248 China -- Gulf of Tonkin -- Hainan Dao -- Sanya Wan — Anchorage 41/18
248--249 China -- Hainan Dao -- Sanya — Directions; lights 29/18
249 China -- Hainan Dao -- Lingshui Jiao — Directions; platform 42/18
255 China -- South China Sea -- Zhanjiang Gang — Prohibited area 17/20
257 China -- South coast -- Zhanjiang — Directions; lights; buoyage 40/19
257 China -- South coast -- Zhanjiang — Directions; lights; buoyage 44/19
259 China – Zhanjiang to Shui Dong — Directions; pilotage 31/19
260 China – Shui Dong — Pilotage 31/19
260 China -- South coast -- Shuidong — Bridge construction 39/19
261 China – Shui Dong to Yangjiang — Directions; pilotage 31/19
261 China -- Shui Dong to Yangjiang -- South--east of Bohe Xingangqu — Directions; 09/20
wind farm
263 China -- South coast -- Yangjiang to Gaolan — Pilotage; bouyage 35/19
264 China -- South coast -- Yangjiang to Gaolan — Directions; pilotage; buoyage 35/19
265 China -- South coast -- Taidian — Depth 03/19
266 China -- Huangmao Hai -- T’an Chiang -- Yamen Daqiao Bridge — Vertical clearance; 41/18
anchorages
267 China -- South coast -- Gaolan — Pilotage 35/19
267 China -- South China Sea -- Gaolan — Pilotage 19/20
267 China -- South China Sea -- Gaolan — Pilotage 23/20
267 China -- South coast -- Gaolan — Directions; buoyage 35/19
268 China -- South coast -- Gaolan to Dahengqin Dao — Directions; buoyage 35/19
272 China -- South China Sea -- Zhujiang Kou -- Guishan Dao — Pilotage 05/19
275 China -- Jiuzhou Gang — Controlling depths; vertical clearance; horizontal clearance 35/18
275 China -- Hong Kong to Zuhai--Macau Bridge — Regulations 51/19
284 China -- Approaches to Hong Kong — Directions; Traffic Separation Scheme 44/18
285--286 China -- Approaches to Hong Kong — Directions; Traffic Separation Scheme 44/18
286 China – South approaches to Hong Kong -- Dangan Shuidao — Directions; buoyage 31/19
287 Hong Kong – Tathong Channel through Lei Yue Mun to Kau Yi Chau — Restricted 31/19
area
292 China -- Hong Kong -- East Lamma Channel — Traffic regulations 29/18
292 Hong Kong -- East Lamma Channel and Western Fairway — Directions; shoal 08/20
294 Hong Kong -- Lamma Island -- North Lamma Anchorage — Obstruction 08/20
295 Hong Kong -- Passages south of Lantau Island — Depths 08/20
297 Hong Kong -- Black Point to Kau Yi Chau — Pilotage 08/20
298 China -- Hong Kong -- Lantau Island — Marine park 39/19
309 Hong Kong -- Lantau Island -- North--west coast — Regulations; prohibited areas 08/20
309 China -- Hong Kong -- Lantau Island — Anchorage; wreck 12/19
312 China -- South coast -- Zhujiang Kou -- Fanshi Shuidao — Bridge development 30/19
313 China -- South coast -- Zhujiang Kou -- Fanshi Shuidao — Bridge development 30/19
314 China -- South coast -- Zhujiang Kou — Directions; shoal; buoys 43/19
315 China -- South coast -- Zhujiang Kou -- Zhouzi Wei — Bridge; vertical clearance 40/19
315 China -- Zhujiang -- Shanban Zhou to Nizhou Tou -- Chuanbi Shuidao — Directions; 06/20
shoal; wreck
315 China -- South coast -- Zhujiang Kou -- Zhouzi Wei — Directions; wreck, bridge 40/19
318 China -- Zhujiang -- Dahao Zhou to Guangzhou — Vertical clearances 21/19
4.28 Wk26/20
IV
Weekly
328 China -- South coast -- Mirs Bay — Pilotage 44/19
328 China -- South coast -- Mirs Bay — Pilotage 04/20
331 China -- South coast -- Mirs Bay -- Shayuyong Gang — Directions; lights 08/20
334 Hong Kong -- Yantian Harbour -- West of Crooked Island — Directions 02/19
343 China -- South coast -- Honghai Wan — Shoal 35/19
NP31 China Sea 2 14th Edition (2019) 07/18
66 Indonesia -- Kalimantan -- Tanjung Datu — Directions; wreck 14/20
84 Indonesia -- Kalimantan -- Pulau Bunguran -- Selat Lampa — Directions; shoal depth 15/20
88 Indonesia -- Kalimantan -- Alur Pelayaran Api — Directions; shoals 14/20
97 Malaysia -- Sarawak -- Sungai Sarawak — Anchorage; light buoy 01/20
121 Brunei -- Tanjung Baram to Tanjung Batu — Directions; major light 01/20
122 Brunei -- Sungai Belait — Anchorage 01/20
122 Brunei -- Seria Oil Terminal — Anchorage 01/20
123 Brunei -- Lumut Terminal — Anchorage 01/20
124 Brunei -- Tanjung Batu to Tanjung Toulak — Directions; major light 01/20
125 Brunei -- Approaches to Brunei Bay — Directions; major light 01/20
125 Brunei -- Approaches to Brunei Bay — Directions; major light 01/20
128 Malaysia -- Sabah -- Pulau Labuan — Directions; wreck 01/20
129 Brunei -- Brunei Bay -- Muara — Vertical clearance 01/20
131 Brunei -- Brunei Bay -- Muara — Directions 01/20
131--132 Brunei -- Brunei Bay -- Muara — Directions 01/20
132 Brunei -- Brunei Bay -- Muara — Directions; light 01/20
132 Brunei -- Brunei Bay -- Sungai Brunei — Route 01/20
133 Brunei -- Sungai Brunei — Bridge 19/20
133 Brunei -- Brunei Bay -- Muara — Directions; light; leading line 01/20
133 Brunei -- Sungai Brunei -- Brunei Channel and Simpson Channel — Directions; 19/20
bridge
133 Brunei -- Sungai Brunei -- Bandar Seri Begawan — Limiting conditions; vertical 19/20
clearance
134 Brunei -- Sungai Brunei -- Bandar Seri Begawan — Arrival information; prohibited 19/20
area
134 Brunei -- Sungai Brunei -- Batang Limbang and approaches — Vertical clearance; 19/20
prohibited
143 Malaysia -- North of Kota Kinabalu -- Teluk Sapangar Terminal — Prohibited 23/20
anchorage
202 Philippines -- Luzon -- San Fernando — Seaoil Bangar Bulk Terminal 03/20
NP32A China Sea 3 2nd Edition (2019) 06/19
6--7 China — National regulations 06/19
62 Taiwan -- Kao--hsiung — Controlling depths 25/19
65 Taiwan -- South--west coast -- Kao--hsiung — Directions 49/19
65 Taiwan -- Kao--hsiung — Directions; breakwater; light 25/19
65 Taiwan -- South--west coast -- Kao--hsiung — Directions 49/19
66 Taiwan -- South--west--coast -- Kao--hsiung — Directions 49/19
69 Taiwan -- West Coast -- Kao--hsiung -- Yung--an LNG Terminal — Directions; light 47/19
71 Taiwan -- West coast -- Mai--Liao — Depths 46/19
76 Taiwan -- Mai--liao to T’ai--chung Kang — Directions; wreck 09/19
76 Taiwan -- West coast -- Mai--liao to T’ai--chung Kang — Directions; wreck 07/20
77 Taiwan -- West coast -- T’ai--chung Kang — Anchorages; foul ground 46/19
82 Taiwan -- North--west coast -- T’ai Chung — Directions; wreck 04/20
87 Taiwan -- North coast -- Chi--lung Kang — Pilotage 49/19
89 Taiwan -- North coast -- Chi--lung Kang — Pilotage 49/19
Wk26/20 4.29
IV
Weekly
90 Taiwan -- North coast -- Chi--Lung Kang — Alongside berths 25/20
101 Philippines -- Luzon Strait -- Batan Island -- Mananioy Bay — Directions; lights 02/20
102--103 Philippines -- Luzon Strait -- Batan Island -- Mananioy Bay — Directions; lights 02/20
124 China -- Taiwan Strait -- Shantou Gang — Anchorage 06/19
124 China -- Taiwan Strait -- Shantou Gang — Pilotage 06/19
127 China -- South--east coast -- Shantou Gang — Depth 16/20
128 China -- Taiwan Strait -- Xiongdi Yu to Dongding Dao — Directions; wreck 24/19
132 China -- South--east coast -- Chaozhou Gang -- Zhelin Wan — Directions 36/19
132 China -- South--east coast -- Chaozhou Gang -- Zhelin Wan — Directions; 17/20
anchorages; berths
133 China -- South--east coast -- Chaozhou Gang -- Dacheng Wan — Anchorage 17/20
140 China -- Xiamen Gang — Directions; buoy 08/19
141 China -- Xiamen Gang — Directions; buoys 08/19
142 China -- Xiamen Gang — Directions; buoy 08/19
148 China -- Taiwan Strait -- Weitou Wan — VTS 06/19
148 China -- South--east coast -- Weitou Wan — Pilotage; anchorages 16/20
149 China -- Taiwan Strait -- Shenhu Wan — VTS 06/19
149 China -- Taiwan Strait -- Jinshang — VTS 06/19
150 China -- Taiwan Strait -- Quanzhou Wan — Anchorages 19/19
150 China -- Taiwan Strait -- Quanzhou Wan — VTS 06/19
151 China -- Taiwan Strait -- Quanzhou Wan — Directions; anchorage 19/19
153--154 China -- Taiwan Strait -- Meizhou Wan — Depths; anchorage 39/19
154 China -- Taiwan Strait -- Meizhou Wan -- Putou Channel — Controlling depths 49/19
154 China -- Taiwan Strait -- Meizhou Wan — Anchorages 39/19
154 China – Taiwan Strait -- Meizhou Wan — Anchorages 35/19
154 China -- Taiwan Strait -- Meizhou Wan -- Putou Channel — Traffic regulations 49/19
155 China -- Taiwan Strait -- Meizhou Wan -- Putou Channel — Berth 49/19
155 China -- South--east coast -- Meizhou Wan -- Dasheng Dao — Directions; rock; buoys 32/19
156 China -- South--east coast -- Meizhou Wan -- Dasheng Dao — Directions; rock; buoys 32/19
156 China -- Taiwan Strait -- Meizhou Wan -- Putou Channel — Directions 49/19
159 China -- Taiwan Strait -- Xinghua Wan — Quarantine anchorage 06/19
163 China -- Taiwan Strait -- Haitan Dao -- Dongxiang — Directions; wreck 10/19
165 China -- East coast -- Minijiang Kou — Vessel traffic services 44/19
167 China -- East China Sea -- Jinpai Men -- Fuzhou Gang — Vertical clearance 07/20
169 China -- East China Sea -- Jinpai Men -- Fuzhou Gang — Bridge 07/20
172 China -- Taiwan Strait -- Donquan Dao to Dongyin Dao — Directions 44/19
186 China -- Approaches to Wenzhou Wan -- East of Hutou Yu — Directions; wreck 49/19
188 China -- Approaches to Wenzhou Wan -- East of Hutou Yu — Directions; wreck 49/19
192 China -- East China Sea -- Wenzhou — Anchorage 06/19
193 China -- Wenzu Wan -- Damen Dao — Directions; obstruction 25/19
193 China -- East coast -- Wenzhou Gang -- Oujiang Beikou — Directions; shoal 26/19
194 China -- East China Sea -- Wenzhou Gang -- Longwan Tou to Qidu Zui — Directions; 52/19
wreck
195 China -- East coast -- Wenzhou Gang -- Jiangxin — Directions; shoal; depth 26/19
202 China -- East China Sea -- North--east of Yushan Liedao — Directions; wreck 52/19
203 China -- East China Sea -- Tantou Shan to Xiasi Jiao — Directions; wreck 52/19
204 China -- East China Sea -- Sanmen Wan — Anchorages 28/19
206 China -- East China Sea -- Zhoushan Qundao -- Xiangshan Gang — Vertical 23/20
clearance; pilotage
212 China -- East China Sea -- Zhoushan Qundao -- Waishuai Jiao — Directions; wrecks, 35/19
buoyage, light
4.30 Wk26/20
IV
Weekly
213 China -- East China Sea -- Zhoushan Qundao -- Dongfu Shan — Light; anchorage 35/19
214 China -- East China Sea -- Zhoushan Qundao -- Waiyang’an Dao — Directions; 35/19
wrecks
215 China -- Zhoushan Qundao -- Zhongjieshan Liedao — Directions; wreck 25/20
215 China -- East China Sea -- Zhoushan Qundao — Directions; wreck 06/19
215 China -- East China Sea -- Zhoushan Qundao -- Xiaoban Dao — Directions; wrecks 35/19
215 China -- East China Sea -- Zhoushan Qundao -- East of Sanxing Shan — Directions; 52/19
wreck
219 China -- Zhoushan and Ningbo — Pilotage 24/20
219 China -- East China Sea -- Approaches to Zhoushan and Ningbo — Pilotage 23/20
219 China -- Zhoushan and Ningbo — Traffic regulations 24/20
220 China -- East China Sea -- Zhoushan Qundao — Directions; wreck 06/19
220 China -- East China Sea -- Zhoushan Qundao -- East of Xiazhi Dao — Wreck 02/20
222 China -- East China Sea -- Liuheng Dao west side — Directions; wreck 52/19
223 China -- East China Sea -- Zhujiajian Dao — Directions; dangerous wreck; light buoys 35/19
223 China -- East China Sea -- Zhoushan Qundao -- East of Xiazhi Dao — Wreck 02/20
224 China -- East coast -- Zhoushan Dao -- Menkou Gang — Bridge; vertical clearance 32/19
227 China -- Qiqu Liedao to Ningbo and Zhoushan -- Guci Hangmen — Vertical 24/19
clearances
229 China -- Ningbo — Pilotage 24/20
233 China -- Ningbo Hang — Berths; obstructions 21/19
234 China -- East coast -- Zhoushan — Anchorages; wrecks 39/19
234 China -- Zhoushan — Pilotage 24/20
236 China -- East coast -- Zhoushan Dao — Vertical clearances 44/19
237 China -- East China Sea -- Zhoushan Qundao — Directions; depth 06/19
237 China -- East coast -- South east and west of Xiushan Dao — Directions 27/19
238 China -- East China Sea -- Zhongjieshan Liedao — Wreck 35/19
239 China -- East coast -- Changbai Dao — Anchorage 35/19
239 China -- East coast -- Huoshan Liedao — Anchorages 35/19
240 China -- East coast -- Approaches to Yangshan Deep Water Port — Pilotage 23/20
241 China -- East China Sea -- Zhoushan Qundao -- Qushan Dao — Anchorage; caution 11/19
241 China -- East China Sea -- Sanxing Shan -- North of Shulanghu Dao — General 23/20
information; anchorages
241 China -- East China Sea -- Sanxing Shan -- North of Shulanghu Dao — Anchorage 23/20
242 China -- East China Sea -- Waishuai Jiao — Directions 35/19
242--243 China -- East coast -- Approaches to Yangshan Deep Water Port — Pilotage 23/20
245 China -- Ma’an Liedao -- Luhuashan South Anchorage — Obstruction 25/19
247 China -- East coast -- Zhoushan Qundao to Qiqu Liedao -- Daji Shan to Donghai 21/20
Bridge — Regulations
248 China -- East coast -- Yangshan Deep Water Port — Pilotage 21/20
251 China -- East coast -- Hangzhou Wan — Directions; wind farm; wreck 29/19
252 China -- East coast -- Luchao Gang — Anchorage; directions 21/19
252 China -- East coast -- Dawu Zhi to Jinshan -- Luchao Gang — Harbour; pilotage 21/20
255 China -- East China Sea -- Hangzhou Wan -- Zhapu — VTS; pilotage 22/20
263 China -- Approaches to Shanghai — Traffic regulations 18/20
265 China -- Shanghai -- Nancao Shuidao — Directions; wrecks 30/19
265 China -- Shanghai -- Nangang Shuidao — Directions; wreck 28/19
266 China -- Shanghai approaches -- Nangang Shuidao — Directions; wreck 31/19
266 China -- Approaches to Shanghai -- Nangang Shuidao — Directions; wreck 39/19
Wk26/20 4.31
IV
Weekly
266 China -- Shanghai -- Nangang Shuidao — Anchorages; wreck 06/19
266 China -- Shanghai -- Nangang Shuidao — Anchorages; depths; obstructions 28/19
266 China -- Shanghai -- Nangang Shuidao — Anchorages; wreck 47/19
266 China -- Shanghai -- Nangang Shuidao — Anchorage; wreck 30/19
266 China -- Approaches to Shanghai -- Nangang Shuidao — Anchorages; obstructions 39/19
267 China -- Approaches to Shanghai -- Beigang Shuidao — Prohibited area 39/19
270 China -- Shanghai -- Huangpu Jiang — Traffic regulations; TSS 17/20
274 China -- Shanghai -- Baoshan Hangdao -- Wusong Kou Cruise Terminal — Depths 17/20
274 China -- Shanghai -- Huangpu Jiang -- Jungong Lu — Depth; wreck 17/20
276 China -- Shanghai -- Chang Jiang — Regulations 18/20
278 China -- Shanghai -- Chang Jiang -- Sutong Bridge — Vertical clearance 19/20
278 China -- Approaches to Shanghai -- Baoshan Hangdao — Directions; wrecks 39/19
278 China -- Inner Approach to Shanghai -- Baoshan Hangdao — Directions; wreck 25/19
278 China -- Approaches to Shanghai -- Baoshan Hangdao — Directions; wreck 39/19
279 China -- Chang Jiang -- Qinglonggang Shuidao to Hongbei Sha — Directions; bridge 17/20
280 China -- Chang Jiang -- Changshu — Outer anchorage 17/20
281 China -- Chang Jiang -- Nantong — Outer anchorage 17/20
281--282 China -- Chang Jiang -- Zhangjia Gang — Outer anchorage 17/20
NP32B China Sea 4 2nd Edition (2019) 08/19
7 China — National regulations 08/19
53 China -- Yellow Sea -- Dafeng Gang approaches — Directions; wrecks 08/19
53 China -- Yellow Sea -- Huang Hai -- Approaches to Guanhe Kou — Pilotage 23/20
54 China -- Yellow Sea -- Haizhou Wan -- Lianyungang Gang -- Lianyungang Xinhaiwan 23/20
Terminal — General information; directions; berths
55 China -- Yellow Sea -- Lianyungang — Pilotage 49/19
55 China -- Yellow Sea -- Haizhou Wan -- Approaches to Lianyungang — Pilotage 23/20
55 China -- Yellow Sea -- Huang Hai -- Lianyungang — Regulations 13/20
55 China -- Yellow Sea -- Lianyungang — Berth 49/19
57 China -- Yellow Sea -- Lianyungang — Berths; depth 21/19
57 China -- Yellow Sea -- Lianyungang — Berths; depth 21/19
57--58 China -- Yellow Sea -- Lianyungang — Berths; depth 21/19
59 China -- Yellow Sea -- Approaches to Dongjiakou Gangqu — Directions 15/19
59 China -- Yellow Sea -- Dongjiakou Zui — Directions; obstruction 38/19
60 China -- Haizhou Wan -- Lanshan — Arrival information; Vessel Traffic Service; 13/20
pilotage
60 China -- Haizhou Wan -- Lanshan — Arrival information; VTS; pilotage 22/20
61 China -- Yellow Sea -- Lanshan — Berths 16/19
61 China -- Haizhou Wan -- Dongjiakou — Anchorages 26/20
61 China -- Yellow Sea -- Approaches to Dongjiakou Gangqu — Directions 15/19
62 China -- Huang Hai -- Rizhao Gang — Arrival information; Vessel Traffic Service 13/20
62 China -- Yellow Sea -- Rizhao — Anchorages 49/19
63 China -- Huang Hai -- Rizhao Gang — Arrival information; pilotage 13/20
63 China -- Yellow Sea -- Rizhao — Traffic regulations 49/19
63 China -- Huang Hai -- Rizhao Gang — Arrival information; regulations 13/20
64 China -- Yellow Sea -- Qingdao Gang — Anchorages; depths 40/19
64 China -- Yellow Sea -- Qingdao — Regulations 12/20
76 China -- Yellow Sea -- South--east of Moye Dao — Directions; wreck 10/19
76 China -- Yellow Sea -- Coastal route via Chenshan Jiao TSS -- South--east of Shidao 41/19
Gang — Directions; wrecks
4.32 Wk26/20
IV
Weekly
77 China -- Yellow Sea -- East--south--east of Chengshan Jiao — Directions; wreck 10/19
81 China -- Bohai Haixia -- Laotieshan Shuidao — Prohibited area 08/20
83 China -- Bohai Haixia — Directions; wreck 09/20
85 China -- Bohai Haixia -- Laotieshan Shuidao — Directions; prohibited area 08/20
86 China -- Yellow Sea north part -- Chengshan Jiao to Yalu Jiang (Amnok Kang) — 12/20
Directions; wreck
93 China -- Bohai Haixia -- Yanti Gang — Pilotage 09/20
98 China -- Yellow Sea -- Bohai Haixia -- Penglai Donggang — Limiting conditions; 17/20
depths
99 China -- Changshan Shuidao -- Penglai — Arrival information; outer anchorages 12/19
99 China -- Yellow Sea -- Bohai Haixia -- Penglai Donggang — Development; directions; 17/20
depths
103 China -- Yellow Sea -- Dalian Gang — Pilotage 22/20
107 China -- Yellow Sea -- Dalian Xingang and Dayao Wan — Pilotage 22/20
111 China -- Dalian Gang to Yalu Jiang -- East--north--east of Wumang Dao — Directions; 38/19
obstruction
114 China -- Yellow Sea -- Dadong Gangqu approaches — Wreck 09/19
114 China -- Dadong and approaches — Pilotage 31/19
114 China -- Dadong and approaches — Outer anchorages 24/19
114 China -- Dadong and approaches — Pilotage 31/19
120 China -- Bohai Wan— Directions; wrecks; obstructions 08/19
121 China -- Bo Hai -- Bohai Wan — Directions; wreck 25/20
121 China -- Bohai Sea -- West--north--west of Beihuangcheng Dao — Directions; 41/19
obstruction
121 China -- Bohai Wan— Directions; obstructions 08/19
121 China -- Bohai Hai -- Bohai Wan Oilfields — Directions 38/19
122 China -- Bo Hai -- Changshan Shuidao to Longkou Gang — Directions; wrecks; shoal 23/20
patch; spoil ground
123 China -- Bo Hai -- Laizhou Wan -- Longkou — Anchorages 08/19
125 China -- Yellow Sea -- Bo Hai -- Approaches to Laizhou — Outer anchorage; wreck 23/20
126 China -- Bohai Sea -- Laizhou and Longku to East--north--east of Huanghe Kou — 41/19
Directions
126 China -- Bo Hai -- Laizhou Wan — Directions; wreck 08/19
127 China -- Bo Hai -- Weifang Gang — Anchorages 08/19
127 China -- Bo Hai -- Weifang Gang — Pilotage 20/20
128 China -- Bo Hai -- Dongying Gang — Pilotage 20/20
129 China -- Bo Hai -- Dagang Gangqu — Speed limit 06/20
130 China -- Bohai -- Bohai Wan -- Huanghua Gang — Buoyed channel 21/19
130 China -- Bohai Wan -- Huanghua Gang — Pilotage 08/19
130 China -- Bohai -- Bohai Wan -- Huanghua Gang — Pilot boarding positions 21/19
130 China – Bohai Wan – Huanghua Gang — Pilotage 17/20
130 China – Bohai Wan – Huanghua Gang — Pilotage 22/20
130 China -- Bohai -- Bohai Wan -- Huanghua Gang — Directions; obstructions 21/19
131 China -- Bohai Wan -- Dagusha Hangdao — Distances 09/19
132 China -- Bohai Wan -- Dagusha Hangdao — Depths 09/19
133 China -- Bo Hai -- Tianjin Gang — Speed Limit 06/20
135 China -- Bohai Wan -- Dagusha Hangdao — Directions 17/20
135 China -- Bohai Wan -- Dagusha Hangdao — Distances 09/19
136 China -- Bo Hai -- Tianjin Gang to Jingtang — TSS 04/20
136--137 China -- Bohai Wan -- Caofeidian to Jingtang — Directions; obstruction 17/20
137 China -- Bo Hai -- Caofeidian — Controlling depths 28/19
137 China -- Bo Hai -- Caofeidian — Anchorages 04/20
Wk26/20 4.33
IV
Weekly
137 China -- Bo Hai -- Caofeidian — Pilotage 04/20
137 China -- Bo Hai -- Caofeidian — Traffic regulations 04/20
137 China -- Bo Hai -- Caofeidian — Regulations 04/20
138 China -- Bo Hai -- Caofeidian — Directions, recommended route 04/20
141 China -- Bo Hai -- Jingtang to Qinhuangdao — Directions; wreck 04/20
142 China -- Bo Hai -- Qinhuangdao — Limiting conditions; controlling depths 12/19
143 China -- Bo Hai -- Liaodong Wan -- Qinhuangdao — Anchorage 45/19
147 China -- Bo Hai -- Suizhong — Anchorage 29/19
148 China -- Bo Hai -- Suizhong Gangqu — Anchorage 29/19
152 China -- Bo Hai -- Lüshun Xingang — Anchorages and harbours 28/19
154 China -- Liaodong Wan -- Jinzhou — Directions; wreck 08/19
154 China -- Bo Hai -- Liaodong Wan -- Approaches to Jinzhou — Directions; wreck; 43/19
obstructions
154--155 China -- Liaodong Wan -- Jinzhou — Directions; wreck 01/20
156 China – Liaodong Wan — Pilotage 28/19
156 China -- Liaodong Wan -- Bayuquan — Pilotage 04/20
159 China – Liaodong Wan – Panjin Gang — Pilotage 28/19
161 China – Liaodong Wan – Panjin Gang — Anchorages; pilotage; prohibited area 28/19
166 South Korea -- West coast -- Maemul Sudo — Depths 08/19
167 South Korea -- West coast -- Maemul Sudo -- Naju Kundo — Directions; light 08/19
172 South Korea -- West coast -- Maemul Sudo -- Naju Kundo — Directions; light 08/19
175 South Korea -- South coast -- Maro Hae — Directions; marine farms 08/19
175 Korea -- South--west coast -- Maro Hae — Directions 25/19
177 South Korea -- Approaches to Mokpo Hang — Vertical clearances 20/19
178 South Korea -- Approaches to Mokpo Hang -- Myeondo Sudo -- Amtaedo — Currents 06/20
182 South Korea -- West coast -- Saok Sudo — Depth 08/19
183 South Korea -- Mokpo Hang — Vertical clearance 22/19
183 South Korea -- South--west coast -- Mokpo Hang — Vertical clearance 52/19
183 South Korea -- South--west coast -- Mokpo Hang — Vertical clearances 21/20
188 South Korea -- West coast -- Punam Kundo to Sangwangdeungdo -- Anmado — Light 37/19
188 South Korea -- West coast -- Gunsan Hang — Directions; anchorage 08/19
189 South Korea -- West coast -- Approaches to Mokpo — Directions; wreck 13/20
191 South Korea -- West coast -- Gunsan Hang — Anchorages 08/19
195 South Korea -- West coast -- Oeyeon Yeoldo — Directions; light 08/19
198 South Korea -- West coast -- Boryeong to Gadaeam — VTS 15/20
200 South Korea -- West coast -- Oeyeon Yeoldo -- Hwangdo — Directions; wreck 42/19
200 South Korea -- West coast -- Approaches to Daesan — Directions; wreck 08/19
202 South Korea -- West coast -- Jangan--Daesan — Pilotage 42/19
203 South Korea -- West coast -- North--west approach to Daesan — Directions 42/19
204 South Korea -- West coast -- Approaches to Daesan — Directions; wreck 08/19
205 South Korea -- Gadaeam to Janganseo — Directions; wrecks 12/19
205 South Korea -- West coast -- Pyeongtaek Hang — Pilotage 49/19
207 South Korea -- Pyeongtaek Hang — Arrival information; outer anchorages 12/19
207 South Korea -- West coast -- Pyeongtaek Hang — Anchorage; obstructions 49/19
208 South Korea -- West coast -- Pyeongtaek Hang — Anchorage; submarine cable 17/20
4.34 Wk26/20
IV
Weekly
208 South Korea -- West coast -- Pyeongtaek Hang — Container berth; depth 20/20
209 South Korea -- Approaches to Incheon -- Incheon — Tidal streams 07/20
210 South Korea -- Janganseo to Palmido — Anchorages 12/19
211 South Korea -- West coast -- Incheon Hang — Depths 37/19
217 South Korea -- Approaches to Incheon -- Daemuuido —Tidal streams 07/20
217 South Korea -- West coast -- Approaches to Incheon — Directions; buoys 52/19
220 North Korea -- West coast -- Haeju Man — Light 26/19
220 South Korea -- Approaches to Incheon Hang — Directions; wrecks 43/19
221 North Korea -- Haeju Hang — Directions; shoal 08/19
224 North Korea -- Korean Bay — Prohibited areas 08/19
NP33 Philippine Islands 6th Edition (2017) 49/17
2 Philippines -- Sulu Archipelago — Regulations 02/18
61 Philippines — Regulations 19/18
63 Philippines -- Sulu Sea -- Pangutaran Group Bank — Directions; route 19/18
63 Philippines -- Mindanao -- Teinga Island — Directions; RTC 19/18
64 Philippines -- Sulu Sea -- Tubbataha Reef — Regulations 04/18
135 Indonesia -- Kalimantan -- Teluk Sibuko -- Pulau Sebatik — Directions; light 24/20
137 Indonesia -- Kalimantan -- Teluk Sibuko -- Pulau Sebatik — Directions; light 24/20
137 Indonesia -- Kalimantan -- Teluk Sibuko -- Cowie Bay — Directions; depths 24/20
141 Philippines -- Sulu Archipelago — Regulations 02/18
143 Philippines -- Sulu Archipelago — Directions 02/18
153 Philippines -- Sulu Archipelago— Directions 02/18
169 Philippines -- Mindanao — Regulations 02/18
170 Philippines -- Mindanao — Directions 02/18
199 Philippines -- Mindanao -- Pakiputan Strait — Directions; shoal 18/18
215 Philippines – Mindoro -- Verde Island Passage — Directions; lights 28/19
220 Philippines – Mindoro -- Verde Island Passage — Directions; lights 28/19
222 Philippines – Mindoro – North coast — Anchorages and harbours 28/19
249 Philippines -- Panay -- Estancia — Pilotage; directions; buoyed channel 16/20
253 Philippines -- Panay -- San Jose de Buenavista — Anchorage 16/20
253--254 Philippines -- Panay -- San Jose de Buenavista — Directions; buoyed channel 16/20
254 Philippines -- Panay south--east side -- Iloilo Strait — Light 50/19
257 Philippines -- Iloilo Strait -- North--east approach — Directions 46/19
257 Philippines -- Iloilo Strait -- Port of Dumangas — Berths 46/19
268 Philippines -- Luzon -- Tayabas Bay -- Castañas — Anchorages and harbours; berths 33/18
268 Philippines -- Luzon -- Tayabas Bay -- Sariaya — Jetties 02/19
284 Luzon -- San Bernardino Strait -- Santa Magdalena — Directions; light 52/17
290 Luzon -- San Bernardino Strait -- San Bernardino Island — Directions; light 52/17
Wk26/20 4.35
IV
Weekly
321 Philippines -- Mindanao — Regulations 02/18
332 Philippines -- Negros -- Tañon Strait west side -- San Carlos City — Pipeline 36/18
375 Philippines -- Mindanao -- Butuan Bay -- Nasipit Harbour — Pilotage 27/18
379 Luzon -- Luzon Plateau -- Benham Bank — Marine Protected Area 26/18
409--410 Philippines -- Luzon -- Lagonoy Gulf -- Tabaco — Directions; lights 11/20
NP34 Indonesia 2 9th Edition (2019) 10/19
90 Indonesia – Jawa -- North coast — Wrecks 34/19
90 Indonesia -- Jawa -- North coast -- Tanjung Awarawar — Prohibited areas; wrecks 42/19
90 Indonesia – Jawa -- North coast — Directions; wrecks; buoyage 34/19
93 Indonesia -- Madura -- Selat Surabaya — Anchorages; wrecks 33/19
95 Indonesia -- Jawa -- Approaches to Surabaya -- Gresik — Directions; shoal; light buoy 10/19
98 Indonesia -- Jawa -- North coast -- Tanjungperak — Anchorages 33/19
102 Indonesia -- Jawa -- Selat Madura -- Probolinggo — Directions; navigation marks 17/19
105 Indonesia -- Jawa -- Kalianget — Directions; buoyage 17/19
106 Indonesia -- Jawa -- Kalianget — Directions; buoyage 17/19
107 Indonesia -- Bali Sea -- Pulau Sapudi — Directions; offshore marks 33/19
107 Indonesia -- Bali Sea -- Pulau Sapudi — Directions; MBH platform 33/19
114 Indonesia -- Jawa -- Selat Bali -- Tanjung Wangi — Directions; depths 10/20
119 Indonesia -- Bali -- Selat Lombok -- Pulau Gilitepekong — Directions; light 25/19
121 Indonesia -- Bali -- Selat Lombok -- Pulau Gilitepekong — Directions; light 25/19
122 Indonesia -- Bali -- Selat Lombok -- Pulau Lembongan — Anchorage 24/20
123 Indonesia -- Bali -- Pelabuhan Benoa — Anchorage; traffic regulations 38/19
123 Indonesia -- Bali -- Approaches to Benoa — Directions; shoal patch 21/20
125 Indonesia -- Lombok -- Lembar — Anchorage; pilotage 27/19
125 Indonesia -- Lombok -- Lembar — Anchorages 46/19
159 Indonesia -- Flores -- Labuan Bajo — Directions; names; alignments; positions 45/19
160 Indonesia -- Flores -- Labuan Bajo — Directions; alignments; light buoys; depths 45/19
163 Indonesia -- Flores -- Selat Molo — Directions; names 45/19
177 Indonesia -- South coast of Flores Island -- Teluk Ipi — Directions; light 09/20
216 Indonesia -- Kalimantan -- Pulau Keramian — Shoals 36/19
217 Indonesia -- Java Sea — Directions; wreck 46/19
217 Indonesia -- Kalimantan -- Tanjung Puting towards Pulau--pulau Lima — Directions; 36/19
wrecks; shoal
217 Indonesia -- Java Sea -- Kalimantan — Directions; shoal 46/19
221 Indonesia -- Java Sea -- Kalimantan -- South coast -- Sungai Kahayan — Pilotage 20/20
222 Indonesia -- Kalimantan -- Banjarmasin — Directions; pilotage 42/19
223 Indonesia -- Kalimantan -- Banjarmasin — Anchorage; pilotage 42/19
224 Indonesia -- Kalimantan -- Banjarmasin — Anchorage 42/19
242 Indonesia -- Selat Makassar west part -- Kalimantan east coast — Directions; major 19/20
light
242 Indonesia -- Kalimantan east coast -- Tanjung Aru to Teluk Balikpapan — Directions; 19/20
major light
245 Indonesia -- Kalimantan east coast -- Teluk Balikpapan — Directions; major light 19/20
247 Indonesia -- Kalimantan -- Balikpapan — Inner anchorages 28/19
248 Indonesia -- Kalimantan east coast -- Teluk Balikpapan to Tanjung Bayur — 19/20
Directions; major light
251 Indonesia – Kalimantan – Samarinda — Vertical clearances 35/19
257 Indonesia -- Kalimantan -- Selat Makassar — Directions; platform 23/20
4.36 Wk26/20
IV
Weekly
259 Indonesia -- Teluk Sangkulirang — Directions; major light 19/20
291 Indonesia -- Kalimantan -- Celebes Sea -- Teluk Sibuko — Directions; anchorage 24/20
296 Indonesia -- Kalimantan -- Tanjung Mangkalihat to Tanjung Sepikat -- Muara Pantai 31/19
— Directions; wreck
307 Indonesia -- Kalimantan -- Celebes Sea -- Teluk Sibuko — Directions; anchorage 24/20
308 Indonesia -- Kalimantan -- Celebes Sea -- Sibuko Oil Terminal — Anchorage 24/20
352 Indonesia -- Sulawesi -- South--east coast -- Kendari — Depths 22/19
352 Indonesia -- Sulawesi -- South--east coast -- Kendari — Anchorage 22/19
352 Indonesia -- Sulawesi -- South--east coast -- Kendari — Pilotage; traffic regulations 22/19
352 Indonesia -- Sulawesi -- South--east coast -- Kendari — Directions 22/19
353 Indonesia -- Sulawesi -- South--east coast -- Kendari — Berths; anchorages 22/19
356 Indonesia -- Sulawesi -- East coast – Teluk Talowa — Bintang Delapan Terminal 44/19
373 Indonesia -- Sulawesi -- Pulau--Pulau Togian -- Pulau Waleabahi to Pasir Tengah — 36/19
Directions
374 Indonesia -- Sulawesi -- Pulau--Pulau Togian -- Batudaka — Anchorage 36/19
374 Indonesia -- Sulawesi -- Pulau--Pulau Togian — Anchorages 36/19
376 Indonesia -- Sulawesi -- Selat Walea to Tanjung Api — Directions; channel 36/19
391 Indonesia -- Bitung -- Selat Lembah -- Pulau Serena Besar — Vertical clearance 45/19
405 Indonesia -- Sulawesi -- Anggrek -- Teluk Kwandang — Directions; wreck 10/19
411 Indonesia -- North coast of Sulawesi -- Tanjung Pasir Putih to Tanjung Pisok — 37/19
Directions; recommended route
411 Indonesia -- North coast of Sulawesi -- Manado — Directions; berths 37/19
412 Indonesia -- North coast of Sulawesi -- Tanjung Pisok to Tanjung Torowitan — 37/19
Directions; recommended route
86 Indonesia -- Sawu Sea -- Selat Sunda to Selat Rote -- Pulau Rote — Directions; light 09/20
90 Indonesia -- Timor -- Teluk Kupang -- Pulau Kera — Directions; light 03/20
108 Indonesia -- Selat Wetar -- Selat Liran — Directions; light 09/20
127 Indonesia -- Banda Sea -- Pulau--Pulau Tanimbar -- Selat Egron — Directions; wreck 33/18
128 Indonesia -- Banda Sea -- Pulau--Pulau Tanimbar -- Saumlaki approaches — 33/18
Directions; wreck
293 Indonesia -- North--west Papua -- Selat Dampier — Directions 17/19
293 Indonesia -- Selat Dampier — Waisai Port 18/19
294 Indonesia -- Selat Dampier -- Pulau Saonek Besar to Pulau Wayam — Directions 18/19
316 Indonesia -- Halmahera -- Tobelo — Directions for entering harbour; light beacon 02/18
59 Indonesia -- Jawa -- Selat Sunda -- Merak — Directions; depth; light buoy 25/20
76 Indonesia -- Java Sea -- Pulau--pulau Seribu — Directions; anchorages 22/19
96 Indonesia -- Java Sea -- Pulau--pulau Karimunjawa — Anchorage; harbour 22/19
103 Indonesia -- Jawa -- North coast -- Semarang — Wreck 33/19
103 Indonesia -- Jawa -- North coast -- Semarang — Harbour 21/20
104 Indonesia -- Jawa -- North coast -- Semarang — Berths 21/20
121 Indonesia -- Sumatera -- Pulau Bangka — Bangka Marine Terminal 07/20
122 Indonesia -- Sumatera -- Pulau Bangka -- Teluk Klabat — Directions; shoal; rock 46/19
123 Indonesia -- Sumatera -- Pulau Bangka — Bangka Marine Terminal 07/20
137 Indonesia -- Sumatera -- Pulau Bangka — Directions; wreck 22/20
Wk26/20 4.37
IV
Weekly
140 Indonesia -- Java Sea — Prohibited areas; wrecks 42/19
141 Indonesia -- Kalimantan -- Selat Karimata — Directions; wreck 11/19
153 Indonesia -- Kalimantan -- West coast -- Pulau Datu — Directions; wreck 24/19
155 Indonesia -- Kalimantan -- West coast -- Pulau Datu — Directions; wreck 24/19
166 Indonesia -- Pulau--pulau Lingga -- Pulau Buaya — Directions; dangerous wreck 13/20
172 Indonesia -- Sumatera -- Selat Durian -- Pulau Petong — Anchorage 24/20
176 Indonesia -- Selat Riau -- Tanjunguban — Anchorages 42/19
177 Indonesia -- Pulau Batam -- Kabil — Directions; light 02/20
178 Indonesia -- Sumatera -- Selat Riau -- Kabil Port — Anchorage 24/20
179 Indonesia -- Sumatera -- Selat Riau -- Tanjungpinang — Anchorages 24/20
191 Indonesia -- Sumatera -- Selat Riau and Selat Durian -- Pulau Petong — Anchorage 24/20
195 Indonesia -- Pulau Karimun Besar -- Selat Gelam — Directions; shoal 02/20
199 Indonesia -- Selat Bulan -- Approaches to Sekupang — Pilotage; directions 13/19
NP37 West Coasts of 20th Edition (2017) 26/17
England and Wales
8 United Kingdom — Distress and rescue; coastguard stations 29/17
94 Wales -- Swansea Bay — Directions; buoy 27/17
94 Wales -- Swansea — Depth 08/19
95 Wales -- Port of Swansea — Pilotage 14/19
96 Wales -- Swansea Bay -- Mumbles Head — Approaches 05/19
97 Wales -- Port of Neath — Depths 24/18
97 Wales -- Port of Neath — Vertical clearances 08/19
98 Wales -- Port of Neath — Training wall 51/18
103 Wales -- Porthcawl -- Tusker Rock — Directions; obstruction 24/18
104 Wales -- South coast -- Approaches to Porthcawl — Directions; caution 24/19
110 Wales -- Port of Barry — Pilotage 14/19
115 Wales -- Port of Cardiff — Pilotage 14/19
116 Wales -- Cardiff -- Lavernock Point — Directions; obstructions 24/18
120 Wales -- Port of Newport — Pilotage 14/19
120 Wales -- Bristol Channel -- Newport — Directions; light sector 10/19
124 England -- Bristol Channel -- Bridgwater Bay -- Hinkley Point — Pilotage 35/19
126 England -- Bristol Channel -- Bridgwater Bay — Light buoy 29/18
126 England -- Bristol Channel -- Bridgwater Bay — Directions; light buoy; shoal 29/18
126 England -- Bridgwater Bay -- Burnham--on--Sea — Leading lights 48/17
140 England -- River Severn -- Chepstow — Vessels handled 28/17
142 England -- River Severn -- Sharpness Dock — Pilotage 28/17
154 Wales -- Milford Haven — Depths 28/18
164 Wales -- Milford Haven -- Milford Docks — Depth 22/18
206 Wales -- Menai Strait to South Stack — General information; traffic regulations 25/18
207 Wales -- Menai Strait to South Stack — Directions 25/18
231 England -- Liverpool Bay — Wind farm 30/17
236 England -- River Dee -- Hilbre Island — Directions; wreck 23/18
237 Wales -- River Dee -- Mostyn Deep — Anchorages 04/20
237 River Dee -- Mostyn Channel — Directions; light; channels 19/18
237 Wales -- Mostyn Docks — Directions; directional light 19/18
237 Wales -- Mostyn Docks — Directions; buoys; light sector 23/18
238 Wales -- River Dee -- Mostyn — Anchorages 04/20
239 England -- Liverpool Bay — Wind farm extension 30/17
244 United Kingdom -- England -- Liverpool -- Birkenhead — Directions; light buoy 30/19
244 England -- Liverpool — Berths 28/17
4.38 Wk26/20
IV
Weekly
247 United Kingdom -- Liverpool -- Birkenhead — Light buoy 30/19
248 England -- Liverpool Bay — Directions; wind farm extension 30/17
251 England -- River Mersey -- Runcorn Sands — Vertical clearance 02/19
272--273 England -- Port of Lancaster -- Glasson Dock — Times 16/18
300 Scotland -- Kirkcudbright Bay — Outer anchorages 40/17
319 Isle of Man -- West coast -- West--north--west of Bradda Head — Directions; wreck 02/20
NP38 West Coast of India 19th Edition (2019) 49/19
93 Maldives -- Male’ Atoll -- Male’ — Anchorages 17/20
134 India -- South--east coast -- Palk Bay -- Pºmban Pass — Directions; buoyage 10/20
138 Sri Lanka -- Galle Harbour — Traffic regulations; prohibited area 22/20
141 Sri Lanka -- Galle to Hikkaduwa Point — Directions; prohibited area 22/20
151 India -- South--east coast -- Palk Bay -- Pºmban Pass — Directions; depths 10/20
152 India -- South--east coast -- Palk Bay -- Pºmban Pass — Directions; depths 10/20
176 India -- West coast -- Badagara — Wrecks 49/19
177 India -- West coast -- Badagara — Anchorage 49/19
177 India -- West coast -- Badagara to Mount Dilli — Directions; wrecks 08/20
184 India -- West coast -- New Mangalore — Wreck 49/19
186 India -- West coast -- North--north--east of New Mangalore -- Mølki Rocks — 23/20
Directions; caution
186 India -- West coast -- New Mangalore to Malpe — Directions; wreck 08/20
198 India -- Mormugao — Outer anchorages; depth; wreck 09/20
214 India -- West coast -- South of Tolkeshwar Point -- KLPL Terminal — Controlling 25/20
depth
227 India -- Mumbai -- Jawaharlal Nehru Port — Regulations 14/20
234 India -- West coast -- Approaches to Gulf of Khambhºt -- Southerland Channel — 49/19
Light
236 India -- West coast -- Approaches to Gulf of Khambhºt -- Southerland Channel — 49/19
Light
239 India -- West coast -- Approaches to Gulf of Khambhºt -- Valsºd Bay — Light 49/19
263 India -- West coast -- Gulf of Katchh -- Mundra — Directions; major light 13/20
270 India -- West Coast -- Gulf of Katchh -- Mundra — Directions; major light 13/20
NP39 South Indian Ocean 15th Edition (2017) 14/17
2 Comores Archipelago -- Mayotte — Volcanic activity 43/19
2 Arabian Sea and Indian Ocean — Piracy 21/19
6 France -- Indian Ocean -- Île Amsterdam and Île Saint--Paul — Nature reserves; 02/18
EEZs
73 Comores Archipelago — Marine nature reserves 35/19
87 Comores -- Ndzuani -- Mouillage d’Ouani — Leading beacons 25/17
87 Comores -- Ndzuani -- Mouillage d’Ouani — Berths; mooring buoys 48/17
88 Comores Archipelago -- Mayotte — Volcanic activity 43/19
89 Comores Archipelago -- Mayotte — Marine nature reserve 35/19
95 Comores Archipelago -- Mayotte -- Port de Longoni — Port information 28/17
95 Comores Archipelago -- Port de Longoni — Pilotage 04/20
95 Comores Archipelago – Mayotte – Port de Longoni — Port information 28/17
95 Comores Archipelago -- Îles Glorieuses — Marine nature reserve 35/19
131 Madagascar -- Approaches to Mahajanga -- Banc du Cavalier — Depths 11/18
133 Madagascar -- Mahajanga -- Chenal du Nord--Ouest — Directions; depths; lights; 11/18
outfall
133 Madagascar -- North--west coast -- Mahajanga — Directions; buoy 01/19
134 Madagascar -- North--west coast -- Mahajanga — Directions; gas terminal 01/19
Wk26/20 4.39
IV
Weekly
171 Madagascar -- Cap Andavaka — Directions; depth 11/18
214 Madagascar -- Port De La Nièvre -- Port de Commerce and Port Militaire — Berths 47/17
258 France -- Île de La Réunion -- Port Réunion — Pilotage 04/20
258 France -- Île de La Réunion -- Port Réunion — Pilotage 08/20
263 Île de La Réunion -- Saint--Pierre — Directions; leading line 12/19
263 Île de La Réunion -- Saint--Pierre — Directions; leading lights 19/17
280 Rodriguez Island -- Port Mathurin -- Western Pass — Directions; light 50/17
281 Rodriguez Island -- Port Mathurin -- Inner entrance — Directions; light 50/17
281 Republic of Mauritius -- Rodriguez Island -- Port Mathurin — Directions 49/19
289 British Indian Ocean Territory — General information; traffic regulations 26/17
301 France -- Indian Ocean -- Île Amsterdam and Île Saint--Paul — Nature reserves; 02/18
EEZs
NP40 Irish Coast 21st Edition (2019) 41/19
153 Ireland -- East coast -- Dublin Bay — Restricted area 41/19
169 Ireland – Howth Harbour to Lambay Island and Rogerstown Inlet — Anchorages; 41/19
submarine cables
186 Northern Ireland -- Strangford Narrows — Underwater turbine 45/19
188 Northern Ireland -- Strangford Narrows — Underwater turbine 45/19
212 Northern Ireland -- Larne — Pilotage 03/20
NP41 Japan 1 12th Edition (2018) 08/18
91 Japan -- North--west coast -- Hamada Ko — Vertical clearance 27/18
94 Japan -- Honshu -- Tako Hana — Directions; light 25/18
100 Japan -- Honshu -- Oki Shoto -- Saigo Ko — Vertical clearance 04/20
124 Japan -- Honshu north--west coast -- Anto Misaki to Saruyama Misaki -- Kanazawa 15/20
Ko — Restricted area
126 Japan -- Honshu -- North--west coast -- Hegura Shima -- Depths 04/20
131 Japan -- Honshu north--west coast -- Rokko Saki to Kannon Saki -- Nanao Ko — 15/20
Restricted area
134 Japan -- Honshu north--west coast -- Kannon Saki to Fushiki--Toyama -- Fushiki — 15/20
Restricted area
140 Japan -- Honshu north--west coast -- Naoetsu to Niigata -- Kashiwazaki Ko — 15/20
Restricted area
144 Japan -- Niigata — Arrival information; outer anchorages and pilotage 08/18
153 Japan -- Honshu -- Akita Funakawa Ko — Depth caution 52/18
155 Japan -- Honshu -- Akita Ku — Depth caution 52/18
180 Japan -- Honshu -- Kashima Ko — Vertical clearance 22/18
193 Japan -- Honshu -- East coast -- Ishinomaki Wan -- Sendai -- Shiogama Ko — 21/19
Directions
197 Japan -- Honshu -- East coast -- Ogatsu Wan -- Ogatsu Ko — Directions; leading 21/19
lights
198 Japan -- Honshu -- East coast -- Kinkasan To -- Shishi Watari — Vertical clearance; 21/19
caution
198 Honshu -- East coast -- Izu Shima — Vertical clearance 21/19
209 Japan -- Honshu -- Kuji Ko — Breakwater construction 47/19
226 Japan -- Hokkaido -- Ishikariwan Ko — Directions; depths 21/18
280 Russia -- Ostrov Shikotan — Marine reserve 33/19
280 Russia -- Ostrov Shikotan -- Bukhta Malokuril’skaya — Submarine cable 06/19
288 Russia -- Sea of Okhotsk -- Ostrov Iturup -- Kuril’skiy Zaliv — Anchorage 07/19
NP42A Japan 2 7th Edition (2020) 13/20
134 Honshu -- South coast -- Suruga Wan -- Oigawa Ko — Depths 13/20
141 Honshu -- O Shima -- Habu Ko — Leading lights 13/20
177 Tokyo Wan -- Tokyo--Ku — Traffic regulations; prohibited area 13/20
4.40 Wk26/20
IV
Weekly
NP42B Japan 3 12th Edition (2019) 49/19
191 Seto Naikai -- Kurushima Kaikyo — Navigation; tidal streams 09/20
192 Seto Naikai -- Kurushima Kaikyo — Tidal stream signals 09/20
218 Seto Naikai -- Hakata Seto -- Hakata Shima — Vertical clearance 04/20
294 Seto Naikai -- Harima Nada -- West side -- Okado Hana to Inge Shima — Directions; 49/19
obstruction
298 Seto Naikai -- Harima Nada -- North side -- Ishima Suido to Himeji Ko — Directions; 49/19
obstruction
304 Japan -- Seto Naikai -- Himeji Ko — Traffic regulations; signal station 23/20
320 Seto Naikai -- Kii Suido -- Tokushima — Restricted area 15/20
339 Kii Suido -- Wakayama--Shimotsu Ko -- Kainan Ku — Vertical clearance 04/20
347--348 Seto Naikai -- Osaka Wan -- Kobe Ku — Outer anchorages 52/19
350 Japan -- Osaka Wan -- Kobe -- Kobe--Chuo Passage — Directional light 02/20
NP42C Japan 4 5th Edition (2015) 18/15
75 Nansei Shoto -- Sakishima Gunto -- Miyako Shima -- Hirara Ko — Vertical clearance 24/19
97 Japan -- Okinawa Shima -- Itoman Gyoko — Bridge; vertical clearance 14/19
99 Nansei Shoto -- Okinawa Shima -- Toguchi Ko — Vertical clearances; directions 27/19
102 Okinawa Shima -- South--west side -- Naha Ko — Traffic regulations; prohibited area 18/19
102 Nansei Shoto -- Okinawa Shima -- Naha Ko — Restricted area 15/20
113 Okinawa -- Nakagusuku Shinko — Harbour; development 48/17
192 Kyushu -- Kagoshima Ko — Anchorage and pilotage positions 24/15
199 Kyushu -- South--west coast -- East of Koshikijima Retto -- Koshiki Kaikyo -- Naka Se 10/17
— Other aids to navigation; racon
244 Kyushu -- Yatsushiro Kai -- Yatsushiro Ko — Berths 42/17
246 Yatsushiro Ko — Basins and berths 17/18
257 Shimabara Wan -- Misumi Ko — Bridge; vertical clearance 19/17
259 Shimabara Wan -- Misumi Ko — Bridge; vertical clearance 19/17
288 Japan -- Approaches to Sasebo Ko -- Terashima Suido — Marine farms 21/18
357--358 Kyushu -- North--west side -- Hakata Ko — Anchorage 18/19
358 Kyushu -- North--west side -- Hakata Ko — Pilotage 18/19
NP43 South and East Coasts 12th Edition (2020) 10/20
of Korea, East Coast of
Siberia and Sea of
Okhotsk
86 South Korea -- Jejudo -- North--west coast -- Aewol Hang — Directions; light 10/20
86 South Korea -- Jejudo -- North--west coast -- Aewol Hang — Directions; wreck 17/20
86 South Korea -- Jejudo -- North--west coast -- Aewol Hang — Directions; light 10/20
90 South Korea – Jejudo -- East coast – Udo Sudo — Directions; wreck 10/20
111 South Korea -- South coast -- Geogeum Sudo — Vertical clearance 22/20
114 South Korea -- South coast -- Jimaseom to Yeondo — Directions; offshore platform 10/20
116 South Korea -- South coast -- Geumodo -- Geumo Sudo — Prohibited area 10/20
125 South Korea -- Yeosu Haeman — General information; VTS 10/20
128 South Korea -- South coast -- Yeosu Haeman — Anchorages 10/20
129 South Korea -- Yeosu Hang — Tugs 10/20
131 South Korea -- Yeosu Hang — Tugs 10/20
151 South Korea -- South coast -- Geojedo -- Okpo Hang — Directions; lights 10/20
152 South Korea -- South coast -- Geojedo -- Okpo Hang — Directions; lights 10/20
Wk26/20 4.41
IV
Weekly
156 South Korea -- South coast -- Busan New Port — Directions; directional light 10/20
158 South Korea -- Approaches to Busan New Port and Masan -- Jinhae Hang — 13/20
Pilotage
161 South Korea -- South coast -- Jinhae Man — Goheyon Fairway 10/20
171 South Korea -- South coast -- Busan Hang — Directions; directional light 10/20
180 South Korea -- South--east coast -- Uslan Hang — Wreck 10/20
180 South Korea -- Ulsan Hang — Restricted Area 10/20
199 South Korea -- East coast -- Donghae Hang — Anchorages 10/20
243 Russia -- Zaliv Petra Velikogo -- Zaliv Amurskiy — Directions; marine farms 10/20
248 Russia -- Vladivostok -- Zaliv Ussuriyskiy — Regulations; prohibited area 10/20
249 Russia -- Vladivostok -- Zaliv Ussuriyskiy -- Bukhta Bol’shogo Kamnya — Prohibited 10/20
area
249 Russia -- Vladivostok -- Zaliv Ussuriyskiy -- Bukhta Bol’shogo Kamnya — Directions 10/20
258 Russia -- Vladivostok -- Zaliv Strelok — Marine farms 20/20
NP44 Malacca Strait and 14th Edition (2019) 40/19
West Coast of
Sumatera
99 Indonesia -- Sumatera -- North--east coast -- Belawan — Pilotage 40/19
99 Indonesia -- Sumatera -- North--east coast -- Belawan — Anchorages 40/19
99 Indonesia -- Sumatera -- East coast -- Belawan — Directions; buoyage 43/19
99--100 Indonesia -- Sumatera -- East coast -- Belawan — Directions 43/19
134 Malaysia -- North channel leading to Pinang Harbour — Directions 41/19
135 Malaysia -- South Channel leading to Pinang Harbour — Vertical clearance 41/19
136 Malaysia -- South Channel -- Inner Part — Directions; alignment 41/19
137 Malaysia -- Pinang Harbour — Limiting conditions; bridge 41/19
147 Malaysia – Malacca Strait -- Approaches to Lumut — Depths 40/19
150 Malaysia – Malacca Strait -- Approaches to Lekir Bulk Terminal — Directions; depths 40/19
154 Malaysia -- Selangor -- S Sungai Besar — Directions; wreck 12/20
163 Malaysia -- Port Dickson — Arrival information; anchorage; shoal 11/20
165 Malaysia -- Port Dickson -- Kuala Sepang Besar — Berths 12/20
173 Malaysia -- Malacca Strait -- Pulau Pisang — Directions; light buoy 40/19
183 Malaysia -- Singapore Strait -- Tanjung Pelapas — Pilotage 02/20
184 Indonesia -- Singapore Strait -- Selat Durian — Anchorage 24/20
188 Indonesia -- Pulau Batam -- Sekupang — Directions; buoyage 02/20
264 Malaysia -- Johor -- Pelabuhan Calder — Directions; wreck 40/19
NP45 Mediterranean 1 16th Edition (2018) 14/18
10 Malta — National regulations; conservation areas 33/19
112 Spain -- Approaches to Cartagena — Approach and entry 31/18
112--113 Spain -- Approaches to Cartagena — Regulations; buoyage 31/18
112 Spain -- Approaches to Cartagena — Regulations; buoyage 13/19
113 Spain -- Approaches to Cartagena — Directions; buoyage 31/18
113 Spain -- Approaches to Cartagena — Directions; buoyage 13/19
133 Spain -- East coast -- Valencia — Outer anchorage; pilotage; directions 48/19
139 Spain -- East coast -- Castellón — Anchorages 02/20
144 Spain -- Cabo de Oropesa to Cabo Tortosa -- Sant Carles de la Ràpita — Pilotage 25/19
159 Spain -- Barcelona — Traffic regulations 04/20
165 Spain -- East coast -- Puerto de Blanes — Directions; buoy 23/18
179--180 Spain -- Islas Baleares -- Ibiza and Formentera — Marine reserve 08/19
185 Spain -- Islas Baleares -- Ibiza — Marine reserve 08/19
4.42 Wk26/20
IV
Weekly
189 Spain -- Islas Baleares -- Ibiza — Marine reserve 08/19
192 Spain -- Isla de Ibiza -- Ibiza -- Isla Grossa — Pilotage 52/18
192 Spain -- Isla de Ibiza -- Puerto de Ibiza — Regulations 02/19
195 Spain -- Islas Baleares -- Mallorca -- South coast — Marine reserves 14/19
196 Spain -- South--west coast of Isla de Mallorca -- Freu de Cabrera — Buoy 22/18
199 Spain -- Islas Baleares -- Mallorca -- Ensenada de Santa Ponça — Anchorage 08/19
205 Spain -- Mallorca -- Palma — Outer anchorages 49/19
206 Spain -- Islas Baleares -- Palma -- Porto Pi — Wreck 52/19
208 Spain -- Islas Baleares -- Mallorca -- Puerto de Sóller — Wreck 12/20
208 Spain -- Islas Baleares -- Mallorca -- Puerto de Sóller — Wreck; buoyage 24/20
223 Spain -- Isla de Menorca -- Isla del Aire — Marine reserve 22/19
224 Spain -- Isla de Menorca -- East coast — Anchorage 47/18
225 Spain – Islas Baleares -- Isla de Menorca – Mahón — Submarine cables; pipelines 28/19
226 Spain -- Isla de Menorca -- East coast — Anchorage 47/18
226 Spain -- Isla de Menorca -- Isla del Aire — Marine reserve 22/19
227 Spain -- Isla de Menorca -- South coast — Anchorage 47/18
239 Morocco -- Al Hoceïma — Pilotage 46/18
239 Morocco -- Al Hoceïma — Directions; leading lights 50/18
240 Morocco -- North coast -- Baie Betoya -- Anse d’Azanen — Prohibited area 28/19
241 Morocco -- North coast -- Baie Betoya -- Anse d’Azanen — Prohibited area; 28/19
development
264 Algeria -- Golfo d’Arzew to Cap Ténès -- Pointe Rouge — Directions; obstruction 15/18
265 Algeria -- Port de Ténès — Outer anchorage; direction; depths 43/18
266 Algeria -- Alger — Directions; light 04/19
272 Algeria -- Alger — Light 04/19
272 Algeria -- Alger — Anchorages; submarine cables 10/20
279 Algeria -- Cap Carbon to Cap Bougaroun -- Djen-- Djen — Directions; major lights 04/19
279 Algeria -- Cap Carbon to Cap Bougaroun -- Djen-- Djen — Directions; major light 12/19
287 Algeria -- Skikda and Port Méthanier — Anchorages 15/18
287 Algeria -- Golfe de Stora -- Skikda and Port Méthanier — Anchorages 34/18
288 Algeria -- Golfe de Stora -- Stora — Prohibited anchorage 34/18
291 Algeria -- Annaba — Directions; wreck 43/19
291 Algeria -- Golfe D’Annaba -- Annaba to Ras Rosa — Directions; wreck 08/20
291 Algeria -- Annaba — Outer anchorage; controlling depths 43/18
299 Tunisia -- Golfe de Tunis -- Djamour el Kébir — Prohibited area 28/18
300 Tunisia -- Golfe de Tunis -- Ra’s Sidi Ali el Mekki — Prohibited anchorage 09/20
302 Tunisia -- Bizerte — Obstruction 22/19
306 Tunisia -- Golfe de Tunis -- Ra’s Sidi Ali el Mekki — Prohibited anchorage 09/20
307 Tunisia -- Golfe de Tunis -- Ra’s Sidi Ali el Mekki — Anchorage 09/20
312 Tunisia -- Cap Bon to Cap Afrique -- Sousse — Traffic regulations 35/18
326 Tunisia -- Gulf of Gabès — Directions; wreck 28/18
326 Tunisia -- Gulf of Gabès -- La Skhirra — Directions; light 32/18
335 Italy -- Sicilian Channel -- Isola di Pantelleria -- Porto di Pantelleria — Arrival 13/19
information; prohibited anchorage and fishing area
342 Malta -- North coast -- Sikka il Bajda — Anchorage 37/19
342 Malta -- Marsaxlokk -- East of Il--Ponta ta’ Delimara — Prohibited anchorage; 19/20
obstruction
342 Malta -- North--east coast — Conservation areas around wrecks 33/19
345 Malta -- Approaches to Valletta Harbour — Conservation areas around wrecks 33/19
Wk26/20 4.43
IV
Weekly
346 Malta -- Marsaxlokk -- East of Il--Ponta ta’ Delimara — Prohibited anchorage; 19/20
obstruction
349--350 Malta -- Il--Belt Valletta -- Il--Port ta’ Marsamxett — Directions 38/19
350 Malta -- East coast — Conservation areas around wrecks 33/19
402 Italy -- Tyrrhenian Sea -- North coast of Sicilia -- Capo Rasocolmo — Prohibited areas 20/19
402 Sicilia -- North coast -- Capo Peloro — Wrecks; prohibited areas 44/19
402 Sicily -- North coast -- Capo di Milazzo — Marine Reserve 20/19
404 Sicilia -- North coast -- Capo d’Orlando — Anchorage 44/19
406 Sicilia -- North coast -- Porto Di Milazzo — Prohibited area 34/18
406 Sicilia -- North coast -- Porto Di Milazzo — Prohibited areas 32/19
406 Sicilia -- North coast -- Porto Di Milazzo — Prohibited area 11/20
407 Sicilia -- North coast -- Porto Di Milazzo — Regulations 32/19
408 Sicilia -- North coast -- Porto Di Milazzo — Directions; prohibited area 34/18
439 Italy -- Stretto di Messina -- Porto di Villa San Giovanni — Arrival information 32/19
460 Italy -- Porto di Augusta — Directions; wreck 17/18
465 Italy -- Sicilia -- South--east coast -- Santa Panagia Oil Terminal — Prohibited areas; 13/19
pipeline
489 Italy -- Porto Nuovo — Directions; chimney 22/20
491 Italy -- South--east coast -- Golfo di Taranto — Prohibited areas 45/18
492 Italy -- South--east coast -- Golfo di Taranto — Directions; prohibited area; 45/18
obstructions
495 Italy -- Golfo di Taranto -- Capo Spulico — Anchorage; caution 45/18
498 Italy -- Golfo di Taranto -- Taranto — Prohibited area 50/19
498 Italy -- Golfo di Taranto -- Taranto — Prohibited area 13/20
511 Italy -- Golfo di Taranto -- Gallipoli — Prohibited area 19/18
55 France -- South coast -- Gulf of Lions — Directions; ODAS buoys 30/19
56 France -- Gulf of Lions -- Port--Vendres — Traffic regulations; speed restrictions 21/20
58 France -- South coast -- Gulf of Lions -- Cap Béar — Anchorage 29/19
59 France -- South coast -- Gulf of Lions -- Cap d’Agde — Prohibited area 12/20
61 France -- Gulf of Lions -- Port--la--Nouvelle — Regulations 04/20
61 France -- Gulf of Lions -- Port--la--Nouvelle — Regulations 08/20
64 France -- Gulf of Lions -- Sète — Outer anchorage; wrecks and obstructions 13/20
67 France -- South coast -- Gulf of Lions -- Golfe d’Aigues Mortes — Seaplane operating 49/18
area
67 France -- South coast -- Gulf of Lions — Directions; light 45/19
71 France -- South coast -- Gulf of Lions -- Golfe de Fos — Seaplane operating area 49/18
72 France -- South coast -- Gulf of Lions -- Port de Fos — Entry regulations 28/19
77 France -- South coast -- Gulf of Lions -- Port--de--Bouc — Regulations 28/19
79 France -- South coast -- Gulf of Lions -- Canal de Caronte — Traffic regulations 28/19
97 France -- South coast -- Port de Toulon — Prohibited area 29/19
102 France -- Toulon -- Îles d’Hyères — Regulations 06/19
102 France -- South coast -- Rade D’Hyères — Prohibited anchorages 02/19
114 France -- Baie des Anges -- Nice — Prohibited anchorages 36/19
115 France -- South coast -- Baie de la Figueirette -- Port de Miramar — Directions 32/19
116 France -- Pointe de l’Aiguille to Port de Mandelieu--La Napoule — Prohibited 36/19
anchorages
116 France -- South coast -- Golfe de la Napoule — Pilotage 22/19
118 France -- Golfe de la Napoule -- Rade de Cannes — Restricted area 16/20
4.44 Wk26/20
IV
Weekly
118 France -- South coast -- Golfe de la Napoule -- Cannes — Anchorage 45/19
118 France -- South coast -- Golfe de la Napoule -- Cannes — Pilotage 45/19
119 France -- South coast -- Golfe Juan — Prohibited area; seaplane area 41/18
119 France -- South coast -- Golfe Juan — Pilotage 22/19
119 France -- South coast -- Golfe Juan — Anchorages; depths; wrecks 45/19
120 France -- Baie des Anges -- Nice — Restricted area; prohibited anchorage 36/19
122 France -- South coast -- Baie des Anges -- Port de Nice — Pilotage 22/19
123 France -- South coast -- Cap D’Antibes -- Anse de la Garoupe — Anchorage 41/19
123 France -- South coast -- Baie des Anges -- Port Vauban — Pilotage 22/19
124 France -- South coast -- Baie des Anges -- Marina Baie des Agnes — Pilotage 22/19
124 France -- South coast -- Baie des Anges -- Port de Cros--de--Cagnes and Port de 22/19
Saint--Laurent--du--Var — Pilotage
124 France -- South coast -- Rade de Villefranche — Pilotage 22/19
125 France -- Rade de Villefranche — Prohibited anchorages 36/19
125 France -- Rade de Villefranche — Prohibited anchorage 43/19
125 France -- South coast -- Port de Villefranche--sur--Mer — Pilotage 22/19
125 France -- West--south--west of Port de Monaco -- Cap Roux -- L’Isoletta — Anchorage 41/19
125 Monaco -- Port de Monaco — Protected area 46/18
127 Monaco -- Port de Monaco — Prohibited area 46/18
127 France -- South coast -- Baie de Beaulieu — Pilotage 22/19
132 Italy -- Gulf of Genoa -- San Bartolomeo al Mare -- Capo Mele — Submarine pipelines 44/19
134 Italy -- Gulf of Genoa -- Imperia — Wrecks 07/19
141 Italy -- Gulf of Genoa -- Arenzano — Restricted area 41/18
148 Italy -- Genova — Regulations; speed limit 45/18
150 Italy -- Genova —Directions; wreck 09/19
158 Italy -- Gulf of Genoa -- La Spezia approaches — Directions; wreck 15/20
160 Italy -- La Spezia — Outer anchorages; wrecks 41/18
160 Italy -- West coast -- Gulf of Genoa -- La Spezia — Prohibited anchorage 12/20
164 Italy -- West coast -- Gulf of Genoa -- La Spezia — Depth 12/20
164 Italy -- West coast -- Gulf of Genoa -- La Spezia — Basins and berths 12/20
168 Italy -- South--east of La Spezia -- Forte dei Marmi — Wreck; prohibited area 50/19
187 France -- Corse -- North--west coast -- Port de I’Île--Rousse — Pilotage 41/18
187 France -- Corse -- North coast -- Port de l’Île--Rousse — Regulations 04/20
188 France -- Corse -- North--west coast -- Port de Calvi — Pilotage 41/18
188 France -- Corse -- Golfe de Calvi -- Port de Calvi — Prohibited area 23/20
188 France -- Corse -- North coast -- Port de Calvi — Regulations 04/20
205 Italy -- Sardegna -- Bonifacio Strait — Marine reserve 07/19
215 France -- Corse -- East coast -- Bastia — Prohibited area 49/19
217 France -- Corse -- East coast -- Lucciana Oil Terminal — Prohibited area 49/19
229 Italy -- West coast -- Corsican Channel TSS to Isola Giannutri — Routes 04/19
230 Italy -- West coast -- Isola del Giglio — Directions; light 04/19
230 Italy -- West coast -- Isola del Giglio -- Punta del Capel Rosso — Major light 18/19
230 Italy -- West coast -- Corsican Channel TSS to Isola del Giglio — Directions 04/19
230 Italy -- West coast -- Isola del Giglio to Isola di Giannutri — Directions; useful marks 04/19
231 Italy -- West coast -- Isola del Giglio — Light 04/19
232 Italy -- West coast -- Corsican Channel TSS to Isola d’Elba — Light 04/19
239 Italy -- Isola d’Elba -- Punta dei Ripalti — Prohibited area 23/20
241 Italy -- Portovecchio di Piombino — Berths; draught restrictions 41/18
Wk26/20 4.45
IV
Weekly
241 Italy -- Golfo di Follonica -- Torre del Sale — Restricted area 41/18
243 Italy -- West coast -- Promontorio Argentario — Prohibited area 41/18
243 Italy -- West coast -- Isola del Giglio — Directions; light 04/19
244 Italy -- Porto Santo Stefano — Basins and berths; depth 41/18
255 Italy -- Sardegna -- North--west coast -- Alghero — Prohibited anchorage 07/20
264 Italy -- Sardegna -- South coast -- Capo Teulada — Prohibited area 05/20
266 Italy -- Sardegna -- Golfo di Palmas -- Portovesme — Regulations 06/20
268 Italy -- Sardegna -- Golfo di Palmas -- Porto di Sant’ Antioco — Directions 23/20
270 Italy -- Sardegna -- Capo Teulada — Prohibited area 45/18
270 Italy -- Sardegna -- South coast -- Golfo di Teulada -- Porto Zafferano — Directions; 41/18
wreck
282 Italy -- Sardegna -- La Maddalena — Obstruction 32/19
292 Italy -- Sardegna -- North--east coast -- Golfo Aranci — Prohibited area 21/20
295 Italy -- Sardegna -- Porto di Olbia — Pilotage 46/19
295 Italy -- Sardegna -- Porto di Olbia — Speed limit 06/20
299 Italy -- Sardegna -- Golfo Spurlatta — Restricted area 45/18
300 Italy -- Sardegna -- North--west coast -- Isola Tavolara — Anchorage 41/18
302 Italy -- Sardegna -- East coast -- Porto di Arbatax — Prohibited areas 06/20
305 Sardegna -- East coast -- Capo San Lorenzo — Prohibited area 06/19
328 Italy -- West coast -- Isole Pontine -- Isola di Ponza — Restricted areas 14/19
331 Italy -- West coast -- Gaeta — Prohibited area 40/19
336 Italy -- West coast -- Gaeta — Anchorages 14/19
338 Italy -- West coast -- Isole Pontine -- Isola di Ventotene — Restricted area 14/19
345 Italy -- Porto di Procida — Prohibited anchorage 41/18
354 Italy -- Golfo di Napoli -- Castellammare di Stabia — Anchor berths 14/19
378 Italy -- West coast -- Marina di Camerota — Anchorage 41/18
1 Albania — Former mined areas 46/19
6 Greece — Regulations; historic wrecks 28/18
77 Greece -- West coast -- Pelopónnisos -- Stenó Prótis — Directions; historic wreck 28/18
77 Greece -- West coast -- Pelopónnisos -- Marathópolis — Anchorage 28/18
78 Greece -- West coast -- Pelopónnisos -- Stenó Prótis — Anchorage 28/18
85 Greece -- Nísos Zákynthos -- Órmos Alykés — Wreck 21/18
86 Greece -- West coast -- Kólpos Argostolíou — Restricted area 47/18
108 Greece -- Préveza -- West--south--west of Fort Áktion — Directions; wreck 21/18
113 Greece -- Patraïkós Kólpos — Regulations; historic wrecks 28/18
115 Greece -- West coast -- Patraïkós Kólpos — Seaplane landing area 04/18
118 Greece -- West coast -- Pátrai Harbour — Seaplane operating areas 04/18
147 Greece -- Ionian Sea -- Stenó Kérkyras -- Kérkyra Harbour — Pilotage 02/20
150 Albania -- Stenó Kérkyras -- Northern part — Directions; historic wrecks 37/18
158 Albania – Gjiri i Vlorës — Restricted areas 05/20
158 Albania – Gjiri i Vlorës — Prohibited anchorage 05/20
159 Albania -- Gjiri i Vlorës -- Vlorë — Oil terminal 04/20
160 Albania -- Gjiri i Vlorës -- Vlorë — Oil terminal 04/20
4.46 Wk26/20
IV
Weekly
165 Albania -- Durrës — Pilotage 04/20
166 Albania -- Durrës — Directions; pilotage 04/20
167 Albania -- Durrës — Directions; wreck 04/20
179 Montenegro -- Boka Kotorska — Pilotage 10/20
179 Montenegro -- Boka Kotorska -- Hercegnovski Zaliv — Pilotage 19/20
185 Montenegro -- Boka Kotorska -- Tivat — Pilotage 10/20
188 Montenegro -- Kotor — Directions; pilotage 11/19
188 Montenegro -- Kotor — Pilotage 10/20
189 Montenegro -- Risanski Zaliv -- Anchorage 10/20
203 Croatia -- Mljetski Kanal -- Otok Mljet — Restricted areas 06/20
210 Croatia -- Mljetski Kanal -- Otok Mljet -- Luka PolaÅe — Prohibited anchorage 06/20
234 Croatia -- PloÅe — Limiting conditions; vessel size 32/19
234 Croatia -- PloÅe — Regulations 32/19
237 Croatia -- PloÅe -- Rijeka Neretva — Directions; buoyage 42/19
263 Croatia -- Splitski Kanal — Anchorage 32/17
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage; modification of area 10/18
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage 40/17
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage; modification of area 10/18
269 Croatia -- West of Split -- Trogirski Kanal — Vertical clearance 50/19
328 Croatia -- SedmovraÆe — Pilotage 26/18
369 Croatia -- Rijeka — Pilotage 23/20
419 Croatia -- Tihi Kanal — Pilotage 26/18
423 Croatia -- Faýanski Kanal — Pilotage 26/18
444 Slovenia -- Gulf of Trieste -- Koper — Anchorages 26/18
445 Slovenia -- Koprski Zaliv — Marine protected areas 33/19
445 Slovenia -- Koprski Zaliv — Directions 33/19
450 Italy -- Trieste -- Porto Industriale — Directions; light 14/18
460 Italy -- Strait of Otranto -- South of Capo d’Otranto — Prohibited area 44/19
460 Italy -- Strait of Otranto -- Castro — Directions; marine farm 44/19
461 Italy -- Otranto — Development 05/18
466 Italy -- Brindisi — Arrival information; regulations concerning entry 35/17
467 Italy -- Brindisi — Directions; light sector 35/17
467 Italy -- East coast -- Brindisi -- Capo di Torre Cavallo — Directions; stranded wreck 05/20
470 Italy -- Monopoli — Depths; berths 49/17
471 Italy -- Monopoli to Bari — Marine farms 21/20
476 Italy -- East of Bisceglia — Marine farm; restricted area 28/18
487--488 Italy -- Adriatic Sea -- Isola Pianosa — Prohibited areas 45/17
488 Italy -- Adriatic Sea -- Isole Tremiti — Restricted areas; overhead cables 45/17
489 Italy -- South east coast -- South east of Vasto — Restricted area; marine farm 35/18
492 Italy -- South east coast -- Approaches to Ortona — Prohibited entry; directions; 35/18
obstructions
494 Italy -- Pescara — Anchorages; pilotage 45/18
498 Italy -- East coast -- Pescara to Pedaso — Restricted area 11/19
498 Italy -- East coast -- Pescara — Directions; obstruction 16/18
501 Italy -- East coast -- Approaches to Ancona and Falconara — Traffic regulations 41/18
505 Italy -- Ancona — Traffic regulations; outer anchorage; pilotage 11/20
Wk26/20 4.47
IV
Weekly
505 Italy -- East coast -- Ancona — Outer anchorages 42/19
505 Italy -- Ancona — Traffic regulations; outer anchorage; pilotage 11/20
506--507 Italy -- Ancona — Directions 11/20
509 Italy -- Ancona — Falconara Marittima — Arrival information 11/20
509--510 Italy -- Ancona — Falconara Marittima — Directions 11/20
510 Italy -- East coast -- Falconara Marittima -- API Refinery Pier — Obstruction 32/17
513 Italy -- North Adriatic -- Rimini — Prohibited area 05/18
514 Italy -- East coast -- Approaches to Ravenna — Directions; wrecks 41/18
528 Italy -- Laguna Di Venezia — Vessel traffic service 22/18
533 Italy -- Venezia — Depths 45/18
533 Italy -- Venezia — Depths 09/19
533 Italy -- Venezia — Authorised draughts 47/19
533 Italy -- Venezia — Vertical clearance 15/20
534 Italy -- Venezia — Traffic regulations 46/19
536 Italy -- Venezia -- Canale Vittorio Emanuele — Depths 09/19
81--82 Greece -- Nísos Kríti -- Irákleion — Directions; historic wreck 18/20
142 Greece -- Athens -- Peiraiás — Port development 24/20
143 Greece -- Athens -- Peiraiás — Directions; port development 24/20
151 Greece -- Saronikós Kólpos -- Stenó Nafstáthmou — Directions; obstruction 42/19
262 Greece -- Aegean Sea -- Nisída Levítha — Directions; wreck 04/20
268 Greece – South Aegean – Nísos Léros -- Órmos Lakkí — Prohibited area; historic 34/19
wrecks
270 Greece – South Aegean – Nísos Léros -- Órmos Lakkí — Prohibited area; historic 34/19
wrecks
356 Greece -- North Aegean -- Thessaloníki — Prohibited anchorage; wrecks 34/19
429--430 Turkey -- West coast -- AliaÔa — Outer anchorages 50/19
438 Turkey -- Approaches to Ayvalik -- Dalyan BoÔazÝ — Directions 52/19
464 Greece -- Alexandroúpoli — Wreck 04/20
67 Libya -- ®arºbulus — Pilotage 04/19
104 Egypt -- North coast -- Port of Gargoub to Râs ‘Alam el--Rûm — Directions 52/19
105 Egypt -- North coast -- Port of Gargoub — Directions; development; anchorage 52/19
111 Egypt -- MØnº’ Al IskandarØyah — Anchorage; wreck 46/19
115 Egypt -- MØnº’ Al IskandarØyah — Directions; wreck; buoys 11/19
115 Egypt -- MØnº’ Al IskandarØyah — Directions; buoy 11/19
115 Egypt -- MØnº’ Al IskandarØyah — Wreck 46/19
127 Egypt -- Port Said — Prohibited anchorage area 23/18
127 Egypt -- Port Said — Prohibited anchorage area 38/18
159--160 Turkey -- Fethiye Körfezi -- Fethiye LimanÝ — Anchorages 06/20
160 Turkey -- Fethiye Körfezi -- KÝzÝl Adalar — Anchorages 06/20
172 Turkey -- Antalya Körfezi -- Alanya — Anchorage 11/20
174 Turkey -- Antalya Körfezi to Iskenderun Körfezi — Vessel traffic service 37/19
175 Turkey -- South coast -- Approaches to Taîucu Körfezi — Directions; marine farm 09/19
175 Turkey -- Taîucu Körfezi — Pilotage 46/19
176 Turkey -- OvacÝk Körfezi — Pilotage; anchorage 46/19
176 Turkey -- Mediterranean Sea -- OvacÝk Körfezi — Alongside berths; useful mark 08/19
176 Turkey -- ™ncekum Burnu to Mersin — Vessel traffic service 37/19
177 Turkey -- South coast -- ™ncekum Burnu to Mersin — Directions; wreck 50/19
177 Turkey -- Mersin — Vessel traffic service 37/19
4.48 Wk26/20
IV
Weekly
177 Turkey -- Mersin Körfezi -- Mersin — Anchorages 48/19
178 Turkey -- Mersin Körfezi — Prohibited area 35/18
179 Turkey -- Mersin to Karataî Burnu — Vessel traffic service 37/19
181 Turkey -- ™skenderun Körfezi -- YumurtalÝk Koyu -- DevegeçeÔi — Directions; light 18/20
182 Turkey -- ™skenderun Körfezi -- YumurtalÝk Koyu -- DevegeçeÔi — Directions; light 18/20
182 Turkey -- South coast -- Karataî — Pilotage 29/19
183 Turkey -- South--east coast -- ™skenderun Körfezi — Outer anchorages 37/18
183 Turkey -- South--east coast -- Head of ™skenderun Körfezi — Anchorages; pilotage 50/19
183 Turkey -- ™skenderun Körfezi — Outer anchorages 03/20
183 Turkey -- South--east coast -- Head of ™skenderun Körfezi — Anchorages; pilotage 50/19
183 Turkey -- ™skenderun Körfezi — Pilotage 03/20
183 Turkey -- ™skenderun Körfezi — Prohibited area 01/20
184 Turkey -- ™skenderun Körfezi -- Botaî (Dörtyol) Oil Terminal — General information 09/19
186 Turkey -- ™skenderun Körfezi -- ™sdemir — Pilotage 03/20
186 Turkey -- South coast -- ™skenderun-- ™sdemir — Restricted area 02/20
186 Turkey -- South coast -- ™sdemir — Port development 29/19
186 Turkey -- ™skenderun Körfezi -- ™sdemir — Berths; depths 32/18
186 Turkey -- South coast -- ™sdemir — Jetties 29/19
187--188 Turkey -- ™skenderun Körfezi -- ™skenderun — Berths; depths 32/18
188 Turkey -- ™skenderun Körfezi -- ™skenderun — Berths; depths 32/18
200 Cyprus -- South coast -- Vasilikos — Anchorages 19/19
207 Cyprus -- East coast -- Fumagusta — Anchorage 02/20
229 Lebanon -- Sel’ Ata -- Ra’s Kubbº — Shoal 49/18
238 Israel -- •efa -- Qishon Harbour — Controlling depths 50/19
239 Israel -- •efa — Anchorages 43/19
239 Israel -- •efa — Pilotage 43/19
240 Israel -- •efa — Directions 43/19
240 Israel -- •efa — Directions 41/19
245 Israel -- Ashdod — Pilotage 23/18
246 Israel -- Ashdod — Directions 41/19
NP50 Newfoundland and 14th Edition (2016) 34/16
Labrador
130 Canada -- Newfoundland -- Placentia Bay — Depths 30/18
145 Canada -- Newfoundland -- South coast -- Placentia Bay -- North Harbour — Fish 35/18
haven
149 France -- Île Saint--Pierre and Miquelon — Directions; depth 47/18
149 Canada -- Newfoundland -- Burin Peninsula — Directions; buoy 47/18
152 France -- Île Saint--Pierre and Miquelon -- Port de Saint--Pierre — Speed limit 02/18
152 France -- Île Saint--Pierre and Miquelon — Pilotage 46/19
155 France -- Île Saint--Pierre and Miquelon — Directions; buoy 47/18
155 France -- Newfoundland -- Petite Miquelon — Directions; depth 40/18
156 France -- Île Saint--Pierre and Miquelon — Anchorage 47/18
156 France -- Île Saint--Pierre and Miquelon — Pilotage 46/19
156 France -- Newfoundland -- Anse de Miquelon — Anchorage 38/18
158 Canada -- Newfoundland -- South coast -- Fortune Harbour — Anchorage 08/19
158 Newfoundland -- Fortune Bay -- Fortune Harbour — Buoyage 02/20
362 Canada -- Newfoundland -- North--east coast -- Bide Arm — Directions; obstruction 21/19
375 Labrador -- Strait of Belle Isle Approaches — Caution; ODAS 01/19
428 Canada -- Labrador -- East coast -- Lake Melville — Dumping ground 35/18
Wk26/20 4.49
IV
Weekly
432 Canada -- Labrador -- East coast -- Goose Bay — Dumping ground 35/18
433 Canada -- Labrador -- Goose Bay Narrows — Directions; buoyage; depths; 39/16
controlling depths
433 Canada -- Labrador -- Goose Bay Narrows to Terrington Basin — Directions; shoal 18/17
454 Canada -- Labrador -- Goose Bay Narrows -- Directions; buoyage; depths; controlling 39/16
depths
NP51 New Zealand 19th Edition (2015) 51/15
5 Navigation and regulations -- Radio facilities — Radio navigational warnings 27/17
72 North Island -- Cape Maria van Diemen — Directions; light sector 23/18
81 North Island -- West coast -- Manukau Harbour — Regulations 32/18
82 North Island -- West coast -- Manukau Harbour — Prohibited anchorage 32/18
82 North Island -- West coast -- Manukau Harbour — Signal station 32/18
94 North Island -- West coast -- Port Taranaki — Anchorage; pilotage 26/19
94 North Island -- West coast -- Port Taranaki — Pilotage 03/18
104 North Island -- Wanganui — Entry; light 39/16
123 North Island -- Wellington — Limiting conditions; under--keel clearance 52/19
128 North Island -- Wellington Harbour — Directions; leading lights 52/19
130 North Island -- Wellington Harbour -- Evans Bay — Directions; berths 52/19
139 South Island -- Tory Channel — Pilotage 29/18
140 South Island -- Tory Channel — Traffic regulations 29/18
142 South Island -- Queen Charlotte Sound -- Perano Shoal — Directions; buoy; 31/18
anchorage
177 South Island -- West Cape to Windsor Point — Directions 39/16
203 Foveaux Strait -- Stewart Island -- East coast -- Muttonbird Islands — Position 16/20
204 Foveaux Strait -- Stewart Island -- Abbot Passage -- Muttonbird Islands — Position 16/20
205 Foveaux Strait -- Stewart Island -- Paterson Inlet and approaches -- Muttonbird 16/20
Islands — Position
210 North Island -- North Cape to Karaui Point — Directions 51/15
211 North Island -- Parengarenga Harbour — Directions 05/17
212 North Island -- North Cape to Karaui Point — Directions 51/15
217 North Island -- Bay of Islands — Pilotage, anchorages 51/15
219 North Island – Bay of Islands — Pilotage, anchorages 51/15
230 North Island -- Whangarei Harbour — Anchorages 39/17
243 North Island -- East coast -- Mahurangi Harbour — Restricted area 41/18
245 Hauraki Gulf -- Auckland approaches — Traffic regulations; reporting 46/17
249 Auckland approaches -- Motuihe Channel — Directions 46/17
252 North Island -- Auckland — Wreck 51/16
263 Auckland approaches -- Tamkai Strait — Local knowledge 46/17
263 North Island -- Auckland Approaches -- Tamaki Strait — Directions; wreck 51/18
274 North Island -- East coast -- Tauranga approaches — Exclusion zones 25/16
276 North Island – East Coast – Tauranga approaches — Exclusion zones 25/16
282 North Island -- East coast -- Tauranga — Anchorages 03/16
282 North Island -- Bay of Plenty -- Tauranga — Anchorages 47/18
285 North Island -- Tauranga -- Maunganui Roads and Stella Passage — Directions; 24/17
beacons
285 North Island -- Tauranga -- Town Reach — Directions; beacons 24/17
286 North Island -- Tauranga -- Town Reach — Directions; useful marks 24/17
286 North Island -- Tauranga -- Western Channel — Directions; buoyage 24/17
286 North Island -- Tauranga -- Otumoetai Channel — Directions; beacons 24/17
290 North Island -- East coast -- Tauranga approaches — Exclusion zones 25/16
291 North Island -- East coast -- Whakatane River — Description 06/16
4.50 Wk26/20
IV
Weekly
298 North Island -- East coast -- East Cape to Mahia Peninsula -- Gisborne — 02/16
Anchorages
298 North Island -- East coast -- Gisborne — Anchorages 35/17
300 North Island -- East coast -- Gisborne — Directions; lights 30/16
300--301 North Island -- Gisborne — Directions; entry 52/19
302 North Island -- Hawke Bay — Rocket launch precautionary area 43/19
303 North Island -- Hawke Bay — Directions; pilotage; anchorages 12/17
304 North Island – Hawke Bay — Directions; pilotage; anchorages 12/17
307 Napier -- Breakwater Harbour — Directions; light 16/16
314 South Island -- East coast -- Cape Campbell to Conway Flat — General information; 22/17
depths
315 South Island -- Cook Strait -- Cape Campbell — Directions; rocks 34/18
317 South Island -- Lyttelton -- Godley Head — Light 10/16
318 South Island -- East coast -- Pegasus Bay -- Approaches to Lyttelton — Directions; 33/19
wreck
319 South Island -- Lyttelton Harbour — Depth 02/19
319 South Island -- Lyttelton Harbour — Anchorage 02/19
320 South Island -- Lyttelton Harbour — Pilotage 02/19
320 South Island – Lyttelton – Godley Head — Light 10/16
320 South Island -- East coast -- Lyttelton Harbour — Directions; lights 08/20
320 South Island -- East coast -- Lyttelton Harbour — AIS 07/17
321 South Island -- East coast -- Lyttelton Harbour — Directions; lights 08/20
323 East coast of South Island -- Banks Peninsula — General information; marine 52/16
reserves; marine mammal sanctuary
324 Akaroa Harbour — Arrival information 22/16
324 South Island -- East coast -- Akaroa Harbour — Marine reserve 25/16
324 Akaroa Harbour — Arrival information 26/16
325 Akaroa Harbour — Berths; anchorages and moorings 22/16
326 South Island -- East coast -- Canterbury Bight — Wreck 25/16
328 South Island -- East coast -- Timaru Harbour — Pilot boarding place 50/17
334 South Island -- East coast -- Otago Harbour — Arrival information; pilotage 30/16
337 South Island -- East coast -- Otago Harbour -- Port Chalmers — Wharf development 50/17
344 Kermadec Islands — Directions 16/16
344 Raoul Island -- Denham Bay — Directions; obstruction 30/17
344 Kermadec Islands — Directions 16/16
344 Kermadec Islands — Anchorages and landing places 16/16
347 Chatham Island -- Hanson Bay — Restricted area 30/18
349 Chatham Islands -- Port Waitangi — Directions; lights 38/18
350 Chatham Island -- Kaingaroa Harbour — Directions; anchorages; depth 30/18
350--351 Pitt Island -- Motutapu Point — Directions 30/18
353 Auckland Islands — General information; prohibited area 06/17
NP52 North Coast of 10th Edition (2018) 32/18
Scotland
4 United Kingdom -- North Sea — Statutory safety zones 32/18
82 Scotland -- North--east coast -- Moray Firth — Wind farms 21/19
84 Scotland -- East coast -- Wick — Traffic signals 41/19
85 Scotland -- North--east coast -- Wick Harbour — Directions; buoyage 29/19
85 Scotland -- North--east coast -- Wick — Directions; clearing marks 08/19
108 Scotland -- East coast -- Cromarty Firth -- South--east of South Sutor — Anchorage 20/20
berths
Wk26/20 4.51
IV
Weekly
109 Scotland -- East coast -- Cromarty Firth — Regulations 31/19
109 Scotland -- East coast -- Cromarty Firth — Regulations 44/19
111 Scotland -- East coast -- Cromarty Firth -- The Ness to Nigg Pier — Transhipment 20/20
area
213 The Shetland Islands -- North Approach to Lerwick -- Cat Firth -- Directions; depth 04/19
219 Shetland Isles -- Stepping Stones -- Muckle Fladdicap — Directions; depth 08/19
267 Faroe Islands -- Tórshavn — Development 36/18
272 Faroe Islands -- SkálafjørÉur -- Runavík — Development 32/18
278 Faroe Islands -- Eysturoy -- FuglafjørÉur — Submarine cable 47/19
NP54 North Sea (West) 11th Edition (2018) 18/18
3 United Kingdom -- North Sea — Statutory safety zones 31/18
3 United Kingdom -- North Sea -- Marine exploitation — OREIs 25/18
61 Scotland -- South--east of Aberdeen — Offshore wind farm 25/18
65 Scotland -- Montrose — Pilotage 45/18
73 Scotland – River Tay — Directions; light sector; buoyage 34/19
74 Scotland -- East coast -- Dundee — Under keel clearance 21/19
74 Scotland -- East Coast -- Dundee — Depth 44/19
77 Scotland -- Perth — Under keel clearance; speed limit; draught 24/20
85 Scotland -- Methil — Under--keel clearance; navigable width 23/18
87 Scotland -- East coast -- Firth of Forth -- Kirkcaldy — Limiting conditions 13/19
89 Scotland -- Leith — Under--keel clearance; navigable width 23/18
89 Scotland -- East coast -- Firth of Forth -- Leith — Under--keel clearance 13/19
90 Scotland -- Leith — Lock width 23/18
92 Scotland -- Burntisland — Under--keel clearance; navigable width 23/18
98 Scotland -- Firth of Forth -- Hound Point Marine Terminal — Under--keel clearance 23/18
98 Scotland -- East coast -- Firth of Forth -- Hound Point Marine Terminal — Under--keel 13/19
clearance
99 Scotland -- Firth of Forth -- Inverkeithing — Pilotage; depths 34/19
100 Scotland -- Rosyth — Under--keel clearance 23/18
100 Scotland -- East coast -- Firth of Forth -- Rosyth — Under--keel clearance 13/19
104 Scotland -- Grangemouth — Under--keel clearance 23/18
130 England -- Tynemouth -- Whitley Bay — Directions; wreck 44/19
131 England -- East coast -- Port of Tyne -- Tynemouth — Regulations 52/19
174 England -- River Humber -- Skitter Channel — Light float 49/18
182 England -- East coast -- River Trent — Vertical clearance 48/18
186 England -- East coast -- River Humber to Cromer — Directions; wind farms 08/20
197 England -- The Wash -- King’s Lynn — Regulations 17/20
197 England -- East coast -- King’s Lynn — Pilotage; tugs 38/19
197 England -- The Wash -- King’s Lynn — Regulations; tugs 45/19
197 England -- The Wash -- King’s Lynn — Draught; regulations 11/20
197 England -- The Wash -- King’s Lynn — Draught; regulations 11/20
205 England -- East coast -- Great Yarmouth approaches — Directions; obstruction 29/18
206 England -- East coast -- Great Yarmouth and Lowestoft approaches — Depth 29/18
206 England -- East coast -- Great Yarmouth and Lowestoft approaches — Directions 29/18
209 England -- Great Yarmouth — Arrival information; pilotage 43/18
214 England -- Approaches to Lowestoft — Directions; depths 44/19
214 England -- Lowestoft -- Kirkley — Directions; light 15/20
4.52 Wk26/20
IV
Weekly
NP55 North Sea (East) 11th Edition (2018) 37/18
8 Germany -- German Bight -- Elbe — Regulations 04/20
64 United Kingdom -- North Sea -- East--south--east of Lowestoft — Wind farm 09/20
64 Germany -- Deep--water routes to the inner German Bight and the Ems — 23/20
Regulations
65 United Kingdom -- North Sea -- East--south--east of Lowestoft — Directions; mast 09/20
66 United Kingdom -- North Sea -- East--south--east of Lowestoft — Wind farm; 09/20
obstruction
67 Germany -- German Bight -- Elbe —TSS 04/20
89 Netherlands -- Zeegat van Texel — Lighthouse 07/19
90 Netherlands -- Zeegat van Texel — Directions; lighthouse 07/19
91 Netherlands -- Zeegat van Texel -- Breewijd — Directions 11/20
108 Germany -- North Sea -- Borkum Riffgrund — Prohibited area 11/20
113 Germany -- North Sea -- Alte Weser — Directions; light buoy 15/19
127 Germany -- North Sea -- Borkum Riffgrund — Prohibited area 11/20
130--131 Germany -- Osterems -- Greetsiel — Directions; route 12/20
137 Netherlands -- The Ems -- Ostfriesisches Gatje -- Delfzijl — UKC 10/20
138 Netherlands -- The Ems -- Delfzijl — Directions; buoy; shoal 10/20
151 Germany -- The Jade — Regulations; extraordinarily large vessels 39/18
166 Germany -- North Sea -- Approaches to the Jade and Weser — Directions; light buoy; 15/19
light sectors
166 Germany -- Alte Weser — Directions; light buoy 42/19
166 Germany -- Alte Weser — Light sector 46/19
194 Germany -- German Bight -- Elbe — TSS 04/20
196 Germany -- Outer Elbe -- Approaches to Cuxhaven — Anchorages; foul ground 25/20
198 Germany -- Cuxhaven -- Medemrinne — Prohibited area 14/19
198 Germany -- The Elbe -- Brunsbüttel — Prohibited areas 17/19
198 Germany -- Elbe -- Cuxhaven to Brunsbüttel -- Neufeld--Reede — Prohibited area 21/19
200 Germany -- Cuxhaven -- Medemrinne — Prohibited area; buoyage 14/19
200 Germany -- Elbe -- Cuxhaven to Brunsbüttel -- Neufeld--Reede — Prohibited area 21/19
200 Germany -- The Elbe -- Brunsbüttel — Prohibited area 40/19
200 Germany -- The Elbe -- Brunsbüttel — Anchorage 32/19
202 Germany -- North Sea -- The Elbe — Traffic regulations 11/20
207 Germany -- The Elbe -- Brunsbüttel — Anchorage 40/19
243 Germany -- The Eider -- Eiderstedt — Directions; light 10/19
263 Denmark -- North Sea -- Approaches to Esbjerg — Traffic regulations 21/20
290 Denmark -- Kås Bredning to Løgstør Bredning -- Salling Sund Bridge — Horizontal 21/20
clearance
301 Denmark -- Skagerrak -- Thyborøn to Hanstholm — Prohibited area 41/19
301 Denmark -- Skagerrak -- Thyborøn to Hanstholm — Prohibited area 41/19
302 Denmark -- North coast -- Hanstholm — Directions; light 47/18
304 Denmark -- Skagerrak -- Hanstholm to Skagen — Directions; wreck 12/20
NP56 Norway 1 17th Edition (2018) 39/18
72 Norway -- South--west coast -- Egersund — Submarine pipeline 36/19
72 Norway -- South--west coast -- Egersund — Berths 07/19
74 Norway -- South--west coast -- Rekefjord and approaches — Directions; rocks 15/20
Wk26/20 4.53
IV
Weekly
77 Norway -- Approaches to Åna--Sira — Vertical clearance 45/18
112 Norway -- Mandal -- Mannefjorden -- Nordre Havneholmen — Directions; light 24/19
112 Norway -- Mandal -- Mannefjorden -- Havneholmen — Directions; light 10/20
112 Norway -- Mandal-- Nordfjorden -- Skjernøya -- North--east side — Directions; light 22/19
113 Norway -- Mandal -- Tregdefjorden -- Langøy — Directions; light 10/20
114 Norway -- South coast -- Tregdefjorden to Songvårfjorden -- Skogsøy — Directions; 41/19
light
114 Norway -- South coast -- Songvårfjorden — Directions; depth 51/19
114 Norway -- South coast -- Skagerrak -- Songvårfjorden — Varholmen light 08/20
115 Norway -- South coast -- Skagerrak -- Route through Ny--Hellesund — Varholmen 08/20
light
115 Norway -- South coast -- Songvårfjorden -- Helgøya — Directions; light 51/19
120 Norway -- Kristiansand -- Topdalsfjorden — Directions; lights 43/19
120 Norway -- South coast -- Flekkerøya — Directions; light 48/19
120 Norway -- Kristiansand -- Topdalsfjorden — Directions; lights 09/19
189 Norway -- Oslofjorden -- Horten — Depth 42/18
190--191 Norway -- Oslofjorden -- Horten — Directions; underwater rocks 42/18
199 Norway -- Oslofjorden -- Fagerstrand — Depths 13/19
225 Norway -- Oslofjorden -- Løperen — Directions; light sector; positions 50/18
225 Norway -- Oslofjorden -- Løperen — Directions; leading lights 52/18
225 Norway -- Oslofjorden -- Asmaløy — Directions; lights 09/19
233 Norway -- Oslofjorden -- Sarpsborg — Depths 19/19
235 Norway -- Oslofjorden -- Svalerødkilen — Anchorage 39/18
251 Sweden -- West coast -- Skagerrak -- Grebbestad — Directions; leading lights 02/20
265 Sweden -- Skagerrak -- Lysekil — Restricted area 05/20
277 Sweden -- Skagerrak -- Hakefjord -- Mitholmarna — Directions; light 12/19
NP57A Norway 2A 13th Edition (2019) 50/19
86 Stavanger -- Kvitsøy -- Leiasund — Anchorage; submarine cable 04/20
93 Norway -- Stavanger — Directions from north--west; Tjuvholmboen to Midtgrunnen 15/20
151 Rogaland -- Karmsundet middle part -- Kopervik to Salhus — Vertical clearances 15/20
181 Rogaland -- Bjoafjorden -- Fornesholmen — Directions; light sector 22/20
181 Rogaland -- Ølsfjorden -- Romsasundet -- Kampareholmen — Directions; light sector 22/20
185 Rogaland -- Bjoafjorden -- Fornesholmen — Directions; light sector 22/20
187 Hordaland -- Halsnøya -- Høylandssundet -- Hillestadholmen — Directions; light 22/20
sector
187--188 Hordaland -- Halsnøya -- Høylandssundet -- Hillestadholmen — Directions; light 22/20
sector
200 Hardangerfjorden -- Ytre Samlen -- North--north--west of Jondal -- Jonaneset — 25/20
Directions; light sector
269 North--west of Bergen -- Toftøyna -- Toftevågen — Anchorage 50/19
270 Sotra -- Raunefjorden -- Raunane — Directions; light sector 05/20
290 Blomøyna -- Dalsvågen — Anchorage 50/19
290 Hordaland -- Kollsnes -- Osundet — Directions; leading lights 50/19
291 Alvøyna -- Heggøyvågen and Dåvøysundet — Anchorages 50/19
294 Alvøyna -- Søre Selsvågen — Anchorage 50/19
300--301 Bergen -- Hjeltefjorden -- Ågotnes — Directions; wreck 04/20
304 Hjeltefjorden -- Småvikane — Anchorage 50/19
392 Indrevær and Utvær to Bulandet -- Lågøyfjorden -- Kråkesteinen — Directions; light 08/20
sector
4.54 Wk26/20
IV
Weekly
394 Straumsfjorden to Buefjorden -- Lågøyfjorden -- Kråkesteinen — Directions; light 08/20
sector
398 Sogn og Fjordane -- Ytre Sula -- Langøysundet — Vertical clearance 13/20
407 Sogn og Fjordane -- Aldefjorden -- Austnesholmen — Directions; light sector 10/20
410 Sogn og Fjordane -- Sula -- Krakhellesundet — Vertical clearances 13/20
416 Sogn og Fjordane -- Atløyna north--west side -- Hinnøysundet — Directions; light 08/20
sector
438 Sogn og Fjordane -- East of Florø -- Eikefjorden -- Helgøya — Light 50/19
450 Sogn og Fjordane -- East--north--east of Florø -- Breidvika -- Fjord Base — 50/19
Development; directions
NP57B Norway 2B 10th Edition (2017) 45/17
9 Navigation and Regulations -- Pilotage — Pilotage boarding places 02/18
81 Raudøyholmen -- Ørstafjorden — Directions; light 22/18
82 Møre og Romsdal -- Sulafjorden — Directions; ODAS buoy 10/20
95 Møre og Romsdal -- Holmefjorden — Sector light 50/18
97 Møre og Romsdal -- Holmefjorden — Directions; sector light 50/18
104 Storfjorden -- Velteneset — Overhead power cables 22/18
112 Møre og Romsdal -- Ålesund -- Steinvågsundet — Depths 13/20
112 Møre og Romsdal -- Ålesund -- Aspevågen — Prohibited area 22/20
113 Møre og Romsdal -- Ålesund -- Steinvågen — Directions; buoys 13/20
113 Møre og Romsdal -- Ålesund -- Steinvågsundet — Leading lights 22/20
114 Møre og Romsdal -- Ålesund -- Aspevågen — Anchorage 22/20
116 Åsefjorden -- Veddevika — Submarine pipeline 35/18
117 Møre og Romsdal -- Sula -- Mauseidvågen — Submarine cables 51/19
133 West coast -- Ellingsøya -- Taftasundet — Vertical clearance 41/18
147 West coast -- Romsdalsfjorden -- Tomrefjorden -- Bårsneset — Directions; light 26/19
sectors
152 Møre og Romsdal -- Romsdalfjorden -- Tresfjorden — Directions; light 08/20
152 South of Molde -- Tresfjorden — Directions; light 35/18
153 West coast -- Romsdalsfjorden -- Hovdeneset — Directions; light sectors 26/19
153 Møre og Romsdal -- Romsdalsfjorden — Directions; light 08/20
154 West coast -- Romsdalsfjorden -- Hovdeneset — Directions; light sector 26/19
154 West coast -- East--south--east of Molde -- Langfjorden -- Åfarnes — Directions; light 15/19
sectors
158 Nogvafjorden -- Flemsøya — Directions; light sector 31/18
164--165 West coast -- Gossa -- Røssøyvågen — Directions; lights 43/19
166 Approaches to Budadjupet -- Bjørnsund — Directions; light 13/19
169 Møre og Romsdal -- Julsundet -- Julbøen — Directions; light sectors 08/20
172 Møre og Romsdal -- Hustadvika -- Storesundet — Directions; light sector 10/20
181 Hustadvika -- Midtfjorden -- Vikan Light to Sjøskorpa via Stoplan — Directions; light 08/20
sector
183 Hustadvika -- Midtfjorden -- Channel north--west of Vikan Light — Directions; light 08/20
sector
183 North--west coast -- Hustadvika -- Kråksundet — Directions; light sector 20/19
183 Hustadvika -- Midtfjorden -- Vikan — Directions; light sector 08/20
187 West coast -- Hustadvika -- Kvitholmen — Directions; light sector 29/19
187 Hustadvika -- Halluren to Hestskjær -- Litlsandøya — Directions; light sector 08/20
189 Møre og Romsdal -- Ramnfjorden -- Sveggevika -- Galten Light — Directions; light 08/20
sector
191 Møre og Romsdal -- Ramnfjorden -- Sveggevika -- Galten Light — Directions; light 08/20
sector
193 North--west coast -- Ramngapet-- Stavneset — Directions; light 18/19
197--198 West coast -- Lauvøyfjorden -- Vevangstraumen — Directions; light 42/19
Wk26/20 4.55
IV
Weekly
199 West coast -- Kornstadfjorden -- Averøya -- Grønmyr — Directions; light sectors 15/19
204 West coast -- Freifjorden -- Freines — Directions; light 29/19
209 North--west coast -- Ytrefjorden -- Griphølen — Directions; light 34/19
211 West coast -- Kristiansund -- Talgsjøen -- Kvitneset — Directions; light sector 15/19
218 West coast -- Freifjorden -- Årsundøya — Directions; light sectors 26/19
219 Møre og Romsdal -- Årsundfjorden -- Stabblandet — Directions; light 10/20
220 North--west coast -- Halsafjorden -- Fåråneset — Directions; light 18/19
221 West coast -- Trongfjorden -- Bøfjorden — Directions; light 42/19
222 West coast -- Trongfjorden -- Torjulvågen — Directions; light 42/19
223 North--west coast -- Surnadalsfjorden -- Torvika — Directions; light sectors 20/19
223 North--west coast -- Trongfjorden -- Askneset — Directions; light sector 20/19
224 North--west coast -- Trongfjorden -- Askneset — Directions; light sector 20/19
225 Møre og Romsdal -- Arsundfjorden -- Stabblandet -- Directions; light 10/20
228 Møre og Romsdal -- Vinjefjorden — Directions; light 51/19
230 North--west coast -- Nordmørsfjordane -- Edøyfjorden — Directions; light 18/19
237 North of Kristiansund -- Grip — Directions; light sector 48/19
241 West coast -- Tustna -- Klakken — Directions; light sector 41/18
241 North--west coast -- Ytrefjorden -- Hammarsundet — Directions; light sector 20/19
250 North--west coast -- Trondheimsleia -- Gjerdavika -- Morøya — Directions; light 34/19
252 North--west coast -- Dromnessundet -- Rogntangan — Directions; light sector 20/19
252--253 North--west coast -- Dromnessundet — Directions; light sectors 20/19
253 West coast -- Trondheimsleia -- South--west part -- Edøya to Værøyane — Directions 36/19
254 West coast -- Trondheimsleia -- South--west part -- Lesundet — Directions 36/19
257 West coast -- Trondheimsleia -- Hamnvik — Directions; light sector 32/19
281 West coast -- Trondheimsfjorden -- Hindremsbukta — Submarine cable 46/19
283 Trondheimsfjorden -- Verdal — Directions; lights 22/20
288 Beitstadfjorden -- Beitstadsundet -- Hjellbotn — Vertical clearance 48/19
289 Trondheimsfjorden -- Beitstadsundet — Directions; light sectors 20/20
300 Sør--Trøndelag -- Fillfjorden -- Fillan — Directions; light sector 17/20
301 Sør--Trøndelag -- Kråkvagfjorden -- Fjellværsøya-- Auster Knarrlagsund — Directions; 17/20
light sector
331 Halten and Kaura to Vikna -- General information — Pilotage 02/18
360 Namsos -- Arrival information — Pilotage 02/18
380 Nord--Trøndelag -- Rørvik -- Marøystranda — Directions; rocks 25/20
NP58A Norway 3A 9th Edition (2020) 11/20
96 Sør--Helgeland -- Ursfjorden — Directions; light sector 22/20
118 Sør--Helgeland -- Velfjorden -- Langfjorden — Vertical clearance 13/20
169 Nord--Helgeland -- Dønna -- Åkervågen — Vertical clearance 11/20
351 Lofoten -- Værøy -- Nordlandsflaget -- Kvitholmen — Directions; light sectors 11/20
352 Lofoten -- Værøy -- Sørlandsvåg — Directions; light sector 11/20
357 Lofoten -- Moskenstraumen -- Lofotodden -- Buvågen — Directions; light sector 11/20
360 Lofoten -- Moskenesøya -- Å — Directions; light sectors 11/20
362 Lofoten -- Moskenesøya -- Olnilsøya — Directions; light sector 11/20
375 Lofoten -- Henningsværstraumen -- Lyngværet -- Brennholmen — Light 11/20
376 Lofoten -- Henningsværstraumen -- Lyngværet -- Brennholmen — Directions; light 11/20
380 Lofoten -- Gimsøystraumen -- Brennholmen — Directions; light 11/20
381 Lofoten -- Gimsøystraumen -- Brennholmen — Directions; light 11/20
397 Lofoten -- Svolvær -- Vårsetøya — Directions; light sector 25/20
399 Lofoten -- Svolvær -- Osanpollen -- Stretarneset — Directions; light sector 25/20
421 Lofoten -- Flakstadøya -- Hundholmen — Directions; light sector 11/20
4.56 Wk26/20
IV
Weekly
422 Lofoten -- Steinsfjorden -- Skolmneset — Directions; light sector 11/20
422 Lofoten -- Steinsfjorden -- Skolmneset — Directions; light sector 25/20
424 Lofoten -- Vestvågøya -- Borgvær — Directions; light 11/20
424 Lofoten -- Vestvågøya -- Borgvær -- Sandleia — Directions; leading lights 19/20
424 Lofoten -- Vestvågøya -- Borgvær — Directions; light 11/20
425 Lofoten -- Vestvågøya -- Borgvær — Directions; light sector 11/20
425--426 Lofoten -- Vestvågøya -- Borgvær — Directions; light sector; light 11/20
428 Lofoten -- Austvågøya -- North approaches to Gimsøystraumen — Directions; light 11/20
448 Vesterålen -- Vesterålsfjorden -- Snarset — Directions; leading light 22/20
NP58B Norway 3B 8th Edition (2018) 40/18
77 North--west coast -- Vågsfjorden -- Rollnesholmene — Directions; light 26/19
78--79 North--west coast -- Vågsfjorden -- Rollnesholmene — Directions; light 26/19
82 North--west coast -- Vågsfjorden -- Sandssundet — Vertical clearance 29/19
82 North--west coast -- Vågsfjorden -- Sandssundet — Directions; buoys 09/19
82--83 North--west coast -- Vågsfjorden -- Sandssundet — Directions; bridge 29/19
84 Vågsfjorden -- South of Senja -- Ytterpollen — Directions; light sector 46/19
87 Grovfjorden -- Grov — Directions; light sector 43/18
91 Vågsfjorden -- Sagfjorden — Directions; light sector 48/18
93 Dyrøysundet and Mjøsundet -- Kastnesskjær Light — Directions; clearing line 15/20
105 Sør--Troms -- Kvæfjord -- Bygdesundet — Submarine pipeline 02/20
110 Andfjorden -- West side of Senja -- Leikneset — Directions; light sector 08/20
110 Sør--Troms -- Andfjorden -- Sifjorden -- Bloskeneset — Directions; light sector 02/20
110 Andfjorden -- West side of Senja -- Leikneset — Directions; light sector 08/20
126 North coast of Norway -- Senja -- Teistneset — Directions; light sector 32/19
128 North coast of Norway -- Senja -- Okseneset — Directions; light sector 32/19
132 North--west coast -- Senja -- Øyfjorden -- Husøy — Directions; light sectors 15/19
132 North--west coast of Norway -- Øyfjorden -- Trælvika — Anchorage; marine farm 46/19
133 North coast of Senja -- Baltsfjorden — Directions; marine farm 41/19
139 North--west coast -- Malangen -- Stønnesbotnen — Light sector 34/19
142 North--west coast -- Tranøyfjorden -- Tranøybotn — Directions; light 26/19
143 Sør--Troms -- Dyrøysundet — Directions; light sectors 15/20
144 North--west coast -- Dyrøysundet — Directions; light 26/19
147 Sør Troms -- Finnfjorden -- Klauvskjærodden — Directions; light sector 10/20
150 Norway -- Gisundet -- Vardneset to Malangen — Directions; light sector 15/20
151 Norway -- Gisundet -- Lysbotnen — Directions; light sector 15/20
173 Sør--Troms -- Indre Malangen -- Kravikneset — Directions; light sectors 22/20
174 Nord--Troms -- Indre Malangen -- Nordfjorden -- Nordbyneset — Directions; light 15/20
sector
174 Sør--Troms -- Indre Malangen -- Kravikneset — Light 22/20
195 Nord--Troms -- Rebbenesøya -- Sandøyfjorden -- Sørstabben — Directions; light 02/20
sector
195 Nord--Troms -- Rebbenesøya -- Sandøyfjorden -- Sørstabben — Directions; light 02/20
sector
196--197 Nord--Troms -- West of Rebbenesøya -- Sandøyfjorden — Directions; light sector 13/20
198 Nord--Troms -- West of Rebbenesøya -- Sandøyfjorden -- Engvika — Directions; light 13/20
sector
261 Norway -- North coast -- Sandlandsfjorden — Directions; light 18/19
262 Norway -- North coast -- Bergsfjorden — Directions; light 18/19
263 Norway -- North coast -- Langfjorden — Directions; light 18/19
Wk26/20 4.57
IV
Weekly
300 Vargsund -- Korsfjorden -- Vannes to Korsfjordbotnen — Directions 49/19
311 North coast -- Entrance to inshore waters between Ingøya and Hjelmsøya — 11/19
Directions; light
326 Vest--Finnmark -- Ryggefjorden -- Hamna — Anchorage 51/19
361 Norway -- Tanafjorden -- Skardholmen — Directions; sector light 50/18
366 Norway -- Berlevåg -- Kjølnes — Directions; light 09/19
368 North coast -- Båtsfjorden — Directions; leading lights 43/19
369 Aust--Finnmark -- Austhavet -- Vardø — Directions; light 02/20
376 North coast -- Varangerfjordan -- Ytre Kiberg — Directions; light 29/19
NP59 Nova Scotia and Bay of 16th Edition (2020) 05/20
Fundy
181 United States of America -- Maine -- Bay of Fundy -- Moosabec Reach -- Eastern part 05/20
— Bridge
NP60 Pacific Islands 1 13th Edition (2018) 04/18
102 Solomon Islands -- New Georgia Island -- Munda Harbour — Directions; leading light 18/20
alignment
103 Solomon Islands -- New Georgia Island -- Munda Harbour — Directions; leading light 18/20
103 Solomon Islands -- New Georgia Island -- Munda Harbour — Route; leading light 18/20
alignment
104 Solomon Islands -- New Georgia Island -- Munda Harbour -- Penguin Reef to 18/20
Ndokendoke Island — Directions; leading light alignment
134 Papua New Guinea -- Bougainville Island -- Otua Island — Directions; light 04/18
158 Solomon Islands -- Bougainville Strait -- Choiseul Bay — Prohibited area 13/20
201 Papua New Guinea -- Louisiade Archipelago -- Jomard Entrance — PSSA 44/19
204 Papua New Guinea -- Louisiade Archipelago -- Panabwal Group — Directions; 28/19
depths
244 Papua New Guinea -- D’Entrecasteaux Islands -- Dawson Strait — Directions 46/19
245 Papua New Guinea -- D’Entrecasteaux Islands -- -- Esa’ala — Anchorage 46/19
255 Papua New Guinea -- North east coast -- Dyke Ackland Bay — Directions; shoal 22/19
258 Papua New Guinea -- North--east coast -- Holnicote Bay — Anchorage; submarine 21/19
cable
262 Papua New Guinea -- Huon Gulf — FADs 30/18
262 Papua New Guinea -- Huon Gulf -- North of Cape Roon — Directions; shoals 37/18
262 Papua New Guinea -- Huon Gulf — Directions; FADs; buoys 30/18
262 Papua New Guinea -- Huon Gulf -- North of Cape Roon — Directions; shoals 37/18
263 Papua New Guinea -- Huon Gulf — Directions; FAD; buoy 30/18
265 Papua New Guinea -- Huon Gulf -- Port Lae — Pilotage 44/19
282 Papua New Guinea -- New Britain -- Thilenius Harbour — Depth 52/18
296 Papua New Guinea -- North coast -- Madang Harbour — Anchorages; regulations 44/19
297 Papua New Guinea -- North coast -- Madang Harbour — Pilotage 44/19
326 Papua New Guinea – New Britain – Kimbe — Arrival information; pilotage 14/19
328--329 Papua New Guinea -- New Britain -- North--west coast -- Borgen Bay — Directions 45/19
331 Papua New Guinea -- Vitu Islands -- Mundua Islands — General information; depth 08/19
367 Papua New Guinea -- Bougainville Island -- Arawa Bay — Directions; light 04/18
368 Papua New Guinea -- Bougainville Island -- North--east coast — Directions; light 04/18
4.58 Wk26/20
IV
Weekly
369 Papua New Guinea -- Bougainville Island -- Cape Laverdy — Directions; light 04/18
370 Papua New Guinea -- Bougainville Island -- Cape Laverdy — Directions; light 04/18
374 Papua New Guinea -- New Ireland -- Nabuto Bay -- Namatanai Roads — Directions 45/19
384--385 Federated States of Micronesia -- Kosrae Island -- Lelu Harbour — Directions; wrecks 43/19
87 Nouvelle--Calédonie -- South coast -- Nouméa — Limiting conditions; depths 32/17
87 Nouvelle--Calédonie -- Nouméa — Outer anchorage 26/18
87 Nouvelle--Calédonie -- Nouméa — Prohibited anchorages 47/18
88 Nouvelle--Calédonie -- Nouméa -- Grande Rade — Leading line 11/17
88 Nouvelle--Calédonie -- Noumea — Directions; leading lights 45/19
88 Nouvelle--Calédonie -- Nouméa -- Petite Passe — Directions; leading marks 51/19
92 Nouvelle--Calédonie -- West coast — Marine reserve 01/18
95--96 Nouvelle--Calédonie -- Baie de Saint Vincent — Anchorages 43/17
98 Nouvelle--Calédonie -- West coast — Marine reserve 01/18
106 Nouvelle--Calédonie -- Port of Vavouto — Depth; UKC 12/20
106--107 Nouvelle--Calédonie -- Port of Vavouto — Berths 12/20
107 Nouvelle--Calédonie -- Port of Vavouto -- Baie Chasseloupe — Anchorages 12/20
118 Nouvelle--Calédonie -- Île Art -- Baie de Waala — Anchorage 27/18
119 Nouvelle--Calédonie -- Île Pott -- Anse Ammoian — Anchorage 27/18
125 Nouvelle--Calédonie -- East coast -- Port Ounia — Anchorage; wreck 12/18
125 Nouvelle--Calédonie -- Baie de Ouinné — Anchorage 20/17
129 Nouvelle--Calédonie -- East coast -- Passe de Thio — Directions; depth 22/20
130 Nouvelle--Calédonie -- Port de Thio — Directions; leading lights 20/17
132 Nouvelle--Calédonie -- Baie de Canala — Depths 35/19
133 Nouvelle--Calédonie -- Baie de Canala -- Presqu’île Bogota — Anchorages 35/19
133 Nouvelle Calédonie -- Baie de Canala -- île Adam and Pic des Morts — Anchorage; 35/19
wharves
133 Nouvelle--Caledonie -- Baie de Nakéty — Anchorages 06/20
135 Nouvelle--Calédonie -- Baie Laugier — Directions; leading lights 20/17
136 Nouvelle Calédonie -- East coast -- Baie de Kouaoua — Anchorages 14/20
137 Nouvelle Calédonie -- East coast -- Baie de Kouaoua — Anchorages 14/20
138 Nouvelle--Calédonie -- Baie de Poro — Leading beacons 48/17
164 Nouvelle--Calédonie -- Île Lifou -- North coast -- Cap Escarpé — Position 35/19
166 Nouvelle--Calédonie -- Île Lifou -- North coast -- Cap Escarpé — Position 35/19
168 Nouvelle--Calédonie – Îles Loyauté – Atoll d’Ouvéa — Passages; general information 35/19
168 Nouvelle--Calédonie – Îles Loyauté – Atoll d’Ouvéa – Passe du Styx — Directions 35/19
169 Nouvelle--Calédonie – Îles Loyauté – Atoll d’Ouvéa — Passe d’Anêmata 35/19
169 Nouvelle--Calédonie – Îles Loyauté – Atoll d’Ouvéa – Passe du Taureau — 35/19
Directions
169 Nouvelle--Calédonie – Îles Loyauté – Atoll d’Ouvéa – Passe de la Baleine — 35/19
Directions
169 Nouvelle--Calédonie – Îles Loyauté – Atoll d’Ouvéa – Hnyimwele — Pilotage 35/19
266 Fiji Islands -- Viti Levu -- Approaches to Suva — Anchorage; wreck 28/18
272 Fiji -- Lautoka — Directions; floating dock 39/19
281 Fiji Islands -- Viti Levu Bay — Directions; rocks 40/17
284 Fiji Islands -- Yasawa Islands -- Tamasua Passage — Directions; depth 51/19
295 Fiji Isands -- Levuka Wharf — Wreck 41/17
300 Fiji -- Viti Levu -- Rewa Roads — Submarine cable 16/18
346 Fiji -- Exploring Isles -- Qilaqila Passage — Leading Beacons 43/17
360 Fiji Islands -- Balmoral Reef — Shoal 42/18
365 Île Futuna -- Ava Leava — Anchorage 16/18
Wk26/20 4.59
IV
Weekly
368 Îles Wallis -- Mouilage de Mata Utu — Anchorage 16/18
368 Oceania -- Îles Wallis -- Mata Utu — Anchorage 47/18
377 Tonga Islands – North coast of Tongatapu — Directions 25/19
377 Tonga -- Approaches to Nuku’alofa Harbour — Limiting conditions 20/19
379 Tonga -- Approaches to Nuku’alofa Harbour -- Egeria Channel — Directions 20/19
379 Tonga -- Approaches to Nuku’alofa Harbour -- Egeria Channel — Directions 20/19
379--380 Tonga -- Approaches to Nuku’alofa Harbour -- Ava Lahi — Directions 20/19
380 Tonga -- Inner approaches to Nuku’alofa Harbour — Directions 20/19
380 Tonga -- Approaches to Nuku’alofa — Directions 24/20
386 Tonga -- Nomuka Group -- Ava Fonuaiki — Directions; clearing lines 26/20
388 Tonga -- Ha’apai Group -- Ha’afeva anchorage — Directions 26/20
394 Tonga -- Ha’apai Group -- Ava Vahaa Fonua — Directions; rock 02/19
400 Tonga -- Vava’u Group -- Neiafu — Anchorage; submarine cables 33/19
410 Samoa -- Savai’i Island -- Salelologa Harbour — Directions; depths 16/18
410 Samoa -- Upolu Island -- Mulifanua Harbour — Directions; depths 16/18
411 Samoa -- Upolu Island -- Cape Tapaga — Shoal depth 15/17
164 French Polynesia -- Îles de la Société -- Tahiti -- Bassin de Taunoa — Anchorage 02/20
165 French Polynesia -- Îles de la Société -- Tahiti -- Port de Papeete — Pilotage 24/20
208 French Polynesia -- Îles de la Socéité -- Îles--Sous--le--Vent -- Manuae — Marine 12/20
reserve
247 French Polynesia -- Îles Marquises -- Nuku--Hiva -- Baie de Taiohae — Anchorage 02/20
258 United States of America -- Hawaii Island -- Cape Kumukahi — Directions; light 19/20
NP63 Persian Gulf 18th Edition (2018) 27/18
2 Persian Gulf and Gulf of Oman — Piracy 20/19
5 United Arab Emirates -- Abu Dhabi — Regulations; Marine Protected Area 33/19
61 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — Name 11/19
62 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — 11/19
Directions; name
62 Oman -- Strait of Hormuz -- West Bukha Oilfield — Directions; racon 37/18
Directions; name
62 Oman -- Muscaò - JazØrat Muscaò — Directions; position 49/18
Directions; names
Directions; names
64 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Køchek — Name 11/19
86 Gulf of Oman -- Oman -- As Suwayq -- Said Bin Sultan Naval Base — Anchorages 49/19
89 Oman -- Shinºî — Anchorage 27/18
91 United Arab Emirates -- Gulf of Oman -- Port of Fujairah — Prohibited anchorage 29/19
92 United Arab Emirates -- Gulf of Oman -- Port of Fujairah — Directions; light 29/19
96 United Arab Emirates -- Gulf of Oman -- Ra’s Dibº — Prohibited anchorage 21/19
4.60 Wk26/20
IV
Weekly
106 Iran -- South--east coast -- Chºbahar — Directions 51/19
107 Iran -- South--east coast -- Chºbahar — Anchorages 51/19
107 Iran -- South--east coast -- Chºbahar — Directions 51/19
134 Iran -- Bandar--e Pºrs — Anchorages 27/18
138 Iran -- Bøshehr — Dredged depths 29/19
138 Iran -- North--west coast -- Bøshehr — Directions; leading lights 38/19
147 United Arab Emirates -- Saqr Port — Directions; pilotage; terminal 44/18
148 United Arab Emirates -- Ra’s al Khaymah -- RAK Maritime City -- RAK Khor Port — 27/18
Directions; control tower; buoy; anchorages
149 United Arab Emirates -- Al Jazeera Port — Anchorages; pipeline; buoy 27/18
150 United Arab Emirates -- Umm al Quwain — Anchorage 47/18
153 Western approaches to the Strait of Hormuz -- Abø Møsá — Name 11/19
157 United Arab Emirates -- Dubai — Anchorage 49/18
160 United Arab Emirates -- Fateh Oil Terminals — Anchorage; pilotage 20/20
162 United Arab Emirates -- Jebel Ali to Khalifa Port — Hassyan Clean Coal Power Plant 11/19
163 United Arab Emirates -- Abu Dhabi -- Khalifa Port — Restricted area 33/19
165 United Arab Emirates -- Abu Dhabi — Arrival information; pilotage 27/18
165 United Arab Emirates -- Abu Dhabi — Restricted area 33/19
167 United Arab Emirates -- Abu Dhabi — Restricted area 33/19
168 United Arab Emirates -- Abu Dhabi -- MuîaffaÖ Port — Restricted area 33/19
169 United Arab Emirates -- Abu Dhabi to Jabal Aþ ¹annah -- Dºs deep--water approach 51/19
— Directions; wreck
171 United Arab Emirates -- Abu Dhabi -- JazØreh--ye SirrØ to Jabal Aþ ¹annah — 33/19
Restricted area
171 United Arab Emirates -- Approaches to Mubarraz terminal -- TSS Between Zaqqum 02/20
and Umm Shaif — Directions
172 United Arab Emirates -- Zirku Oil Loading Terminal — Vessel traffic information 05/19
service
174 United Arab Emirates -- -ºlat al Mubarraz Oil Loading Terminal — Vessel traffic 05/19
information service
175 United Arab Emirates -- Approaches to Ar Ru’ays (Ruwais) and Jabal Aþ ¹annah — 48/18
Depths
176 United Arab Emirates -- Jabal Aþ ¹annah — Vessel traffic information service 05/19
176 United Arab Emirates -- Ar Ruways -- Ghasha Oilfield — Development; reclamation 25/19
works
177 United Arab Emirates -- Arzanah Oilfield — Directions; platforms 02/19
Directions
178 United Arab Arab Emirates -- Ar Ruways -- Ghasha Oilfield — Directions; reclamation 25/19
works
Directions
182 United Arab Emirates -- Jabal Aþ ¹annah to Ra’s Rakan — Restricted area 33/19
187 Qatar -- Doha — Arrival information; pilotage 27/18
188 Qatar -- Hamad Port — Limiting conditions; UKC 27/18
189 Qatar -- Hamad Port — Arrival information; pilotage 27/18
190 Qatar -- Mesaieed — General information; approach and entry 27/18
190 Qatar -- Mesaieed — Controlling depths 02/20
191 Qatar -- Mesaieed — Directions; approach and entry 27/18
194 Qatar -- Outer approaches to Ra’s Laffºn — Directions; wreck 27/18
195 Qatar -- Al Shaheen Oil Terminal — Restricted areas 20/20
195 Qatar -- Al Ruwais Port — Port information 27/18
Wk26/20 4.61
IV
Weekly
196 Qatar -- Ra’s Laffºn — Limiting conditions; local weather 27/18
196 Qatar -- Ra’s Laffºn — Outer anchorages 51/18
200 Bahrain -- Outer approaches — Prohibited area 29/19
200 Bahrain -- Outer approaches — Prohibited area 41/19
201 Bahrain -- Bahrain approaches — Directions; wreck 27/18
202 Bahrain -- Port of Bahrain — Anchorages 27/18
202 Bahrain -- Port of Bahrain — Pilotage; obstruction 13/19
202 Bahrain -- Approaches to Port of Bahrain — Pilotage 14/19
202 Bahrain -- Port of Bahrain — Restricted areas; submarine cable 13/19
204 Bahrain -- Port of Bahrain — Inner anchorages; berths 27/18
204 Mina’ Salman -- Khawr al Qulay’ah — Anchorage; wreck and buoy 11/19
204 Bahrain -- Port of Bahrain — Berths 27/18
210 Saudi Arabia -- Ra’s al Ju‘aymah — Directions; buoys; shoals 14/19
211 Saudi Arabia -- Ad Dammºm — Anchorages 02/19
223 Kuwait -- MØnº’ Al--Zour — General information; port 15/20
225 Kuwait -- MØnº’ Al--Zour — Directions 15/20
225 Kuwait -- MØnº’ Al--Zour — Port 15/20
226 Kuwait -- MØnº’ az Zawr — Development 15/20
227 Kuwait -- MØnº’ ‘abd Allºh — Restricted area 47/19
229 Kuwait -- MØnº’ ash Shu‘aybah — Restricted area 47/19
230 Kuwait -- MØnº’ al AÖmadØ — Light buoys 47/19
232 Kuwait -- MØnº’ ash’ Shuwaykh -- Al Hishan — Vertical clearance 21/19
232 Kuwait -- Khalij al Kuwait — Vertical clearance; horizontal clearance 09/20
232 Kuwait -- Khalij al Kuwait -- Mina ad DawÖah — Vertical clearance 19/20
232 Kuwait -- Khalij al Kuwait — Anchorage; wreck 09/20
232 Kuwait -- Al Kuwayt Harbour — Wreck 32/18
233 Kuwait -- KhalØj al Kuwayt — Development 27/18
233 Kuwait -- KhalØj al Kuwayt — Development 09/20
234 Kuwait -- MØnº’ ash Shuwaykh — Directions 27/18
235 Kuwait -- Khalij al Kuwait -- MØnº’ ad DawÖah — Approach and entry; vertical and 09/20
horizontal clearances
235 Kuwait -- KhalØj al Kuwayt -- MØnº’ ad DawÖah — Prohibited area 02/20
235 Kuwait -- KhalØj al Kuwayt -- MØnº’ ad DawÖah — Directions 09/20
243 Iraq -- Approaches to Khawr ‘Abd Allºh — Security zones 10/19
247 Iraq -- Khawr ‘Abd Allºh — Pilotage 19/19
247 Iraq -- Approaches to Al Baîrah Oil Terminal — STS anchorage 29/19
247 Iraq -- Approaches to Khawr ‘Abd Allºh — Directions; security zones 10/19
NP64 Red Sea and Gulf of 19th Edition (2018) 30/18
Aden
2 Red Sea, Gulf of Aden and Arabian Sea — Piracy 20/19
62 Egypt -- Suez Canal -- Waiting Area — Obstruction 22/20
98 Egypt -- Gulf of Suez -- Râs Ghârib — Prohibited area 11/20
124--125 Egypt -- Red Sea -- Barnøs — Directions; buoyage; recommended route 02/19
127 Red Sea -- Egypt -- Approaches to Safaga — Directions 52/19
127 Egypt -- Red Sea -- Safaga — Directions; lights 37/18
139 Sudan -- Port Sudan — Cautionary area 30/18
4.62 Wk26/20
IV
Weekly
140 Sudan -- Port Sudan — Directions; wreck 30/18
236 Saudi Arabia -- Jeddah — Arrival information; anchorage 28/19
250 Saudi Arabia -- Abu Abu Kulør to Oreste Point — Offshore passage; directions; buoy 36/19
251 Saudi Arabia -- Abu Abu Kulør to Oreste Point — Offshore passage; directions; buoy 36/19
252 Saudi Arabia -- Farasºn Bank -- Southern part -- Inner Channel -- middle part — 36/19
Directions; caution
255 Saudi Arabia -- Red Sea -- Jazº‘ir Farasºn group — Farasºn — Port information 17/19
259 Saudi Arabia -- JØzºn and approaches — Approach; buoy 36/19
259 Saudi Arabia -- JØzºn and approaches — Directions; buoy 36/19
260--261 Saudi Arabia -- JØzºn and approaches — Directions; track 36/19
310 Oman -- Port Salalah — Anchorages; pilotage 30/18
310 Oman -- Port Salalah — Pilotage 22/19
317 Oman -- Gulf of Masirah -- Ad Duqm Port — Pilotage 22/19
332 Djibouti -- Djibouti Port — Anchorages 30/18
334 Djibouti – Djibouti Port — Directions; wreck 04/20
341 Somalia -- Gulf of Aden -- Berbera — Directions 23/20
NP65 St Lawrence 19th Edition (2020) 06/20
77 Québec -- Chenal du Vieux Fort — Directions; lights; light sector 06/20
90 Québec -- Détroit de Jacques--Cartier -- Île à la Chasse — Directions; shoal 06/20
127 Gulf of St Lawrence -- Îles de la Madeleine -- Havre de la Grande Entrée — 19/20
Directions; light buoys; leading lights
287 Québec -- Péninsule de la Gaspésie -- Birch Point to Cap Gaspé — Marine nature 06/20
reserve
NP66A South--West Coast of 2nd Edition (2019) 03/19
Scotland
59 Firth of Clyde -- Ayr — Traffic signals 15/20
62--63 Firth of Clyde -- Irvine Bay -- Irvine — Directions 45/19
63 Firth of Clyde -- Irvine Bay -- Irvine — Berths 45/19
64 Scotland -- West coast -- Ardrossan — Traffic lights 03/19
93 Scotland -- Firth of Clyde -- Hunterston Channel — Directions; pontoon; buoys 06/20
101 Scotland -- Firth of Clyde -- Loch Long — Traffic signals 45/19
101 Firth of Clyde -- Loch Long — Prohibited area 40/19
105 Scotland -- Firth of Clyde -- Loch Long -- Coulport Jetty — Traffic signals 45/19
107 Scotland -- Firth of Clyde -- Gareloch -- Faslane — Traffic signals 45/19
110 Scotland -- Firth of Clyde -- Gareloch -- Faslane — Traffic signals 45/19
113 Scotland -- River Clyde -- Glasgow — Vertical clearances; bridge 06/20
136 West coast -- Jura -- Loch Tarbert — Directions; rock 32/19
141 West coast -- Sound of Jura -- Loch Sween -- Caol Scotnish — Rocks 32/19
172 Firth of Lorn -- Kerrera Sound — Directions; buoyage 18/19
173 Firth of Lorn -- Oban — Directions; small vessel route 28/19
174 Oban Harbour — Anchorages 11/19
NP66B North--West Coast of 2nd Edition (2019) 02/19
Scotland
133 South Harris -- Leverburgh — Directions; light 07/19
141 Scotland -- Outer Hebrides -- Benbecula -- Loch Uiskevagh — Rock; caution 22/19
141 Scotland -- Outer Hebrides -- Benbecula -- Loch Uiskevagh — Rock; caution 43/19
147 Isle of Skye -- Kyle Akin — Alt--an--Avaig jetty 24/20
150 Inner Sound -- Loch Kishorn — Berths 07/19
194 Scotland -- Outer Hebrides -- Isle of Lewis -- Stornoway — Pilotage 16/19
195 Scotland -- Outer Hebrides -- Isle of Lewis -- Stornoway — Directions; light sector 16/19
198 Isle of Lewis -- Breivig — Directional light 07/19
Wk26/20 4.63
IV
Weekly
NP67 West Coasts of Spain 13th Edition (2018) 09/18
and Portugal
66 Spain -- Ferrol -- Islas Gabeiras — Directions; shoal 31/18
112 Spain -- West coast -- Vigo — Restricted area 06/19
113 Spain -- West coast -- Puerto de Vigo — Prohibited area; general layout 49/18
113 Spain -- West coast -- Vigo — Prohibited area 06/19
113 Spain -- West coast -- Puerto de Vigo — Prohibited area; general layout 49/18
115 Spain -- West coast -- Vigo — Directions; light buoy 06/19
124 Portugal -- Viana do Castelo — Directions 32/19
124 Portugal -- Rio Minho to Rio Lima -- Viana do Castelo — Directions; scientific platform 41/19
124 Portugal -- Viana do Castelo — Directions; wind farm 22/20
125 Portugal -- Viana do Castelo — Prohibited anchorage 11/20
133 Portugal -- Porto do Douro — Vertical clearances 22/19
187 Spain -- Río Guadalquivir — Port operations 05/20
188 Spain -- Golfo de Cadiz -- Río Guadalquivir — Entrance channel; wrecks 02/20
189 Spain -- Río Guadalquivir -- Pozo — Outer anchorage 05/20
220 Spain -- Strait of Gibraltar -- Puerto de Algeciras--la Línea — Anchorages 38/19
242 Portugal – Arquipélago dos Açores – Ilha de Santa Maria — Directions; light 03/20
250 Portugal -- Arquipélago dos Açores -- Ilha de São Jorge — Directions; major light 03/19
250 Arquipélago dos Açores -- Canal de São Jorge — Traffic regulations 36/18
251 Portugal -- Arquipélago dos Açores -- Ilha de São Jorge — Directions; major light 03/19
251 Arquipélago dos Açores -- Canal de São Jorge -- Porto das Velas — Anchorage 36/18
NP68 East Coast of the 16th Edition (2018) 16/18
United States 1
60 Maine -- Frenchman Bay -- Bar Harbor — Wreck 12/19
108 New Hampshire -- Portsmouth — Vertical and horizontal clearances 33/19
108 New Hampshire -- Portsmouth — Vertical and horizontal clearances 43/18
118 Massachusetts -- Approaches to Salem Harbour — Depths 29/18
142 Massachusetts -- East approaches to Nantucket Sound — Depth 50/19
143 Massachusetts -- Nantucket Sound — Depths 50/19
143 Massachusetts -- Nantucket Sound -- Martha’s Vineyard — Wreck 40/18
155 Massachusetts -- Buzzard Bay -- Cleveland Ledge Channel — Anchorages; 26/20
obstructions
166 Rhode Island -- Providence — Caution; pipelines; wreck 31/19
168 Massachusetts -- Mount Hope Bay -- Brayton Point — Directions; leading lights 05/20
171 Block Island Sound -- Montauk Point — Directions 27/19
172 Block Island Sound -- Montauk Point and Little Gull Island — Directions; light 27/19
173 Block Island Sound -- Little Gull Island — Directions; light 27/19
179 Long Island Sound -- Stratford Point and Penfield Reef — Directions; lights 27/19
180 Long Island Sound -- Stratford Point and Penfield Reef — Directions; light 27/19
182 Connecticut -- New London Harbor -- New London Ledge — Directions; light 27/19
183 Connecticut -- New London Harbor — Directions; light 27/19
183 Connecticut -- Long Island Sound -- New London — Berths; depth 09/20
184 Connecticut -- Long Island Sound -- New Haven Harbor — Bridge clearance 21/18
184 Connecticut -- Long Island Sound -- Approaches to New Haven — Anchorage 33/19
184 Connecticut -- Long Island Sound -- Approaches to New Haven — Pilotage 33/19
184 Connecticut -- Long Island Sound -- Approaches to New Haven — Directions; buoy 33/19
184 Connecticut -- Long Island Sound -- New Haven — Directions; buoy 35/19
186 Long Island Sound -- Stratford Point and Penfield Reef — Directions; light 27/19
188 Long Island Sound -- Housatonic River -- Stratford Point — Directions 27/19
195 New York -- Long Island -- Northport — Anchorage; wrecks 26/20
4.64 Wk26/20
IV
Weekly
200 New York — New York Harbor approach -- South of Long Island — Directions; 14/20
wrecks
201 Block Island Sound -- Long Island -- Montauk Point — Directions; light 27/19
208 New York -- Ambrose Channel -- Gravesend Bay — Anchorage; wrecks 10/19
210 New York -- Upper Bay -- Anchorage Channel — Anchorages; obstructions 10/19
212 New York -- Staten Island -- Arthur Kill — Vertical clearances 37/19
215 East coast -- New Jersey -- Port Elizabeth — Berths 27/18
NP69 East Coast of the 14th Edition (2017) 38/17
United States 2
73 Delaware -- Chesapeake and Delaware Canal -- Delaware River — Anchorage 51/19
78 Delaware River -- Marcus Hook — Anchorage; obstruction 15/18
82 New Jersey -- Delaware River -- Gloucester City — Obstruction 09/18
88 New Jersey -- Delaware River -- Whitehill Range — Leading lights 45/17
91 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
100 Virginia -- Chesapeake Bay -- Hampton Roads Approach -- Thimble Shoal — 26/19
Directions; light
108 Virginia -- Chesapeake Bay -- Newport News — Depth 52/19
109 Virginia -- Newport News -- James River — Depths 29/19
114 Virginia -- Chesapeake Bay -- Hampton Roads Approach -- Thimble Shoal — 26/19
Directions; light
142 Chesapeake Bay -- Choptank River -- Cambridge — Directions; leading lights 51/18
169--170 North Carolina -- East of Pamlico Sound -- Wimble Shoals — Directions; wreck 30/18
176 North Carolina -- Approaches to Morehead City — Directions; light buoy 16/20
179 North Carolina -- Morehead City and Beaufort Inlet — Directions; lights; alignment 52/19
179 North Carolina -- Morehead City — Directions; light 28/19
182 South Carolina -- Long Bay — Directions; wrecks 26/18
183 North Carolina -- Cape Fear River — Vertical clearance 08/20
184 North Carolina -- Willmington -- Smith Island — Directions; leading lights 40/18
206 Charleston-- Wando River — General information; vertical and horizontal clearances 28/19
208 South Carolina -- Port Royal Sound — Limiting conditions; depths 43/18
210 Georgia -- Savannah — Controlling depths 41/19
211 Georgia -- Savannah — Development; entrance channel 41/19
212 Georgia -- Savannah — Directions; lights 41/19
224 Florida -- Saint Marys Entrance -- Amelia River — Depths 30/19
225 St Marys Entrance — Pilot boarding position 39/17
225 Georgia -- Saint Marys Entrance — Restricted area 45/17
229 Florida -- Jacksonville — Channel; depths 40/19
230 Florida -- Jacksonville -- Saint Johns River — Vertical and horizontal clearances 16/19
Wk26/20 4.65
IV
Weekly
NP69A East Coasts of Central 8th Edition (2019) 14/19
America and Gulf of
Mexico
96 Guatemala -- Bahía de Amatique -- Puerto Barrios — Obstruction 22/20
100 Belize -- Gulf of Honduras — Marine reserves 23/20
102 Belize -- Approaches to Belize Harbour -- Lighthouse Reef — Marine Reserves and 18/20
Marine Protected Areas
103 Belize -- Gulf of Honduras -- Port Honduras — Marine reserves 23/20
104 Belize -- Punta Gorda to Belize Harbour -- Big Creek — Directions 26/19
103--104 Belize -- Placencia Lagoon -- Big Creek — Directions 46/19
103--104 Belize -- Gulf of Honduras -- Big Creek — Directions; pilotage 26/20
105 Belize -- Approaches to Belize Harbour — Marine Reserves and Marine Protected 18/20
Areas
106 Belize -- Approaches to Belize Harbour -- Turneffe Islands — Marine Reserves and 18/20
107 Belize -- Approaches to Belize Harbour -- Swallow Caye — Marine Reserves and 18/20
107 Belize -- Approaches to Belize Harbour — Anchorages; wrecks; FPSO 18/20
113 Mexico -- Yucatán Peninsula -- Bahía Mujeres — Marine nature reserves 06/20
125 Mexico -- East coast -- Dos Bocas — Directions; beacons; lights 28/19
131 Mexico – Bay of Campeche – Veracruz — Limiting conditions; controlling depths 34/19
131 Mexico – Bay of Campeche – Veracruz — Arrival information; pilotage; tugs; traffic 34/19
regulations; quarantine
131 Mexico -- Bay of Campeche -- Veracruz — light buoy 06/20
131 Mexico – Bay of Campeche – Veracruz — Arrival information; pilotage; tugs; traffic 34/19
regulations; quarantine
132 Mexico – Bay of Campeche – Veracruz — Harbour; general layout; development 34/19
132 Mexico – Bay of Campeche – Veracruz — Directions; approaches; entrances 34/19
132 Mexico -- Bay of Campeche -- Veracruz — Directions; lights; light buoy 06/20
132 Mexico – Bay of Campeche – Veracruz — Directions; approaches; entrances 34/19
133 Mexico – Bay of Campeche – Veracruz — Directions; entrances 34/19
133 Mexico -- Veracruz — Directions; leading lights 22/19
133 Mexico -- Bay of Campeche -- Veracruz — Directions; light 06/20
133 Mexico – Bay of Campeche – Veracruz — Directions; entrances 34/19
133 Mexico -- Bay of Campeche -- Veracruz — Directions; light buoy 06/20
133 Mexico – Bay of Campeche – Veracruz — Basins and berths 34/19
134 Mexico – Bay of Campeche – Veracruz — Basins and berths 34/19
136--137 Mexico -- Tuxpan — Directions; leading lights 14/20
136--137 Mexico -- Tuxpan — Directions; leading lights 24/20
138 Mexico -- East coast -- Tampico — Directions; fairway buoy 16/19
140 Mexico -- Río Pánuco -- Tampico — Vertical clearance 07/20
161 United States of America -- Gulf of Mexico -- Freeport — Outer anchorages 52/19
170 United States of America -- Galveston Bay -- Bayport — Depths 22/19
172 United States of America -- Texas -- Houston — Bridge position 37/19
174 United States of America -- Gulf of Mexico -- Houston -- Barbours Cut — Berths 32/19
177 United States of America -- Gulf of Mexico -- Galveston to Sabine Pass -- Sabine 52/19
Bank — Anchorages
180 United States of America -- Texas -- Port Arthur — Directions 46/19
184 United States of America -- Gulf of Mexico -- Gulf Gateway LNG Offshore Terminal — 07/20
Directions; light
184 United States of America -- Louisiana -- Port of Lake Charles — Vertical clearance 34/19
185 United States of America -- Gulf of Mexico -- Port of Lake Charles — Outer 07/20
anchorage; wreck; obstruction
4.66 Wk26/20
IV
Weekly
199 United States of America -- New Orleans -- Mississippi River — Anchorage 28/19
199 United States of America -- New Orleans -- Mississippi River -- Poland Avenue Wharf 28/19
— Wreck
207 United States of America -- Baton Rouge — Depths; obstruction 14/19
213 United States of America -- Gulf of Mexico -- Tampa Bay — Project depths 05/20
218 United States of America -- Tampa Bay -- Saint Petersburg — Controlling depths 05/20
226 United States of America -- Florida -- Tampa Bay -- Big Bend — Controlling depths 40/19
226 United States of America -- Florida -- Tampa Bay -- Big Bend — Directions; leading 16/20
lights
230 United States of America -- Florida -- Lighthouse Point to Cape San Blas — 31/19
Directions; wrecks
235 United States of America -- Florida -- Port Saint Joe — Directions; depths 22/19
236 United States of America -- Florida -- Panama City — Depth 52/19
236 United States of America -- Florida -- Panama City -- Saint Andrew Bay — Directions; 52/19
caution
237 United States of America -- Florida -- Approach to Panama City — Directions; 52/19
channel
237 United States of America -- Florida -- Approach to Panama City — Directions; buoys; 52/19
237 United States of America -- Florida -- Panama City — Directions 10/20
240 United States of America -- Gulf of Mexico -- Pensacola -- Bay Channel — Wreck 07/20
240 United States of America -- Gulf of Mexico -- Approaches to Pensacola — Leading 07/20
line
NP70 West Indies 1 7th Edition (2018) 46/18
6 Dominican Republic — Marine reserve 09/19
112 Bahamas -- Freeport — Pilotage 14/20
116 Bahamas -- Great Bahama Bank -- Ocean Cay — Port development 44/19
116 Bahamas -- Great Bahama Bank -- Ocean Cay — Depth; wreck 09/20
119 United States of America -- Straits of Florida -- Through route — Data collecting buoy 09/19
119 United States of America -- Straits of Florida — Data collection buoy 38/19
123 United States of America -- East coast -- Florida -- Port Canaveral — Depths 49/18
124 United States of America -- East coast -- Florida -- Port Canaveral — Traffic 49/18
regulations
125 United States of America -- East coast -- Florida -- Port Canaveral — General layout; 49/18
directions; basins
125 United States of America -- East coast -- Florida -- Port Canaveral — Basins and 06/19
berths
125--126 United States of America -- East coast -- Florida -- Port Canaveral — Basins and 06/19
berths
132 United States of America -- East coast -- Florida -- Miami — Limiting conditions 33/19
134--135 United States of America -- East coast -- Florida -- Miami — Directions 33/19
139 United States of America -- Florida -- Key West — Pilotage 38/19
143 United States of America -- Florida -- Dry Tortugas — Directions; buoyage 20/19
163 Cuba -- North coast -- Bahía de Levisa — Limiting conditions; controlling depth 27/19
172 Cuba -- North coast -- Puerto de Cárdenas — Controlling depths 03/20
172--173 Cuba -- North coast -- Puerto de Cárdenas — Anchorages 03/20
179 Cuba -- North coast -- La Habana — Basins and berths; alongside depths 27/19
Wk26/20 4.67
IV
Weekly
188 Dominican Republic -- South coast -- San Pedro de Macorís — Berths; terminal 22/19
188 Dominican Republic -- South coast -- San Pedro de Macorís — Berths; terminal 22/19
214--215 Cuba -- South coast -- Bahía Santiago de Cuba — Anchorage; depths 27/19
224 Cuba -- South coast -- Casilda — Berths 25/19
251 Jamaica -- South--east coast -- Port Royal — Alongside berths; cruise terminal 15/20
255 Jamaica -- Portland Bight -- Approaches to Port Esquivel — Directions 12/19
256 Jamaica -- South coast -- Portland Bight — Old Harbour LNG Terminal 49/18
256 Jamaica -- Portland Bight; Approaches to Port Esquivel — Terminal name 12/19
257 Jamaica -- South coast -- Portland Bight — Anchorage 49/18
261 Cayman Islands — Restricted marine areas and marine parks 03/19
NP71 West Indies 2 18th Edition (2017) 18/17
62 Anguilla -- Sombrero Island — Directions; light 16/18
68 Dominican Republic -- South coast -- Punta Palmillas to Bayahibe — Anchorage; 09/19
marine reserve
80 British Virgin Islands -- Virgin Gorda -- North Sound — Directions; buoyage 16/19
90 Virgin Islands -- The Narrows — Directions; depths 40/17
96 Virgin Islands -- Tortola -- Road Harbour — Alongside berths 18/17
101 Virgin Islands -- Saint John -- Windward Passage -- Blunder Rocks — Wreck 17/20
111 Virgin Islands -- Saint Croix -- Hams Bluff — Directions; light 44/17
115 Virgin Islands -- Saint Croix -- Hams Bluff — Light 44/17
119 Virgin Islands -- Saint Croix -- Port Alucroix -- Krause Lagoon Channel — Directions; 22/20
wreck
139 Puerto Rico -- West coast -- Bahía de Mayagüez — Directions; obstruction 09/19
169 Puerto Rico – Bahía de Ponce — Basins and berths; anchorage 27/19
179 Saint Barthélémy -- Baie de Saint--Jean — Restricted area 11/19
181 Anguilla -- Seal Island — Directions; depth 16/18
182 Anguilla -- Crocus Bay — Wreck; depth 16/18
184 Sint Maarten -- Cole Bay — Anchorage 44/19
184 Sint Maarten -- Simson Baai — Anchorage 44/19
195 Leeward Islands -- Saint Christopher — Marine Management Areas 15/20
195 Leeward Islands -- Nevis — Marine Management Areas 15/20
200 Saint Kitts -- Basseterre — Anchorages 10/20
200 Saint Kitts -- Basseterre — Obstructions 04/20
200 Saint Kitts -- Basseterre — Anchorages 10/20
202 Nevis -- Charlestown — Anchorages 10/20
206 Saint Kitts and Nevis -- The Narrows — Directions 03/20
206 Nevis -- The Narrows — Anchorages 10/20
212 Antigua -- Saint Johns — Directions; oil terminal 40/19
213--214 Antigua -- Saint Johns — Oil terminal; buoyage 40/19
231 Guadeloupe -- Basse--Terre — Marine reserve; prohibited anchorage 44/18
235 Guadeloupe -- Terre--de--Haut — Directions; anchorages; obstruction 05/20
236 Guadeloupe -- Grand Terre -- Le Moule — Outer anchorage; depths; bearings 11/18
236--237 Guadeloupe -- Grand Terre -- Le Moule — Directions; position; bearings 11/18
242 Guadeloupe -- Pointe de Folle Anse — Berths 40/18
4.68 Wk26/20
IV
Weekly
242 Guadeloupe -- Marie--Galante -- Baie de Saint--Louis — Submarine cables 16/20
244 Guadeloupe -- Pointe--à--Pitre — Passe Ouest — Directions 14/20
244 Guadeloupe -- Pointe--à--Pitre — Alongside berths 52/17
253 Martinique — Regulations 01/19
255 Martinique -- Rade de Saint--Pierre — Prohibited area; anchorages 01/19
256 Martinique -- Baie de Fort--de--France — Outer anchorages 01/19
256 Martinique -- Baie de Fort--de--France — Pilotage 34/18
258 Martinique -- Pointe du Bout — Anchorages 01/19
259 Martinique -- Mouillage des Trois Îlets — Anchorage 01/19
259 Martinique -- Baie de Fort--de--France -- Mouillage des Trios Îlets — Anchorage 36/19
261 Martinique -- Sainte--Luce — Restricted area 30/17
262 Martinique -- Culde--de--Sac du Marin — Directions for entering harbour; channels 23/17
262 Martinique -- Cul--de--Sac du Marin and Anse d’Arlets — Anchorages 01/19
262 Martinique -- Sainte--Luce — Anchorage 30/17
262 Martinique -- Cul--de--Sac du Marin and Anse d’Arlets — Anchorages 01/19
265 Martinique -- Havre de la Trinité — Anchorages 01/19
266 Martinique -- Havre du Robert — Anchorages 01/19
267 Martinique -- Îlet Long — Anchorages 01/19
268 Martinique -- Baie du Vauclin — Directions; anchorages 01/19
276 Saint Lucia -- Laborie Bay — Directions; rock 44/18
277 Saint Lucia -- Laborie Bay — Rock 44/18
293 St Vincent and the Grenadines -- Canouan — Depths 43/19
299 The Grenadines -- Carriacou and Grenada -- Northern channel — Directions; rock 18/17
299 The Grenadines -- Ronde Island — Directions; rock; depths 45/18
300 The Grenadines -- Carriacou -- Southwest Point — Directions; rock 45/18
301 St Vincent and the Grenadines -- Canouan -- Charlestown Bay — Submarine cable 43/19
302 The Grenadines -- Carriacou -- Hillsborough Bay — Directions; depth 19/18
307 Grenada -- South coast -- Woburn Bay — Prohibited area 18/18
307 Grenada -- South coast -- Prickly Bay — Depths 18/18
308 Grenada -- West coast -- Beauséjour Bay — Marine Protected Area 14/18
309 Grenada -- Saint George’s Harbour — Depth 18/18
309 Grenada -- Saint George’s Harbour — Anchorages 13/18
310 Grenada -- Saint George’s Harbour — Pilotage; landmark; light 13/18
310 Grenada -- West coast -- Grande Anse Bay — Prohibited area 18/18
310 Grenada -- Saint George’s Harbour — Pilotage; landmark; light 13/18
327--328 Barbados -- Bridgetown — Obstruction; depth 44/17
368 Appendix IX 01/19
NP72 Southern Barents Sea 4th Edition (2019) 36/19
and Beloye More
101 Russia -- Murmanskiy Bereg -- Guba Voron’ya — Restricted area 46/19
101 Russia -- Murmanskiy Bereg -- Guba Yarnyshnaya — Restricted area 46/19
173 Russia -- Pechorskaya Guba — Regulations 40/19
Wk26/20 4.69
V
UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS
NP74, Vol A Edition 2020. Weekly Edition No. 26, Dated 25 June 2020.
Last Updates: Weekly Edition No. 25, dated 18 June 2020.
A0062 - Saint Anthony Head 50 08·47 N Iso WR 15s 22 W16 White 8-sided tower W295°-004°(69°), R004°-022°(18°)
(GB:TH) 5 00·97 W R14 19 over Manacle rocks,
W022°-172°(150°).
Shown 24 hours. Daymark obscured
by works (T) 2020
-- .. Horn 30s .. .. .. bl 3
*
A0774 - Saint Catherine's Point 50 34·54 N Fl W 5s 41 25 White 8-sided fl 0·1.

(GB:TH) 1 17·88 W castellated tower and W257°-117°(220°).
dwelling Shown 24 hours. Daymark obscured
26 by works (T) 2020
-- .. FR 35 13 . . R099°-116°(17°)
*
EAST COAST
A2596 - Whitby High. Ling Hill 54 28·67 N Fl WR 5s 73 W18 White 8-sided tower fl 0·8.
(GB:TH) 0 34·09 W R16 and dwellings R128°-143°(15°), W143°-319°(176°).
13 Daymark obscured by works (T)
2020
*
WEST COAST. THE SEA OF THE HEBRIDES. THE SMALL ISLES. RUM
A4078·9 - Isle of Rhùm. Loch 57 00·69 N Fl R 5s .. 1
Scresort 6 16·00 W
* * * * * * * *
NP75, Vol B Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
B1051 GW/EMS 54 09·96 N Iso W 8s 14 17 Red light vessel Shown 24 hours. Floodlit
DE, 4003, 308500 (DE) 6 20·72 E 12
- Emergency light .. FR .. .. .. May show 2 F R (vert)
- .. Horn Mo(R) .. .. .. Sounded continuously
30s
*
B1474 - Ruthensand 53 43·22 N Dir WRG 6s 15 W15 Red tower, white ec 1·5.
DE, 4003, 310700 9 25·43 E R12 bands and lantern Oc G170°-174·8°(4·8°).
DE, 4003, 310701 G11 15 Oc W174·8°-176·1°(1·3°).
Oc R176·1°-182°(5·9°)
- - Ldg Lts 161·6°. Front .. Iso W 4s .. 9 .. Intens on leading line only.
Rear B1474·1. 2 F W, 650m NE (T)
2020
* *
B2012 - Livø Bredning. Fur Havn. 56 48·16 N FG 3 4 Green pipe mast

DK, , 552 Entrance. E Side 9 01·19 E 2
* *
B2014 - Livø Bredning. Fur Havn. 56 48·15 N FR 3 4 Red pipe mast

DK, , 553 Entrance. W Side 9 01·17 E 2
* *
B2501 - Herbergbåen 59 08·77 N Iso W 2s .. .. .. Floodlit. (P) 2020

NO, , 035880 10 26·96 E
* * * * * * * *
5.1 Wk26/20
V
NP75, Vol B Edition 2019/20 continued.
B2519 - Froungbaen. NW 59 07·40 N Iso G 2s .. .. .. Floodlit. (P) 2020

NO, , 035877 10 26·45 E
* * * * * * * *
B2519·3 - Uleholmbåen. S 59 07·34 N QW .. .. .. Floodlit. (P) 2020

NO, , 035860 10 26·23 E
* * * * * * * *
B2519·5 - Uleholmbåen. N 59 07·40 N Iso R 4s .. .. .. Floodlit. (P) 2020

NO, , 035868 10 26·20 E
* * * * * * * *
B2964·9 - Uvårflaket 58 01·88 N Oc(3)WRG 10s 12 R6·8 Post G088·4°-096·1°(7·7°),

NO, , 074250 7 43·98 E G6·8 16 W096·1°-121·3°(25·2°),
W8·3 R121·3°-259·6°(138·3°),
G259·6°-263·6°(4°),
W263·6°-265·7°(2·1°),
R265·7°-034·8°(129·1°),
G034·8°-038·2°(3·4°),
W038·2°-039·9°(1·7°),
R039·9°-043·2°(3·3°),
G043·2°-054·2°(11°),
W054·2°-055·4°(1·2°),
R055·4°-088·4°(33°).
Floodlit
* * * * * * * *
B3003·5 - Troneboen 57 58·14 N QG .. .. .. Floodlit. Spar buoy to be removed

NO, , 077755 7 31·01 E (P) 2020
* * * * * * * *
B3047 Hammerøy 58 01·89 N Iso G 4s .. .. .. Floodlit. (P) 2020

NO, , 080903 7 13·81 E
* * * * * * * *
FARSUND
B3079·3 Remove from list; deleted
B3502·3 - Nesegapet Ø. E Side 59 08·61 N Iso G 2s 9 2·3 Post Floodlit

NO, , 125555 5 16·40 E
* * * * *
B3502·5 - Nesagapet SV. W Side 59 08·58 N Iso R 2s 9 2 Post Floodlit

NO, , 125554 5 16·40 E
* * * * *
B3503·5 - Nesodden. S på Nesodden 59 08·58 N QG 9 2·8 Post Floodlit

NO, , 125553 5 16·54 E
* * * * * *
B3505·3 - Nesegapet NV. W Side 59 08·61 N Iso R 4s 9 2 Post Floodlit

NO, , 125556 5 16·32 E
* * * * * *
ÅKRAFJORDEN
B3658 - Susodden. Åkrafjorden. S 59 44·68 N Iso WRG 6s 6 W5·8 Post G099·1°-116·8°(17·7°),
NO, , 141600 Side 6 02·62 E R4·5 3 W116·8°-119·6°(2·8°),
G4·5 R119·6°-204°(84·4°),
G204°-233·5°(29·5°),
W233·5°-262·2°(28·7°),
R262·2°-301·2°(39°)
* * *
5.2 Wk26/20
V
NP75, Vol B Edition 2019/20 continued.
B3684 - Ljonestangen 60 14·62 N Oc WRG 6s 4 W4·1 Post G201·8°-211°(9·2°),

NO, , 143900 6 09·35 E R3·1 5 W211°-227·7°(16·7°),
G3·1 R227·7°-236·1°(8·4°),
G236·1°-038·9°(162·8°),
W038·9°-051·9°(13°),
R051·9°-058·6°(6·7°)
* *
B3686 - Jonanes 60 17·63 N Oc(2)WRG 8s 7 W7·5 Post R347·3°-355°(7·7°),

NO, , 144000 6 13·34 E R 6 8 G355°-018·4°(23·4°),
G 6 W018·4°-031°(12·6°),
R031°-105·5°(74·5°),
G105·5°-183·4°(77·9°),
W183·4°-218·9°(35·5°),
R218·9°-225·2°(6·3°)
* * * *
NP76, Vol C Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
C0061·8 - Aså Havn. Ldg Lts 258·1°. 57 08·62 N FW 3 2 White % on building

DK, , 1442B Front 10 25·63 E
*
C0061·81 - Aså Havn. Ldg Lts 258·1°. 57 08·61 N FW 8 2 White + on metal

DK, , 1442A Rear 10 25·52 E mast
*
C0062 - Aså Havn. W Mole. Head 57 08·63 N FG 4 1 Mast

DK, , 1440 10 25·72 E 4
*
C0064 - Aså Havn. S Mole. Head 57 08·62 N FR 4 1 Mast

DK, , 1441 10 25·74 E 4
*
C1508 - Asnæsværket. Pier. N 55 39·93 N Fl G 3s 3 3·5 Bracket on pier fl 0·75.

DK, , 3322 11 05·00 E Shown 24 hours. TE 2020
*
SMAALANDSFARVANDET. GRØNSUND
C1854 Remove from list; deleted
SMAALANDSFARVANDET. GRØNSUND
C1854·1 Remove from list; deleted
C3025 - Kanał Południowy. 54 31·08 N Oc R 10s 7 2 Red pole ec 2·5

PL, 521, 0326 Nabrzeże Pomorskie. S 18 33·59 E
Corner
* * *
SIKEÅ FJORD
C5844 Remove from list; deleted
5.3 Wk26/20
V
NP77, Vol D Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
D1534·12 - Ria. Canal de Deusto 43 16·89 N Q R 1s 10 1 Red tripod, on hut TE 2020

ES, I, 00880 2 58·08 W 8
*
D1632·11 - Laviana. Dir Lt 099·1° 43 35·40 N Dir WRG 6s 70 5 White round tower, fl 2.
ES, I, 02102 5 54·58 W tapered top LFl G098·1°-098·5°(0·4°).
6 Al WG098·5°-098·85°(0·35°).
LFl W098·85°-099·25°(0·4°).
Al WR099·25°-099·7°(0·45°).
LFl R099·7°-100·1°(0·4°)
--- .. By day .. 4 .. Irreg (T) 2020
* *
D2616·6 Oued Drâa (Rio Nun) 28 40·50 N Fl(2)W 5s 85 25 White tower, black TE 2020
MA, , 18050 11 07·79 W bands
ES, I, 13777 33
FR, LC, 20450
* * *
DAWHAT DIBĀ
D7334·4 Remove from list; deleted
DAWHAT DIBĀ
D7334·5 Remove from list; deleted
NP78, Vol E Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
E0394·6 - E Breakwater. Head 41 10·67 N Fl R 5s 7 5 Red post fl 0·5.

ES, II, 29160 1 31·63 E 2 TE 2020
* *
E0394·65 - Pasarela de Cierre. E Head 41 10·69 N Fl G 5s 5 3 Green post fl 0·5.

ES, II, 29170 1 31·62 E 3 TE 2020
* *
E0434·593 - N Entrance 41 21·47 N Fl(2)R 7s .. 3 Red & on red round fl 0·5, ec 1·5, fl 0·5, ec 4·5
ES, II, 30377·8 2 10·90 E floating beacon
6
* * * * * * * *
E6389·5 - Beni Khiar. Fishing 36 27·10 N Fl G 4s 5 6 .. fl 1.

TN, , 2340 Harbour. Large Jetty. Head 10 47·80 E TE 2020
*
E6440 - Goulet du Lac de Bizerte. 37 15·51 N Dir WRG 6s 16 8 Round tower fl 0·3.
TN, , 0480 Pointe de Sabra 9 51·56 E 15 Fl G134°-234°(100°).
Fl W234°-235°(1°).
Fl R235°-355°(120°)
* *
5.4 Wk26/20
V
NP79, Vol F Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
SINGAPORE PORT. JOHOR STRAIT. SERANGOON HARBOUR

F1739 - Pulau Ubin. Tg Check Jawa 1 24·50 N Dir Fl W 5s 27 10 White + on white Fl W309°-314°(5°).
Dir Lt 311·4° 103 59·50 E post, white concrete In line with unlit white % on white
base post 190m from rear
5
* * * * * * * *
NP80, Vol G Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
G0555 - S Breakwater. Head. No 8 26 54·89 S Fl G 3s 15 10 White tower, green fl 0·5.

BR, DH2, 3828 48 38·01 W bands, on concrete To be moved to 26°54´·88S
base 48°37´·98W (P) 2020
14
*
G0555·5 - No 10 26 54·86 S Q(2)G 3s 5 5 White round GRP fl 0·5, ec 0·5, fl 0·5, ec 1·5.
BR, DH2, 3836 48 38·48 W tower, green bands, To be moved to 26°54´·85S
on concrete base 48°38´·47W (P) 2020
4
*
NP82, Vol J Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
J5705·2 - Rivière Sens. Marina. Spur. 15 58·92 N Fl(2)G 6s .. . . White mast, green top TE 2020
FR, LD, 06820 Head 61 43·01 W
(FR)
*
NP83, Vol K Edition 2020/21. Weekly Edition No. 26, Dated 25 June 2020.
K2603·95 - Boat Harbour. Breakwater 34 28·40 S Fl R 3s .. 3 Metal pole fl 1

Head. E 150 54·77 E
*
K2603·951 - Boat Harbour. Breakwater 34 28·38 S Fl G 3s .. 3 Metal pole fl 1

Head. W 150 54·76 E
*
CLARENCE RIVER
K2818 - River Entrance Ldg Lts 29 25·95 S Fl(3)W 15s 41 14 White concrete tower (fl 0·5, ec 2) x 2, fl 0·5, ec 9·5.
237·5°. Common rear. 153 21·84 E Front K2819
Clarence Head
(AU:AMSA)
- North Channel Ldg Lts .. F Bu .. 2·5 . . Bu040°-171°(131°).
131·5°. Common rear. Front K2822
Clarence Head
* * * * *
5.5 Wk26/20
V
NP83, Vol K Edition 2020/21 continued.
K2838 Cape Byron 28 38·31 S Fl W 15s 118 27 White concrete tower fl 0·03.
(AU:AMSA) 153 38·18 E and lantern Range 15M, W20°-160° (140°) (T)
22 2020
- .. FR 111 8 .. R148°-189°(41°)
*
K2944·9 - Mary River. Leslie Reach 25 30·49 S Fl R 3s .. . . Red U on beacon fl 0·3.

152 46·90 E Destroyed (T) 2020
*
K3492·95 - Lassul Bay. NE 4 11·74 S Fl G 2s .. . . Green % on beacon

151 44·88 E
*
K3495·5 - Duke of York Island. 4 07·04 S Fl W 5s 19 3 White GRP hut fl 0·2

Kabelatad 152 26·66 E 4
*
K3507·6 - Nahuchie Point 2 02·34 S Fl W 2·5s 7 10 White GRP hut fl 0·3

147 24·21 E 6
*
K3636 - Acid Tanker Berth. NW 42 49·74 S FR .. .. .. TE 2020

End 147 19·01 E
*
PASSE DEVERD. ÎLOT DEVERD

K4788·4 - Cap Deverd. Ldg Lts 096°. 20 45·20 S Fl W 14 4 % on beacon
FR, LC, 49745 Front 164 22·20 E
(FR)
* * * * * * * *
K4788·41 - Cap Deverd. Ldg Lts 096°. 20 45·30 S Fl W 38 4 % on beacon Sync with front
FR, LC, 49746 Rear. 120m from front 164 22·30 E 4
(FR)
* * * * * * * *
K4975·7 - Baie Haamene 16 38·35 S Oc G 4s 3 3 Green % on green ec 1

FR, LC, 67320 (FR) 151 28·23 W beacon
5
*
K4983·139 - Motu Toopua. NW 16 30·48 S Fl R 2·5s 2 3 Red & on red beacon fl 0·5.
FR, LC, 68720 (FR) 151 46·28 W 4 TE 2020
*
K4983·142 - Motu Toopua. NW 16 30·37 S QR 2 3 Red & on red beacon TE 2020

FR, LC, 68710 (FR) 151 46·31 W 4
*
K4983·6 - N Side. Pointe Tahi. E 16 27·89 S Q(6)+LFl W 3 5 " on black beacon, TE 2020
FR, LC, 69060 (FR) 151 44·02 W 15s yellow top
7
*
5.6 Wk26/20
V
NP84, Vol L Edition 2020/21. Weekly Edition No. 26, Dated 25 June 2020.
L2876 - Vårsetøya. E Side 68 13·50 N Oc(2)WRG 8s 10 W1·8 Post G203·3°-219·5°(16·2°),

NO, , 749600 14 33·49 E R1·3 3 W219·5°-221·2°(1·7°),
G1·3 R221·2°-320·3°(99·1°),
G320·3°-328·4°(8·1°),
W328·4°-348·3°(19·9°),
R348·3°-353·7°(5·4°)
* *
L2879 - Rødholman. E Side 68 13·10 N Oc WRG 6s 19 W5·1 Column G173·8°-200·3°(26·5°),

NO, , 750000 14 33·25 E R3·9 6 W200·3°-205·2°(4·9°),
G3·9 R205·2°-257·6°(52·4°),
G257·6°-347·9°(90·3°),
W347·9°-011·5°(23·6°),
R011·5°-028°(16·5°),
G028°-045·5°(17·5°),
W045·5°-048·8°(3·3°),
R048·8°-053·9°(5·1°)
--- .. Racon .. .. .. ALRS Vol 2 Station 66000
* *
L2880·5 - Stretarneset 68 13·23 N Oc(2)WRG 8s 13 W9·1 Post G188·5°-200°(11·5°),

NO, , 750100 14 32·30 E R7·5 4 W200°-204°(4°),
G7·5 R204°-312·1°(108·1°),
G312·1°-316·9°(4·8°),
W316·9°-318·7°(1·8°),
R318·7°-330°(11·3°),
G330°-340·9°(10·9°),
W340·9°-010·6°(29·7°),
R010·6°-020·7°(10·1°).
Floodlit
* *
L2882 - Klippfiskholmen 68 13·59 N Oc(3)WRG 10s 6 R2·9 Post G179·5°-185·8°(6·3°),

NO, , 750600 14 32·60 E G2·9 6 W185·8°-201·1°(15·3°),
W3·9 R201·1°-345·1°(144°),
G345·1°-008°(22·9°),
W008°-012·9°(4·9°),
R012·9°-016·4°(3·5°)
* * * *
L2922 Kristenskjærene. Gimsøy 68 18·97 N Iso WRG 4s 6 W7·3 Cairn R131·9°-135·2°(3·3°),

NO, , 755200 14 15·84 E R5·9 8 G144·7°-190·2°(45·5°),
G5·9 W190·2°-196·3°(6·1°),
R196·3°-252°(55·7°),
G252°-319·3°(67·3°),
W319·3°-338·6°(19·3°),
R338·6°-117·4°(138·8°)
* * *
L3055 Skolmneset 68 14·83 N Iso WRG 4s 17 W6·7 Cairn G305·3°-025°(79·7°),

NO, , 778200 13 30·61 E R5·4 7 W025°-026·8°(1·8°),
G5·4 R026·8°-071·1°(44·3°),
G071·1°-076·1°(5°),
W076·1°-083·7°(7·6°),
R083·7°-118·8°(35·1°),
G118·8°-150°(31·2°),
W150°-181·8°(31·8°),
R181·8°-209·9°(28·1°)
*
L6643 - Proliv Kibirinskaya. 67 06·18 N QW 23 12 White (, red stripe,

RU, 2105, 5920 Krestovyy. Ldg Lts 317·9°. 32 31·70 E on 4-sided truncated
Front pyramid
16
*
5.7 Wk26/20
V
NP84, Vol L Edition 2020/21 continued.
L6760 - Rabocheostrovskiy. No 1 65 00·15 N FW 10 3 White ( on 4-sided Vis on leading line only.

RU, 2105, 5240 Ldg Lts 286·6°. Front 34 48·59 E metal framework Destroyed (T) 2020
tower
8
*
L6760·1 - Rabocheostrovskiy. No 1 65 00·17 N FW 14 3 White ( on Vis on leading line only.

RU, 2105, 5241 Ldg Lts 286·6°. Rear. 150m 34 48·41 E framework structure Destroyed (T) 2020
from front 14
*
L6768·1 - Monastyrskiy. Ldg Lts 64 59·66 N FR 16 2 White ( red stripe, Vis on leading line only.
RU, 2105, 5246 257·3°. Rear. 407m from 34 47·30 E on pole Destroyed (T) 2020
front 9
*
NP85, Vol M Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
M4294·8 Yeongmando 34 10·87 N Fl(4)Y 8s 16 9 Yellow 3-sided metal

KR, 410, 2507·1 127 21·20 E tower
13
* * * * * * * *
M4321·529 - Hajungchon Hang 34 56·49 N Fl G 4s 9 7 White round metal

KR, 410, 2077·6 128 13·22 E tower
5
* * * * * * * *
M4367 - South Inner Harbour. 35 05·15 N F RG 12 1 White 4-sided metal G153°-184°(31°), R334°-005°(31°).
KR, 410, 2027·17 Entrance. W Breakwater. 129 01·85 E tower FG: Entry / FR: No entry
Head. Harbour Traffic 8
Control
* * * * * * * *
M4430·9 Gusan Hang. A 36 44·39 N Fl(4)Y 8s 8 8 Yellow × on yellow

KR, 410, 1285·7 129 28·50 E pile
7
*
M5952·52 - Izumi Otsu Bridge. L1 34 31·10 N FG 14 4 .. G140°-320°(180°).

JP, 411, 3531 135 24·07 E TE 2020
*
M5952·521 - Izumi Otsu Bridge. L2 34 31·10 N FG 14 4 .. G320°-140°(180°).

JP, 411, 3531·01 135 24·06 E TE 2020
*
M5952·53 - Izumi Otsu Bridge. R1 34 31·14 N FR 14 4 .. R140°-320°(180°).

JP, 411, 3531·04 135 24·03 E TE 2020
*
M5952·531 - Izumi Otsu Bridge. R2 34 31·14 N FR 14 4 .. R320°-140°(180°).

JP, 411, 3531·05 135 24·02 E TE 2020
*
5.8 Wk26/20
V
NP87, Vol P Edition 2019/20. Weekly Edition No. 26, Dated 25 June 2020.
WEITOU WAN AND APPROACHES. JINMEN DAO

P3620·08 - Liaoluo Harbour. S 24 24·47 N Oc R 5s .. 5
Breakwater. Head 118 25·42 E
*
P3620·081 - Liaoluo Harbour. N 24 24·62 N Fl G 4s .. 6

Breakwater. Head 118 25·47 E
*
P3758 - Beizhi Koumen. No 1, No 2 31 33·23 N Mo(C)Y 15s 7 3 Yellow × on yellow

CN, G102, 2075·51 122 06·21 E post
CN, G102, 2075·52 1
--- .. AIS .. .. .. MMSI No 999412257
* * * * * * * *
P4659·75 - Tai-chung Power Station. S 24 12·87 N Fl Y 4s 13 . . Red concrete tower

TW, 5, 21520 Training Wall. Centre 120 27·90 E 3
*
P4659·8 - 24 12·99 N FY 27 3
120 27·68 E
* * * * * * * *
P4660·2 - N Groyne 24 18·77 N Fl(3)Y 10s 13 7 White round concrete (fl 0·4, ec 0·9) x 2, fl 0·4, ec 7
TW, 5, 21070 120 31·19 E tower, red bands
12
*
P4660·3 - N Groyne. Head 24 18·84 N Fl R 4s 13 . . Red concrete spar

TW, 5, 21075 120 31·03 E 5
*
P4660·4 - N Breakwater 24 17·98 N Fl G 4s 44 17 Green round concrete fl 0·8

TW, 5, 21160 120 29·19 E tower
18
-- .. Racon .. .. .. ALRS Vol 2 Station 80890
*
P4660·48 - N Breakwater. Elbow. 24 17·69 N Dir WRG 11 W14 Yellow 6-sided F R057·5°-062·5°(5°).
TW, 5, 21130 Entrance Dir Lt 065° 120 29·91 E R11 concrete tower F W062·5°-067·5°(5°).
TW, 5, 21110 G11 16 F G067·5°-072·5°(5°)
- - - Ldg Lts 065°. Front .. FY 39 11
*
P4660·481 - N Breakwater. Ldg Lts 24 17·80 N FY 55 11 Yellow metal tower

TW, 5, 21120 065°. Rear. 500m from front 120 30·18 E 26
*
P4660·5 - N Breakwater. Jetty 24 17·91 N Fl W 5s 5 6 Red round concrete fl 0·5.

TW, 5, 21135 120 30·33 E tower This light may be visible in the white
8 sector of F4660·48. Mariners are
advised to navigate with caution when
approaching T'ai-chung. TE 2020
*
P4660·6 - S Breakwater 24 17·41 N Fl R 2s 43 14 Red round concrete

TW, 5, 21170 120 30·04 E tower
20
-- .. FR .. 5
-- .. Racon .. .. .. ALRS Vol 2 Station 80900
* * * * * * * *
5.9 Wk26/20
V
NP87, Vol P Edition 2019/20 continued.
P4660·614 - Coal Wharf. Ldg Lts 24 14·16 N FG 13 3 Green % on orange TE 2020

TW, 5, 21610 231°30′. Front 120 29·02 E metal pillar
13
*
P4660·615 - Coal Wharf. Ldg Lts 24 14·13 N FG 18 3 Red + on orange TE 2020

TW, 5, 21620 231°30′. Rear. 100m from 120 28·97 E metal pillar
front 18
*
P4660·618 - Collier Channel. Ldg Lts 24 13·79 N FG 74 9·6 Orange metal TE 2020
TW, 5, 21600 201°32′. Rear. 864m from 120 29·62 E chimney
front 57
*
P4660·62 - S Pier. Ldg Lts 051·5°. 24 15·23 N FG 48 9 Orange light beacon

TW, 5, 21650 Front 120 30·48 E
* * *
P4660·621 - S Pier. Ldg Lts 051°30′. 24 15·27 N FG 18 3 Red + on orange TE 2020

TW, 5, 21660 Rear. 100m from front 120 30·53 E metal pillar
18
*
P4660·676 - Fishing Harbour. Ldg Lts 24 17·66 N FG 43 9 Red + on orange TE 2020

TW, 5, 21680 021·53°. Rear. 601m from 120 31·27 E metal tower
front 43
*
P4660·94 - N Pier. Main Channel. Ldg 24 16·95 N Dir WRG 68 17 Yellow % on red and F R103°-112°(9°).
TW, 5, 21140 Lts 114·25°. Front 120 31·42 E white square metal F W112°-116·5°(4·5°).
tower F G116·5°-121°(4·5°).
45 TE 2020
* *
P4660·941 - N Pier. Main Channel. Ldg 24 16·78 N FW 92 9·6 Red and white light
TW, 5, 21150 Lts 114·25°. Rear. 800m 120 31·85 E beacon
from front
* * *
5.10 Wk26/20
VI
COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE REQUIREMENTS,

PILOTAGE, VTS, REPORTING, RADIO COMMUNICATIONS AND TRANSMISSIONS
An increasing number of ports are introducing specific quarantine reporting requirements with regards to this virus. Its continued
spread is also impacting a number of other services covered by ADMIRALTY List of Radio Signals products. Due to the ongoing
and dynamic nature of the situation, mariners should contact the appropriate Port Authority, VTS, Pilot, coastguard, radio station
or other designated body covering their planned route and destination, for the latest advice and procedures. Due to the rapidly
changing situation, it is advised to check local situation at the earliest opportunity when passage planning.
VI
UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS

Weekly Edition No. 26 dated 25 June 2020
The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2020.pdf)
VOLUME 2, NP282(1), First Edition, 2020

Published Wk 13/20
(Last Updates: Weekly Edition No. 25 dated 18 June 2020)
AUTOMATIC IDENTIFICATION SYSTEM (AIS)
PAGE 138, SPAIN (South Coast), below Bajos de la Perla y Las Bajas.
Insert:
Gibraltar Bay ODAS Lt Buoy 36°03′·97N 5°24′·98W 992242150 Real
Spanish Bulletin 22/20 (RSDRA2020000134478) 26/20

Published Wk 13/20
PAGE 118, CHINA, below Changjiang Kou Lt Vessel.

Insert:
Changjiang Kou S18 31°03′·90N 122°03′·64E 994136411 Broadcasts every 3 minutes Virtual
Chinese Notice 21/722/20 (RSDRA2020000134430) 26/20
PAGE 142, CHINA, below Nan Zhi Wreck.

Insert:
Nancao Hangdao Channel No 1 31°03′·11N 122°10′·50E 994126370 Broadcasts every 3 minutes Virtual
Nancao Hangdao Channel No 9 31°04′·85N 122°02′·32E 994126378 Broadcasts every 3 minutes Virtual Continued on next page
Wk26/20
Nancao Hangdao Channel No 12 31°05′·05N 122°00′·37E 6.1
994126380 Broadcasts every 3 minutes Virtual
Nancao Hangdao Channel No 7 31°04′·36N 122°04′·11E VI

994126376 Broadcasts every 3 minutes Virtual
VI
Nancao Hangdao Channel No 17 31°06′·30N 121°58′·22E 994126385 Broadcasts every 3 minutes Virtual Continued on next page
6.1
Chinese Notice 21/723/20 (RSDRA2020000134430) 26/20
Wk26/20
6.2
VI
VI
VOLUME 6, PART 2, NP 286(2), 2019/20 PAGE 374, SHIP REPORTING SYSTEMS, IN THE GULF OF FINLAND
Published Wk 21/19
REPORTING SYSTEM (GOFREP), Tallinn Traffic, CONTACT DETAILS.
Delete and replace by:
––––––––––––––––––
CONTACT DETAILS:
PAGE 371, SHIP REPORTING SYSTEMS, IN THE GULF OF FINLAND Call: Tallinn Traffic
REPORTING SYSTEM (GOFREP), Reporting System (GOFREP), VHF Channel: Ch 61 81 (Reserve)
CONTACT DETAILS. Telephone: +372 6205764
Delete and replace by: +372 6205765
Fax: +372 6205766
CONTACT DETAILS: E-mail: gofrep@vta.ee
Vessels entering the area N of the Central Reporting Line (Former update 19/20)
Call: Helsinki Traffic
VHF Channel: Ch 60 80 (Reserve) Vessel Traffic Services Finland, (RSDRA2020000135288), 26/20
Telephone: +358(0)20 4485387
+358(0)20 4485388 ––––––––––––––––––––––––––––––
E-mail: gofrep@vtsnland.
Website: tmfg./en/vts/masters-guide VOLUME 6, PART 5, NP 286(5), 2019/20
Vessels entering the area S of the Central Reporting Line W of longitude Published Wk 48/19
26°30′·00E
Call: Tallinn Traffic ––––––––––––––––––
VHF Channel: Ch 61 81 (Reserve)
(Last Updates: Weekly Edition No. 21 dated 21 May 2020)
Telephone: +372 6205764
+372 6205765 PAGE 14, CANADA (Atlantic Coast), GENERAL NOTES, below ICE
E-mail: gofrep@vta.ee ADVISORY SERVICE section.
Vessels entering the area S of the Central Reporting Line E of longitude Insert:
26°30′·00E
Call: Saint Petersburg Traffic GULF OF ST. LAWRENCE – PROTECTION OF THE NORTH
VHF Channel: Ch 10 (Reserve) 74 ATLANTIC RIGHT WHALE:
Telephone: +7(8)812 3807021 (1) Due to changing migration patterns of North Atlantic right whales and their
+7(8)812 3807081 increased presence in the Gulf of St. Lawrence, the Government of Canada has
E-mail: gofrep@rsbm.ru established seasonal speed restrictions in specic zones. Vessels should make
themselves aware of the mandatory regulations and reporting procedures in place.
(Former update 19/20)
Speed restriction zones are described in monthly Notices to Mariners (NOTMARs),
Vessel Traffic Services Finland, (RSDRA2020000135288), 26/20 which are published by the Canadian Coast Guard (CCG). The status of these zones
is broadcast through Navigational Warnings (NAVWARNs), which are published by the
PAGE 373, SHIP REPORTING SYSTEMS, IN THE GULF OF FINLAND CCG’s Marine Communications and Traffic Services (MCTS) Centres.
REPORTING SYSTEM (GOFREP), Helsinki Traffic, CONTACT (2) Vessels should report a North Atlantic right whale sighting. If you see a North
DETAILS. Atlantic right whale that is entangled, injured or dead, please report it to your nearest
Delete and replace by: Canadian Coast Guard Marine Communications and Traffic Services Centre, or as
follows:
CONTACT DETAILS: CONTACT DETAILS:
Call: Helsinki Traffic
VHF Channel: Ch 60 80 (Reserve) Southern part of the Gulf of St. Lawrence
Telephone: +358(0)204 485387 Telephone: +1 866 5676277
+358(0)204 485388 Newfoundland and Labrador
Fax: +358(0)204 485394 Telephone: +1 888 8953003
E-mail: gofrep@fta.
Québec Sector
(Former update 19/20) Telephone: +1 877 7225346
Vessel Traffic Services Finland, (RSDRA2020000135288), 26/20 For sightings of live, free-swimming whales
Telephone: +1 902 4408611 (Local)
PAGE 374, SHIP REPORTING SYSTEMS, IN THE GULF OF FINLAND +1 844 8008568 (Toll Free)
REPORTING SYSTEM (GOFREP), Saint Petersburg Traffic, CONTACT
DETAILS. Canadian Notice 5/504/20, (RSDRA2020000128877), 26/20
Delete and replace by:
––––––––––––––––––––––––––––––
CONTACT DETAILS:
Call: Saint Petersburg Traffic
VHF Channel: Ch 10 (Reserve) 74
Telephone: +7(8)812 3807081
Fax: +7(8)812 3807020
E-mail: gofrep@rsbm.ru
(Former update 19/20)
Vessel Traffic Services Finland, (RSDRA2020000135288), 26/20
1
Wk26/20
6.3
VI
ADMIRALTY LIST OF RADIO SIGNALS 76710 13

CUMULATIVE LIST OF UPDATES 79210 13
85682 13
CORRECT TO Wk 26/20
85683 13
This list is a summary of the entries in the current editions of the Admiralty List of
Radio Signals which have had updates issued in Section VI of the Weekly Edition 85684 13
of Notices to Mariners. The entries affected are shown in bold type followed by 85685 13
the numbers of the Weekly Editions in which updates for that station were issued. 85690 13
These summaries are issued on a quarterly basis.
85705 13

VOLUME 1, NP281(1), 2019/20
Published Wk 48/19 BELGIUM 20
FINLAND 14
FRANCE (Atlantic Coast) 13
MARITIME RADIO STATIONS
IRELAND 13, 14, 16
SPAIN (South Coast) 26
ALGERIA 48
SRI LANKA 13, 14
CROATIA 48
TUNISIA 13
FRANCE 48
TURKEY (Marmara Denizi) 15
GREENLAND 48
TURKEY (Mediterranean Coast) 17
IVORY COAST 48
UKRAINE 13
LIBERIA 2020 21
UNITED KINGDOM 13, 14, 17, 20, 22, 23, 25
MADAGASCAR 2020 4
MOROCCO 48
NORWAY 2020 7
POLAND 2020 1, 2, 7, 16 VOLUME 2, NP282(2), First Edition, 2020
SLOVENIA 2020 6 Published Wk 13/20
SPAIN (Mediterranean Coast) 48
TURKEY 2020 12 RADAR BEACONS
UNITED KINGDOM 2020 9, 10, 12
80608 13 82483 14
81514 21 82936·5 14
VOLUME 1, NP281(2), 2019/20 81824.5 25 86635 13
Published Wk 48/19 81826.25 25 96800 13
81944.5 25
MARITIME RADIO STATIONS AUTOMATIC IDENTIFICATION SYSTEM (AIS)
ANTARCTICA 2020 11, 19 ANTARCTICA 13

ARGENTINA 2020 12 ARGENTINA 14
BRAZIL 2020 8 BRAZIL 13
CHILE 2020 13, 14 CHILE 13, 18
COLOMBIA (Caribbean Coast) 2020 18 CHINA 13, 14, 15, 16, 18, 20, 21, 22, 23, 24, 25, 26
CURAÇAO 2020 10 CUBA 15
FIJI 48 GUADELOUPE (France) 13
GREENLAND 48 INDONESIA (Bali) 13
INDONESIA (Sumatera) 2020 23 INDONESIA (Jawa) 13
JAPAN 2020 22 INDONESIA (Sumatera) 13
MALAYSIA (Sabah) 2020 9 KOREA, SOUTH 13
MALAYSIA, PENINSULAR 2020 9 NEW ZEALAND 14, 17
PHILIPPINES 2020 13 SINGAPORE 19
SAINT-PIERRE AND MIQUELON (France) 52 UNITED STATES (Atlantic Coast) 13, 17
SINGAPORE 2020 9 UNITED STATES (Gulf Coast) 23
UNITED STATES (Pacific Coast) 19
VIETNAM 18
Published Wk 13/20 DIFFERENTIAL GPS (DGPS)
UNITED STATES (Gulf Coast) 25

RADAR BEACONS
DIAGRAMS
50330 22
51695 13 Page 264 25
51810 13
54035 20
70780 17
70785 13
Wk26/20
6.4
6.1
VI
VOLUME 3, NP283(1), 2020 VOLUME 5, NP285, 2019/20

Published Wk 50/19 Published Wk 28/19
RADIO-FACSIMILE VHF DSC, LIST OF COAST STATIONS FOR SEA AREA A1
NORTHWOOD 2020 20 NAVAREA I - POLAND 2020 1, 2

OLYMPIA 2020 16 NAVAREA I - UNITED KINGDOM 2020 9
NAVAREA III - CROATIA 31
RADIO WEATHER SERVICES NAVAREA IV - COLOMBIA (Caribbean Coast) 2020 18
AND NAVIGATIONAL WARNINGS NAVAREA IV - CURAÇAO 2020 10
NAVAREA IV - MARTINIQUE (France) 46
BAHRAIN 50
NAVAREA X - NEW CALEDONIA (France) 46
BELGIUM 50
NAVAREA XII - COLOMBIA (Pacific Coast) 2020 18
DENMARK 2020 6
FINLAND 2020 23
MF DSC, LIST OF COAST STATIONS FOR SEA AREA A2
FRANCE (Atlantic and English Channel Coasts) 50
FRANCE (Mediterranean Coast) 2020 9, 12 NAVAREA I - FRANCE (Atlantic and English Channel Coasts) 32
GERMANY 2020 2 NAVAREA I - POLAND 2020 1, 2
GREENLAND 50 NAVAREA I - UNITED KINGDOM 2020 9
ITALY 50 NAVAREA IV - COLOMBIA (Caribbean Coast) 2020 18
NORWAY 2020 6 NAVAREA VI - ANTARCTICA 2020 11
POLAND 2020 1, 2, 7, 11 NAVAREA VII - MADAGASCAR 2020 4
RÉUNION (France) 51 NAVAREA VIII - RÉUNION (France) 47
SÃO TOMÉ AND PRÍNCIPE 2020 3 NAVAREA XII - COLOMBIA (Pacific Coast) 2020 18
SPAIN (Mediterranean Coast) 50 NAVAREA XIV - FRENCH POLYNESIA 47
SPAIN 50
SPAIN (North Coast) 50 HF DSC, LIST OF COAST STATIONS FOR
SPAIN (South Coast) 50 SEA AREA A3 AND A4
UNITED ARAB EMIRATES 52
UNITED KINGDOM 2020 9 NAVAREA IV - COLOMBIA (Caribbean Coast) 2020 18
DIAGRAMS MARITIME SAFETY INFORMATION (MSI) UNDER THE GMDSS
Page 56 2020 16 Page 218 NAVAREA (Baltic Sea Sub-Area Coordinator) 33

Page 85 2020 6 Page 219 NAVAREA II 39
Page 220 NAVAREA III 43
SAFETYNET
VOLUME 3, NP283(2), 2020 Page 242 NAVAREA III 29
Published Wk 5/20 Pages 242 and 243 Area of Responsibility for High Seas (GMDSS) 29
Page 248 EGC MSI SYSTEM NEW SCHEDULE TABLE 37
RADIO-FACSIMILE
NAVTEX
HONOLULU 17
SHANGHAI 5 NAVAREA VII - SOUTH AFRICA 28
NAVAREA III - FRANCE (Mediterranean Coast) 2020 12
RADIO WEATHER SERVICES NAVAREA III - ITALY 46
AND NAVIGATIONAL WARNINGS NAVAREA VII - NAMIBIA 43
NAVAREA IX - EGYPT 28
CANADA (Arctic Coast, Atlantic Coast and Saint Lawrence River) 9 NAVAREA XI - CHINA 2020 14, 15
CHINA 14, 15 NAVAREA XI - GUAM (USA) 39
CURAÇAO 10 NAVAREA XI - PHILIPPINES 44
GUYANA 7 NAVAREA XX - RUSSIA (Arctic Coast) 28
RUSSIA (Pacific Coast) 5 NAVAREA XVI - PERU 29
UNITED STATES (Alaska) 10 NAVAREA XXI - RUSSIA (Arctic Coast) 35
URUGUAY 10
DISTRESS, SEARCH AND RESCUE
DIAGRAMS
NAVAREA I - DENMARK 48
Page 83 5 NAVAREA I - POLAND 2020 1, 2
NAVAREA I - UNITED KINGDOM 2020 4
NAVAREA II - BENIN 48
NAVAREA II - CAMEROON 48
NAVAREA II - GUINEA 48
NAVAREA II - IVORY COAST 48
NAVAREA II - LIBERIA 2020 21
NAVAREA II - MAURITANIA 48
Wk26/20
6.5
6.2
VI
NAVAREA II - SPAIN 48 FINLAND 26, 30, 42, 45, 47, 2020 16

NAVAREA III - ALGERIA 48 GERMANY 21, 42, 2020 2, 8, 24
NAVAREA III - SPAIN 48 NORWAY 21, 2020 3
NAVAREA III - TUNISIA 48 POLAND 2020 8, 9, 12, 14
NAVAREA IV - CURAÇAO 2020 10 RUSSIA (Baltic Coast) 21, 40
NAVAREA V - BRAZIL 33, 2020 8 SHIP REPORTING SYSTEMS 21, 21 2020 19
19, 26
NAVAREA VI - FALKLAND ISLANDS (UK) 33 SWEDEN 23, 27, 49, 2020 5, 11, 18, 20, 24, 25
NAVAREA VII - MADAGASCAR 48, 2020 4
NAVAREA VIII - BANGLADESH 28
NAVAREA VIII - INDIA 28, 31 DIAGRAMS
NAVAREA IX - DJIBOUTI 48
NAVAREA XI - MALAYSIA 2020 9 Page 146 2020 2
NAVAREA XI - PHILIPPINES 2020 13 Page 414 27
NAVAREA XIV - FIJI 46 Page 428 2020 18
NAVAREA XIV - FRENCH POLYNESIA 47 Page 442 49, 2020 25
NAVAREA XIV - NEW ZEALAND 44
DIAGRAMS VOLUME 6, PART 3, NP 286(3), 2019/20

Published Wk 27/19
Page 193 47
Page 328 28
PILOT SERVICES, VESSEL TRAFFIC SERVICES
Page 335 28 AND PORT OPERATIONS
Page 487 47
ALBANIA 2020 13
ALGERIA 27, 2020 5, 7
VOLUME 6, PART 1, NP 286(1), 2019/20 BULGARIA 34
Published Wk 16/19 CROATIA 2020 5
FRANCE (Mediterranean Coast) 27
ISRAEL (Mediterranean Coast) 40
AND PORT OPERATIONS ITALY 2020 12, 20
LEBANON 31
BELGIUM 2020 4, 19 MONTENEGRO 2020 10
CANARIAS, ISLAS (Spain) 2020 6 MOROCCO 29
CHANNEL ISLANDS (UK) 28, 50 SLOVENIA 2020 24
ENGLISH CHANNEL AND NORTH SEA, including Skagerrak - DEEP SEA SPAIN (Mediterranean Coast) 27, 46
PILOTS 17 TURKEY 35, 44, 46, 49, 2020 2
FRANCE (Atlantic and English Channel Coasts) 17, 19, 43, 46, 2020 4, 5, 8, UKRAINE 41
21, 22, 24
NETHERLANDS 2020 10, 13 DIAGRAMS
SPAIN (North Coast) 16, 27
SPAIN (South West Coast) 2020 4 Page 408 41
UNITED KINGDOM 16, 22, 26, 38, 39, 2020 5, 8, 9, 14, 19
UNITED KINGDOM (Northern Ireland) 27, 2020 3
VOLUME 6, PART 4, NP 286(4), 2019/20
DIAGRAMS
Published Wk 37/19
Page 44 50
Page 156 2020 13 PILOT SERVICES, VESSEL TRAFFIC SERVICES
Page 351 26 AND PORT OPERATIONS
AUSTRALIA 37, 39, 48, 2020 6, 8

FRENCH POLYNESIA 2020 9, 21
VOLUME 6, PART 2, NP 286(2), 2019/20 INDIA 50, 2020 18
Published Wk 21/19 INDONESIA 37, 40, 42, 2020 8, 23
MALAYSIA 2020 23
PILOT SERVICES, VESSEL TRAFFIC SERVICES NEW ZEALAND 44, 2020 15
AND PORT OPERATIONS PAKISTAN 39
PHILIPPINES 2020 2
BALTIC SEA 2020 15, 22
SHIP REPORTING SYSTEMS 44
DENMARK 21, 33, 2020 4
SINGAPORE 2020 23
ENGLISH CHANNEL AND NORTH SEA, including Skagerrak - DEEP SEA
PILOTS 21
ESTONIA 2020 12
Wk26/20
6.6
6.3
VI
VOLUME 6, PART 8, NP 286(8), First

DIAGRAMS
Published Wk 14/20
Page 335 44
AND PORT OPERATIONS
VOLUME 6, PART 5, NP 286(5), 2019/20 KUWAIT 14
Published Wk 48/19 MOZAMBIQUE 17, 19
NAMIBIA 14
PILOT SERVICES, VESSEL TRAFFIC SERVICES NIGERIA 14
AND PORT OPERATIONS RÉUNION (France) 14
UNITED ARAB EMIRATES 19
BAHAMAS, THE 48, 2020 12
CANADA (Atlantic Coast) 48, 52, 2020 26
CANADA (Northern Coast) 52
CANADA (Pacific Coast) 48, 52, 2020 21
UNITED STATES (Atlantic Coast) 2020 5
UNITED STATES (Gulf Coast) 2020 12

Published Wk 3/20

AND PORT OPERATIONS
CHINA 3, 4, 5, 6, 8, 16, 17, 20, 21, 22

JAPAN 14
KOREA, SOUTH 13
RUSSIA (Pacific Coast) 3
SHIP REPORTING SYSTEMS 17
VIETNAM 3, 8
DIAGRAMS
Page 25 3
Page 25 21
Page 26 21
Page 34 3
Page 44 3
Page 63 4
Page 79 22
Page 118 3
Page 139 21

Published Wk 7/20

AND PORT OPERATIONS
CHILE 15
EL SALVADOR 7
GUADELOUPE (France) 10
MEXICO 10
Wk26/20
6.7
6.4
VII
UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS
In force 25 June 2020
Weekly
136 Ocean Passages for the (1st Edition 2018) 10/18

World Volume 2
231 Connector Routes. Connector to Connector Routes and Waypoints. 50/18
235 Auckland, Brisbane, Buenaventura and Callao. Port to Port Routes and 50/18
Port to Connector Routes.
239 Gladstone, Harbour of Vancouver (Juan de Fuca Strait) and Hay Point. 50/18
Port to Port Routes and Port to Connector Routes.
243 Lazaro Cardenas, Long Beach and Lyttelton. Port to Port Routes, Port to Connector 50/18
Routes and Waypoints.
245 Melbourne, Newcastle, Oakland and Port Botany. Port to Port Routes and Port to 50/18
Connector Routes.
249 Port Kembla, Quintero, San Jose, San Pedrito Port, Tacoma, Tauranga and 50/18
Townsville. Port to Port Routes and Port to Connector Routes.
201A ADMIRALTY United Kingdom English Channel to River Humber 18/19
Tide Tables (Including Isles of Scilly, Channel Islands and European Channel Ports)
Volume 1A 2020 Edition
293 Part II, Time and Height Differences for predicting the tide at Secondary Ports, 35/19
ENGLAND, SOUTH COAST
7.1
Wk26/20
VIII
ADMIRALTY DIGITAL SERVICES
COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE

REQUIREMENTS, PILOTAGE, VTS, REPORTING, RADIO COMMUNICATIONS AND
TRANSMISSIONS
An increasing number of ports are introducing specific quarantine reporting requirements with regards to
this virus. Its continued spread is also impacting a number of other services covered by ADMIRALTY
List of Radio Signals products. Due to the ongoing and dynamic nature of the situation, mariners should
contact the appropriate Port Authority, VTS, Pilot, coastguard, radio station or other designated body
covering their planned route and destination, for the latest advice and procedures. Due to the rapidly
changing situation, it is advised to check local situation at the earliest opportunity when passage planning.
1. ENC / ECDIS and AVCS
a) Safety Notice
For a graphical way to establish that the ECDIS is correctly displaying the new symbols introduced in IHO S-52 Presentation Library
Edition 4.0 the mariner can check ECDIS Chart 1. ECDIS Chart 1 is a legend of the entire set of symbols that may be used within an
ENC and is installed on all type-approved ECDIS systems. See iho.int for further information. ECDIS Systems have been required to
use Presentation Library edition 4.0 since 1st September 2017 and previous editions are no longer SOLAS compliant.
b) ENCs temporarily withdrawn from AVCS

To review a cumulative list of ENCs temporarily withdrawn from AVCS, please visit the ‘Updates’ tab on:
admiralty.co.uk/AVCS
c) ENC Readme.txt file

The README.TXT file located within the ENC_ROOT folder on the latest AVCS discs contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the support tab at admiralty.co.uk/avcs.
This file is updated on a regular basis and should be consulted to ensure that all related issues are taken into consideration.
d) Temporary & Preliminary Notices to Mariners (T&P NMs) in ENCs

The use of T&P NM information is considered an essential part of keeping navigational charts up to date.
The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file in the INFO folder on the service media and at: admiralty.co.uk/ENC-TP-NMs
ADMIRALTY Information Overlay (AIO) shows ADMIRALTY paper T&Ps where they are not already included in the ENCs. Most
countries now include temporary information in their ENCs.
Further guidance can be found in the INFO folder on AIO discs.
e) Important notice regarding AVCS CD Service
From WK14/19, AVCS is only available by download or on the weekly DVDs.

For more information, please contact your ADMIRALTY Chart Agent.
8.1
Wk 26/20
VIII
f) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)
The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.
Email calls to AVCS OUS will receive an auto-response that asks the customer to resubmit their data request online by http. Please
contact your ADMIRALTY Distributor if support is required for use of the http service.
Due to the technology updates at UKHO, the ARCS Online Updating Service was withdrawn in July 2019.
2. ADMIRALTY Products Supporting Digital Navigation

i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.
ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.
iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.
iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.
3. ADMIRALTY Digital Publications (ADP)
ADMIRALTY Sailing Directions: Removal of AIS and Racons

In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as this is held in
greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon information will be removed
from new editions of each Sailing Direction volume, and AIS and Racon information present in existing Sailing Direction volumes will
no longer be updated. For accurate, up-to-date information on AIS and Racons, refer to ADMIRALTY Radio Signals publications.
ADP V19 is available on the ADP Weekly Update DVD.

The UKHO only supports ADP V18 and V19. Users of older versions of ADP should upgrade to a supported version at their earliest
convenience. ADP V18 and V19 are the only versions that allow users to receive tidal updates as they are made available.
ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT

The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.
For information: Please note that there will not be a 2020 ADP release.
Historically we have made new versions of the ADP software available in December of each year however, there will be no commercial
release of ADP this year. Previous versions have been released with yearly updates to tidal data and non-essential bug fixes however, as
tidal data is now updated weekly there is no need for us to release a new version of the software at this time.
The supported ADP versions continue to remain at V18 and V19.
The ADP software and the Data updates can still be downloaded from weekly ADP and AENP Update DVDs.
Users can also download ADP directly on the Distributors FTP Site at ftp://ukho.gov.uk
For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@ukho.gov.uk
8.2
Wk 26/20
VIII
4. Status of ADMIRALTY Digital Services
Update status table
Product Last issue date/Week Reissue Date/Week

i. ADMIRALTY Vector Chart Service (AVCS) Base CD download 04 June 2020 - 23 06 August 2020 - 32
ii. ADMIRALTY Information Overlay (AIO) Base CD 04 October 2018 - 40
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 23 January 2020 - 04 30 July 2020 - 31
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 21 May 2020 - 21
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 23 April 2020 - 17
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 26 March 2020 - 13
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 12 December 2019 - 50 20 August 2020 - 34
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 06 February 2020 - 06 10 September 2020 - 37
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 20 February 2020 - 08
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 17 October 2019 - 42 02 July 2020 - 27
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 18 June 2020 - 25
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 12 March 2020 - 11
23 August 2018 – 34
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts
ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.
5. Supported ADMIRALTY Software Versions
Product Supported Versions

ADP V18, V19
ADMIRALTY e-Reader 1.3
ADMIRALTY Planning Station 3.4
ADMIRALTY gateway 4.2, 4.4
NavPac and Compact Data 3.4, 4.0, 4.1
If you are using an unsupported version, contact your Chart Agent to upgrade to the latest version as soon as possible.
Important notice for users of ADMIRALTY NavPac and Compact Data
Versions 3.4 and 4.0 of ADMIRALTY NavPac and Compact Data 2016 – 2020 will be retired on 31 December 2020 in the following
phased approach:
• 28.05.20 - end of bug fixes and updates to ADMIRALTY NavPac and Compact Data v3.4 2016 – 2020 and ADMIRALTY
NavPac and Compact Data v4.0 2016 – 2020
• 31.12.20 – data expires and end of functionality to do forward calculations for celestial navigation in ADMIRALTY NavPac
and Compact Data v3.4 2016 – 2020 and ADMIRALTY NavPac and Compact Data v4.0 2016 – 2020
• 31.12.20 – end of UKHO Customer Services and Technical support for ADMIRALTY NavPac and Compact Data v3.4 2016 –
2020 and ADMIRALTY NavPac and Compact Data v4.0 2016 – 2020
In advance of the retirement date, users are advised to contact their ADMIRALTY Chart Agent to discuss migrating to ADMIRALTY
NavPac and Compact Data v4.1 2021 – 2025, which is available to order from 28.05.20 and is fully operational, maintained and
supported by UKHO from this date onwards.
During the phased retirement of ADMIRALTY NavPac and Compact Data v3.4 and v4.0 UKHO will continue to provide the current
level of support in place to users, including assistance with resolving queries in using these versions, until v3.4 and v4.0 are officially
retired on 31.12.20. However, no further upgrades will be applied to v3.4 and v4.0 and the versions users are currently using will
remain unchanged.
During the phased retirement, and from 01.01.21 onwards, UKHO will continue to provide Customer Services and Technical support for
users of ADMIRALTY NavPac and Compact Data v4.1 2021 – 2025, and assist users migrating to this version of the software.
8.3
Wk 26/20
VIII
Important notice for users of ADMIRALTY e-Navigator Planning Station and ADMIRALTY gateway
All versions of ADMIRALTY e-Navigator Planning Station and ADMIRALTY gateway will be retired on 29 January 2021 in the
following phased approach:
• 01.05.20 – no new users of ADMIRALTY e-Navigator Planning Station and ADMIRALTY gateway accepted into service
• 29.01.21 – ADMIRALTY e-Navigator Planning Station and ADMIRALTY gateway deactivated, end of availability of
functionality and product updates and user support materials
• 26.02.21 – end of UKHO Customer Services support for ADMIRALTY e-Navigator Planning Station and ADMIRALTY
gateway
During this period UKHO will continue to provide the current level of support to ADMIRALTY Planning Station and ADMIRALTY
gateway users, including chart updates, until the products are officially retired. However, no further upgrades will be applied to
ADMIRALTY Planning Station and ADMIRALTY gateway and the versions users are currently using will remain unchanged.
In advance of the retirement date, users are advised to contact their ADMIRALTY Chart Agent to discuss migration plans and options for
alternative products and services to meet their needs.
8.4
Wk 26/20
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)
Reporting Port Information affecting ADMIRALTY Products
NAME OF PORT
APPROXIMATE POSITION Latitude Longitude
GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.
Number of ships or tonnage handled per

year.
Maximum size of vessel handled.
Copy of Port Handbook (if available).
ANCHORAGES
Designation, depths, holding ground,
shelter afforded.
PILOTAGE
Authority for requests.
Embark position.
Regulations.
DIRECTIONS
Entry and berthing information.
Tidal streams.
Navigational aids.
TUGS
Number available.
WHARVES
Names, numbers or positions & lengths.
Depths alongside.
CARGO HANDLING
Containers, lighters, Ro-Ro etc.
REPAIRS
Hull, machinery and underwater.
Shipyards.
Docking or slipping facilities.

(Give size of vessels handled or
dimensions)
Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
RESCUE AND DISTRESS

Salvage, Lifeboat, Coastguard, etc.
SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)
Fresh water.
(with method of delivery and rate of
supply)
Provisions.
SERVICES
Medical.
Ship Sanitation.
Garbage and slops.
Ship chandlery, tank cleaning, compass

adjustment, hull painting.
COMMUNICATIONS
Nearest airport or airfield.
Port radio and information service. (with

frequencies and hours of operating)
PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.
VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.
ADDITIONAL DETAILS
NOTES:
1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.
2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.
2. Objective of GNSS Data Collection
The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.
It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.
It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.
3. Details required
a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.
b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).
c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.
d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services
For emergency information affecting safety of life at sea forward to: navwarnings@ukho.gov.uk
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@ukho.gov.uk
This form H.102 and instructions are available online: admiralty.co.uk/msi
Date Ref. number

Name of ship or sender IMO number
Address and general locality
E-mail / Tel / Fax of sender
Subject
Position
Latitude Longitude
(see Instruction 2)
GPS Datum Accuracy
ADMIRALTY Charts affected Edition
Latest Weekly Edition of

Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected
Latest update disk applied Week:
Make, model and or age of ECDIS if

applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:
Name of observer / reporter
H.102A submitted Yes No H.102B submitted Yes No
Tick box if not willing to be named as source of this information
Alternatively use our H-Note App located here:

admiralty.co.uk/H-note

26wknm20 Week26 2020

Uploaded by

Copyright:

Available Formats

You might also like

26wknm20 Week26 2020

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

26wknm20 Week26 2020

Uploaded by

Copyright:

Available Formats

Notices

I Explanatory Notes. Publications List

GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS

SEARCHABLE NOTICES TO MARINERS

 Search NMs by - Chart Number only

NOTICES TO MARINERS ON-LINE

FURTHER GUIDANCE NOTES

Our Singapore team can also be contacted outside of UK hours on:

ADMIRALTY NOTICES TO MARINERS

Planning for the future

Admiralty Way, Taunton, Somerset

Find out more about our market-leading

and are trademarks of the Secretary of State for Defence

ADMIRALTY Charts ADMIRALTY Charts

343 AUS 614

COVID-19 (CORONAVIRUS) TEMPORARY EFFECTS ON QUARANTINE REQUIREMENTS,

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 25 June 2020

344 China - Zhu Jiang, Shanban Zhou to Nizhou Tou. 1:25,000 47 78

Includes significant safety-related information as follows: changes to depths,

Note: On publication of this New Edition former Notice 1597(P)/20 is

346 China - Zhu Jiang, Nizhou Tou to Huangpu. 1:25,000 47 78

Includes significant safety-related information as follows: changes to depths

Note: On publication of this New Edition former Notice 1599(P)/20 is

348 China - South Coast , Chiwan Gangqu to Dachanwan Gangqu. 1:15,000 47 78

Includes significant safety-related information as follows: changes to depths.

Note: On publication of this New Edition former Notices 1603(P)/20 and

Includes significant safety-related information as follows: new anchorage

Note: On publication of this New Edition former Notice 2449(P)/20 is

Includes significant safety-related information as follows: new anchorage

Note: On publication of this New Edition former Notice 2449(P)/20 is

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 25 June 2020 (continued)

1990 Mediterranean Sea, Oristano to Arbatax including Golfo di Cagliari. 1:300,000 25 42

Includes general updating throughout.

2241 Baltic Sea, Entrance to the Gulf of Finland. 1:200,000 10 36

Includes significant safety-related information as follows: a new submarine

Note: On publication of this New Edition former Notice 2622(P)/20 is

2248 Baltic Sea, Gulf of Finland Western Part. 1:200,000 11 36

Includes significant safety-related information as follows: a new submarine

Note: On publication of this New Edition former Notice 2622(P)/20 is

Includes changes to depths and coastline.

3172 Oman and Iran, Strait of Hormuz. 1:125,000 40 62

Includes changes to depths, coastline and firing practise areas.

3173 Iran and Oman, Strait of Hormuz Northern Part. 1:125,000 40 62

Includes changes to depths, coastline, harbour installations, wrecks, aids to

Includes significant safety-related information as follows: a new submarine

Note: On publication of this New Edition former Notice 2622(P)/20 is

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 25 June 2020 (continued)

Includes significant safety-related information as follows: a new submarine

Note: On publication of this New Edition former Notice 2622(P)/20 is

Note: This chart remains affected by Notices 5402(T)/19, 134(T)/20 and

Includes updated lines of equal magnetic variation for 2020.

Note: This chart remains affected by Notices 1483(T)/20.

Search NMs by - Chart Number only