Professional Documents
Culture Documents
Daily Trust 9th Dec 2020
Daily Trust 9th Dec 2020
Daily Trust 9th Dec 2020
2,422 DAYS SINCE CHIBOK KEEP DONATING TO THE First Bank – 2028620800 Union Bank – 0045259464 NIGERIA COVID-19 8 NEW CASES TOTAL CASES DISCHARED DEATH
SCHOOLGIRLS WERE ABDUCTED DAILY TRUST IDPs RELIEF FUND
GTB
Jaiz
– 0175835101 UBA
– 0001706242
–1019182505
CASE UPDATE DEC 550 70,195 65,110 1,182
APC to decide on
zoning June 2021
As NEC extends Buni-led c’ttee tenure, grants waiver to Umahi, Dogara
We must respect our pre-merger agreements – Buhari
State, LG, ward excos to serve as caretaker c’ttees
Ex-national vice chair protests expulsion, PDP wants ruling party deregistered P5
President Muhammadu Buhari addresses participants during the virtual All Progressives Congress (APC) National
Executive Council Meeting at the State House in Abuja yesterday. Attorney-General of the Federation and Minister of Justice,
Photo: State House
Abubakar Malami, Gov. Abdullahi Sule (Nasarawa), Gov. Muhammadu Badaru Abubakar (Jigawa) and Chairman APC Caretaker
Committee, Gov. Mai Mala Buni (Yobe), view a document at the meeting, while some state governors engage in chats
Zamfara APC withdraws Judge orders Lalong, Attorney Banditry: Fulani youths
from today’s runoff poll P 38 General to settle 2-yr judges’ benefit P 10 take to carwash in Sokoto P 33
LAGOS EDITION
Wednesday, December 9, 2020
Rabi Al-Akhar 23, 1442 AH
www.dailytrust.com
N200
Vol. 51, No. 88
48
PAGES
2,422 DAYS SINCE CHIBOK KEEP DONATING TO THE First Bank – 2028620800 Union Bank – 0045259464 NIGERIA COVID-19 8 NEW CASES TOTAL CASES DISCHARED DEATH
SCHOOLGIRLS WERE ABDUCTED DAILY TRUST IDPs RELIEF FUND
GTB
Jaiz
– 0175835101 UBA
– 0001706242
–1019182505
CASE UPDATE DEC 550 70,195 65,110 1,182
APC to decide on
zoning June 2021
As NEC extends Buni-led c’ttee tenure, grants waiver to Umahi, Dogara
We must respect our pre-merger agreements – Buhari
State, LG, ward excos to serve as caretaker c’ttees
Ex-national vice chair protests expulsion, PDP wants ruling party deregistered P5
President Muhammadu Buhari addresses participants during the virtual All Progressives Congress (APC) National
Executive Council Meeting at the State House in Abuja yesterday. Attorney-General of the Federation and Minister of Justice,
Photo: State House
Abubakar Malami, Gov. Abdullahi Sule (Nasarawa), Gov. Muhammadu Badaru Abubakar (Jigawa) and Chairman APC Caretaker
Committee, Gov. Mai Mala Buni (Yobe), view a document at the meeting, while some state governors engage in chats
Lagos East by-election: Anxiety Burglars steal millions Two die, five injured
as court hears suit against Abiru P 38 from A/Ibom Govt House P 10 in Ogun road crash P 10
DAILY TRUST, Wednesday, December 9, 2020 www.dailytrust.com
>>PAGETWO
WEATHER Basic protective measures against AFRICAN SAYINGS >>
coronavirus (COVID-19) Cross the river in a
ABUJA KANO
crowd and the crocodile
won't eat you
Wash your hands Maintain social Avoid touching eyes,
SUNNY SUNNY
frequently with distancing nose and mouth (Sierra Leone)
36 20 34 14
MAX MIN MAX MIN
soap and water Source: BBC collection of listeners’ proverbs
35 16 34 14
MAX MIN MAX MIN
ENUGU P/HARCOURT
37 22 27 17
MAX MIN MAX MIN
JOS
SUNNY
30 13
MAX MIN
LAGOS
PARTLY CLOUDY
33 24 Pupils of Jami'yar Matan Arewa Premier School call on government’s attention to the
MAX MIN
Photo: Maryam A-Suka
alarming rate of insecurity in the North, in Kaduna yesterday
(Temperature in centigrade)
NO, Help us
• Media Trust Limited journalists have pledged to uphold the Company’s policy of not asking or taking a gift by
whatever name, from those they encounter in the course of their work.
produce
THANK
• Please assist us by not seeking to influence our reporters and editors with your favours. Where they can, our
journalists are expected to graciously decline a gift. When it is pressed on them, they are expected to declare it. The newspapers
Company will write a letter thanking the giver and donating the amount to charity.
you can
YOU • Report anyone who claims to be our staff, but engages in unethical conduct. To blow the whistle, send an SMS to
08035896941, 08055497449 or an email to whistleblower@dailytrust.com trust
DAILY TRUST, Wednesday, December 9, 2020
abubakaradam@dailytrust.com
3
IN-DEPTH
ANALYSIS
N
igeria may be less than Al-Furqan Juma’at Mosque for a
two years into President courtesy visit on its Chief Imam,
Muhammadu Buhari’s Dr. Bashir Umar and then headed
second term, but the political straight to the Government Tinubu addressing the ulamas
atmosphere is already heating up House, where Tinubu continued
with different permutations for to receive guests for the duration more commitments,” he said.
the 2023 presidential elections. of his short stay. He went further to stress that
Hence, when the National The visit took on a political “We owe a duty to Nigeria; duty of
Leader of the All Progressives colouration when on his way unity, stability and progress. We
Congress (APC), Asiwaju Bola back to the airport and in are not going to say it is going to
Ahmed Tinubu, along with between inspection of some be easy. It is not going to be easy.
Chief Bisi Akande and others, projects completed by his host, It is a challenge. Even with your
touched down in a private jet he first stopped over for the prayers, it’s going to be tough
at the Malam Aminu Kano second time at the Al-Furqan because power is not served like
International Airport in Kano Mosque and then went to visit a menu in any restaurant. Our
State some minutes after 2 pm Alhaji Yusuf Ali, former National founding fathers, our history has
on Friday, December 4, the Chairman of the defunct All shown, that you have to unite
conversation went into a new Progressive Party (APP) at his and fight for it. But Allah (SWT)
gear. residence. Host and visitor asked us not to misuse it, affect
The Governor of Kano State, would later get in the same bus, humanity when you have the
Dr Abdullahi Umar Ganduje, with former Chairman of the opportunity, affect the progress
cancelled an engagement Economic and Financial Crimes Tinubu and Ganduje at the Wedding Fatiha of mankind when you have the
outside the state to wait an hour Commission (EFCC), Nuhu opportunity. Be forthright and
at the airport before the flight Ribadu, sent to fetch the aged Ali. “We will surely compensate very big that fellow Muslims be honest. Between the North
arrived. From Ali’s house, the next you when the right time comes. will see and be proud of so it and the South, our unity is not
With journalists in the stop was at the residence of The executive governor always can be easy for us to market his shaking and we will continue to
governor’s convoy still trying to Sheikh Abdulwahab Abdallah tells us about how close he is to candidature. promote it, we will continue to
decipher the reason for the APC were several other Ulamas were you and that you are a leader “Secondly, I know he is aware of pray for it,” he said.
leader’s visit, the convoy made waiting to receive the former who supports every aspect of his the real challenges ahead of him, He praised the state governor
a stop at Meena Event Centre Lagos State governor. success. We are aware of it and so he needs nothing now beyond Ganduje, saying they had fought
for the wedding Fatiha of Naisa The host, Sheikh Abdallah will surely reciprocate it to you.” prayers and steadfastness to see many battles together and had
Muhammad Bin-Uthman and opened the conversation by the realization of his ambition. put APC together.
Nuruddeen Adam. Naisa is the saying, “Tinubu has surprised us ‘Your Excellency, the So, we will do our best to pray While the promised support
daughter of a popular Islamic all. He has shown that he is a true presidential candidate’ for him to see the fruition of this by the Ulamas was unequivocal,
cleric, Sheikh Muhammad Bin- patriot. We will continue to pray Perhaps, the most ambition.” when journalists asked the APC
Uthman. for him. unequivocal of the speeches was leader to comment further on
“When I was informed about “Your Excellency, the that of Sheikh Abdulgafar Nasir ‘I will return with more the 2023 presidential elections
the wedding Fatiha, I said I must executive governor, we visited Kabara of the Qadiriyya sect, commitments’ based on what transpired with
come because of Bin Uthman’s the President (Buhari) two days who directly referred to Tinubu After the clerics had spoken, the Ulamas, he declined, saying
commitment to promoting to the day a new vice president as a “presidential candidate”. Tinubu addressed them. he was in Kano for a wedding.
unity among Nigerians,” Tinubu will be selected (before the 2015 His words, “Your Excellency, “To the gathering of Ulamas, Less than 48 hours after
told the audience. “Within 24 election). Less than five of us sat the presidential candidate. I am very excited and happy to the visit, the chairman of the
hours of receiving notice of the with Buhari where he told us Your excellency, the executive be here today. Our daughter, Council of Ulamas in Kano State,
wedding Fatiha, I feel I must what they discussed with Tinubu. governor of Kano State, other who just got married, may Allah Sheikh Ibrahim Khalil, who was
come, therefore I informed Gov. We deliberated from night until high profile Islamic scholars here continue to give them happiness also present at the meeting,
Ganduje that I am coming even if the following morning and he present. and joy. Because my attendance addressed the media (this paper
he is not around.” (Tinubu) promised to support “We appreciate you over this brought many memories back excluded) and was reported to
He took the opportunity to whatsoever will favour the North. important visit by the candidate for me; the leaders that I have have said reports of Kano Ulamas
advise Nigerians to work harder “We, therefore, like Tinubu who deemed it fit for him to meet not seen for years, something I supporting Tinubu were untrue
for the unity and oneness of because he is a good Muslim and these scholars in person and did and I have even written off in and such could cause disaffection
the country in the face of the we always need his assistance, solicit prayers from them. This is my mind. among Islamic clerics as they
numerous challenges, the we have nothing to pay him indeed a great honour. “This is a very crucial time have diverse political allegiances
country is currently battling back.” “I have only two things to say. in the history of Nigeria; a very and views.
with. Speaking on behalf of the There is a need for us to know serious intersection. We just While Tinubu himself has been
“The dividers will not stop in Tijjaniyya sect, Sheikh Shehu what he has in mind regarding experienced #EndSARS and silent about contesting the 2023
wanting to break us. They will Maihula told Tinubu that, “When his presidential ambition. He are still facing so much security presidential elections, analysts
not stop at plotting to divide we were struggling to grab power, should know that here in the challenges in our country. think that his visit, though
Nigeria,” he said, adding that we couldn’t do that until we got North, nothing is as important “I have listened to our front officially for a wedding, could
what is more important is the your support. This is still fresh as religion. He should therefore liners, you have spoken. I be an unofficial beginning of his
unity of all the various groups in in our memory and we have not try so much to see that in his am going back with a lot of campaign, should he eventually
the country. forgotten. remaining time to do something excitement. I will come back with declare his ambition.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
4 follow us on Twitter: @daily_trust NEWS
Daily Trust’s Kabir Yusuf Agency acquires equipment to
monitor Nigerians’ calls, messages
elected NPAN president By Idowu Isamotu
T
he Newspaper leaders, saying they have Alhaji Mohammed Idris, their family members’ during former NSO Group employee told
Propr ietors’ laid a very good foundation appealed to government elections. Motherboard that Pegasus had an
Association of Nigeria for the association. in the interim, take the The varsity’s report, titled “awful integration with Circles”
(NPAN), yesterday elected “They have succeeded in newspaper business as ‘Running in Circles: Uncovering and that Circles had “exaggerated
the Chairman of Media getting a secretariat we can educational venture and the Clients of Cyber-espionage their system’s abilities,” according
Trust Limited, publishers of call our own. We are going grant zero tariff on paper Firm Circles’, as published by to the report.
Daily Trust and other titles, to build on that by giving to promote education and
Malam Kabiru Yusuf, as its
president.
the NPAN a very good and
functioning secretariat,” he
constitutional and civic duty
of the media at holding the
Buhari sacks NDE DG, Argungu
Yusuf was elected said. government accountable to By Muideen Olaniyi effect from Monday, December 7,
unopposed at the end While he sought the the people. 2020.
of the 2020 Annual cooperation of all members “NPAN views seriously President Muhammadu Buhari The statement added that
General Meeting (AGM) in steering the affairs of the the steady encroachment yesterday sacked the Director- the supervising minister of the
of the association, held association, he assured that on freedom of the press General (DG) of the National agency, the Minister of State,
at the NPAN’s secretariat, under his leadership the and free speech, especially Directorate of Employment Labour and Employment, had
Maryland, Lagos. association would do its by state actors and urge (NDE), Dr Nasiru Mohammed been directed to nominate
He was nominated by best to advance the course resistance through all Ladan Argungu. an Acting DG from amongst
the outgoing president, of journalism and freedom legitimate means to any A presidential spokesman, the most senior directors
Nduka Obaigbena and the in Nigeria. infringement on press Garba Shehu, in a statement based on competencies and
nomination was seconded He also promised that the freedom and free speech. issued on Tuesday, said the seniority to take over pending
by the publisher of The newly elected executives Likewise, the NPAN holds directive which was given on the appointment of Argungu’s
Source Magazine, Comfort would be very responsive that the right to protest is a Friday, December 4, 2020, took replacement.
Obi. and open to ideas. Yusuf fundamental human right
The publisher of the
Guardian newspaper, Lady
was before his election
as president, the deputy
that must be guaranteed
by the Nigerian state in
Reps summon auditor-general over $36.1m World Bank loan
Maiden Alex-Ibru, emerged president of the association. such a way as to stave off By Balarabe Alkassim failed to show up on Tuesday. His
the Deputy President, while Also present at the AGM violence. representatives led by a Deputy
the publisher of Blueprint were the former governor “That the NPAN in The House of Representatives has Director, Mr Babalola Olanrewaju,
newspaper, Mohammed of Ogun State, Aremo particular, pays deserving summoned the acting Auditor could not explain to the lawmakers
Idris was elected General Olusegun Osoba, who is a attention to media General of the Federation, Mr the rationale behind the loan.
Secretary of the association. life patron of the association education in Nigeria and Aghughu Adolphus, over a $36.1m Chairman of the committee, Mr
Other executives that and the publisher of support the Nigerian facility under the Fiscal Governance Wole Oke, said, “We want to know
emerged are the publisher Vanguard newspaper, Mr Institute of Journalism and Institutions Project of the what the loan was meant for before
of The Nation Newspaper, Sam Amuka, who is also a (NIJ) to achieve the World Bank, to the office. going to sign it. What was your
Walter Edun as Treasurer; Dr life patron and ex-officio stated objective for its The House Committee on Public procurement plan before arriving
Mrs Mwadiuto Iheakanwa member; the Managing establishment, including Accounts issued the summons at its at that figure? Or is it a reward?
of the Champion newspaper Director of This Day an upgrade to a degree public hearing in Abuja on Tuesday. We need to know the programme
as Publicity Secretary, while Newspaper, Eniola Bello awarding media training Adolphus, who had earlier been plan, how you want to utilise the
the Managing Director of and the Editor-In-Chief of institution in the future,” the invited by the committee, had loan.”
Daily Times, Fidelis Anosike, Vanguard Newspaper, Mr communique reads.
emerged Assistant Secretary
of the association.
Gbenga Adefaye, among
others.
NPAN urged the Federal
Government to rise up
Lawan advocates stiffer penalty for rapists
Also, the publisher of to its responsibilities of By Abdullateef Salau Tallen, in Abuja.
the Nigerian Pilot, Prince Revive newsprint protecting of life and "Last year, the incidents of
Dennis Sami; publisher factories, Newspaper property by stamping out Senate President Ahmad Lawan, rape were rampant but thank
of Leadership newspaper, owners ask FG terrorism, banditry and yesterday, said there is the need God it is coming down and I
Sam Nda-Isaiah and Ray Meanwhile, NPAN, urged kidnapping. for concerted efforts to protect believe that the consequences
Ekpu, a past president of the the Federal Government to Commenting on the women and girls from sexual on anyone involved in rape
association were nominated make a conscious effort to COVID-19 pandemic, the predators. must be extremely punitive and
without opposition as ex- revive the non-functioning communique called on the He, therefore, called for stiffer prohibitive.
officio members. newsprint factories in the FG to make aggressive effort penalties for convicted rapists. "Because if you educate or
The outgoing president, country. to procure the vaccines from He made the call in a speech empower a girl it is like you
Obaigbena was also elected A communiqué issued whatever sources as may after he was presented with an educate the nation. The reverse is
as life patron. at the end of the meeting, be available and vaccinate award of HeForShe by a group also the case. If you destroy one it
In his speech, the newly signed by the newly elected citizens against the deadly of women led by the Minister of is like destroying the nation,” he
elected NPAN president, President and General disease. Women Affairs, Dame Pauline said.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
NEWS follow us on Twitter: @daily_trust 5
APC to decide on zoning June 2021
By Ismail Mudashir, Muideen Olaniyi & NWC members of NEC. privileges accruable by virtue of
Saawua Terzungwe NEC, therefore, donated their membership of the party.
its powers as enshrined in So, they will be able to contest
T
he ruling All Progressives Articles 13.3 Subsection 5 for positions in the party. They
Congress (APC) will and 13.3 Subsection 6 of the will be able to contest elections
decide on which part of APC Constitution to the Buni without any requirement of
the country will produce its committee. being members for a number of
presidential candidate for 2023 Governor Akeredolu who years or period of time,” he said.
in June next year, sources in the spoke on the matter said the The two big defectors are seen
party told Daily Trust yesterday. dissolved excos at other levels in many quarters as formidable
One of the sources said if the would continue to serve in their forces that would shape the 2023
North gets the slot of the national respective offices in a caretaker politicking.
chairman of the party during committee capacity “until we “If the APC decides to take the
the national convention of the complete party registration and presidential ticket to the South
party, the South will produce the conduct congresses.” East, Umahi will definitely be
presidential candidate and vice handy and if the ticket goes to
versa. My expulsion a nullity the South West where the likely
An emergency virtual National The NEC also approved candidate will be a Muslim, then
Executive Committee (NEC) the expulsion of former APC Dogara could be considered,” a
yesterday extended the lifespan National Vice Chairman, South- source said.
of the Governor Mai Mala Buni- South, Ntufam Hilliard Eta, for “But all these would depend
led 13-member APC Caretaker/ flouting the directives of NEC to on what would happen between
Extraordinary Convention discontinue all litigations against now and 2023 and you know
Planning Committee (CECPC) the party and its members. politics is fluid, and that is why
by six months. The timeline However, Eta said his you are hearing names like El-
given the caretaker committee Gov Mai Mala Buni expulsion from the party was a Rufai, Fayemi, Tinubu, Zulum,
will expire on December 25, but committee had succeeded in convention before the 30th of nullity. “I am already in court. Lalong and all that,” he said.
the NEC extended it for another bringing the new atmosphere June 2021 by the grace of God.” The lawyers amongst them
six months period that would of hope to the party and urged should have told them that they We’ll continue to do our best
terminate on June 30, 2021. party members to collectively Beyond the surface can’t make that pronouncement Governor Buni, while
Among other issues, the work towards the sustenance of Our correspondents could not since I am in court. speaking during the NEC
reason given by the party was peace. establish whether the president “Their action is a nullity meeting said they did a lot in
for the committee to complete “Healthy debates are now had “categorically” mentioned because it isn’t even the NEC reconciling warring factions.
membership revalidation and taking place and the potential the issue of zoning as part of the of the party that met. Their so- He said: “Tempers within
registration of new members, for organs of the party to affirm agreement, but a source at the called acting national secretary our party have substantially
but competent sources said the the majority positions as the meeting said it was part of it. has no power to convene NEC,” come down although the works
window will most importantly decision of the party is now Recalled that the Minister of he said. Eta in a suit he filed on of our various reconciliation
afford the party opportunity possible,” Buhari said. Works and Housing, Babatunde November 26, 2020, through his committees are yet to be
to resolve contentious issues “What is required now is for Raji Fashola had recently said lawyer, Onyechi Ikpeazu (SAN) concluded. While progress is
zoning inclusive. all of us as leaders of the party to there was a zoning arrangement, is challenging the dissolution being recorded by our respective
“This is partly why President maintain discipline and ensure urging that it should be respected of the Comrade Adams reconciliation committees,
Muhammadu Buhari in his that this new momentum is on the expiration of President Oshiomhole-led NWC which he the task of reconciliation
remarks at the NEC meeting protected, sustained and the Buhari’s tenure in 2023. was part of. should be continuous, the
harped on healing wounds, decisions of party organs are A close ally of the president He also asked the court for an NEC may therefore wish to
mending fences and respecting respected by every member. who was part of the formation order of injunction to restrain review development and direct
the free-merger agreement “May I use this opportunity of the APC told Daily Trust that the caretaker committee of the accordingly.”
reached by those behind the to remind all of us of the need there was an agreement on APC from running the party. He added that almost
formation of the APC,” another to recreate our negotiation the zoning. A source in the party said the all pending cases in courts
source said. He said the issue of secret of 2012, 2013 under our The APC was formed in litigation by Eta and others could instituted by members had been
which part of the country should legacy parties, what guided our 2013 following the merger of throw sand into what the party withdrawn to create “neutral
produce the APC’s flag bearer success to achieve the merger the Congress for Progressive was doing to galvanise forces ground’’ for discussions, while
was threatening the existence of that produced the APC was the Change (CPC), Action Congress ahead of 2023. a time table for membership
the party as the second tenure of respect we were able to have for of Nigeria (ACN), All Nigeria “I think he has a case and registration and revalidation
Buhari eats deep into the second each other. Peoples Party (ANPP), a faction the party must act fast because, exercise will be released after the
year. “In those times, decisions of the All Progressives Grand in the eye of the law, someone initial sensitization.
“While there are sources that reached both formal and Alliance (APGA) and the new with a superior argument could The PDP yesterday asked
believe APC leaders from the informal consultations were PDP. have his way. Eta might likely the Independent National
North can use the numerical respected. We trusted initiatives The president’s ally, who does be working in cohort with other Electoral Commission (INEC)
strength of the region to hold on taken and believed that they not want to be named, said the people to ensure instability to deregister the APC and recall
to power, those in the South feel were required to produce the agreement was reached before in the party. He might also be its certificate of registration
it would amount to a betrayal needed political platform the merger process was sealed. working towards enforcing his because it allegedly had no
of trust if the North did not that could guarantee electoral “The agreement was fundamental human rights operational structures as
reciprocate what was done to victory. Every one of us as leaders informally reached between the but the party must resolve required by law.
them in 2015. ensured that those decisions then ACN and CPC with Buhari the impasse to avert collateral The party in a statement by
“The extension of time for were respected,” the president and Asiwaju in attendance. damage,” he said. its National Publicity Secretary,
the Buni-led committee is said. There were four persons from Kola Ologbondiyan also asked
honestly beyond membership While briefing State House each side. It was a serving Waivers for Umahi, Dogara INEC to declare the seats of
registration…The major issue reporters after the NEC meeting, minister from the North that The NEC meeting also all lawmakers elected on the
is the sharing formula without Governor Nasir El-Rufai of first raised the issue. Then it yesterday granted waivers to platform of APC at the federal
causing an unnecessary Kaduna State in the company was agreed that Buhari should those who had joined the party and state levels vacant and
distraction. And even if the of Governors Rotimi Akeredolu fly the ticket and afterward, the and those wishing to follow suit commence the process of the
North agrees to hands-off, we (Ondo), Hope Uzodinma (Imo), power will shift to the South, in the nearest future to be able by-election to fill the seats “as
have to agree on which part and Secretary of the CECPC, Sen. specifically South-west,” he said. to contest for positions in the required by law.”
of the South should have the John James Akpanudoedehe State, LG, ward excos to serve party and elections without any “The APC being overburdened
presidential candidate. said the national convention as caretaker c’ttees requirement of being members by the weight of failure,
“There are those who believe where new party leaders would Yesterday’s NEC also approved for a number of years or period humongous corruption as well
it should go to the South West. emerge would hold after the an immediate dissolution of of time. as the plagues of economic
There are those who believe revalidation of registration and the party organs at the polling Governor David Umahi of recession, violence, killings
it should go to the South East, membership of party members units, wards, local governments, Ebonyi State recently joined and hardship, it has brought
and some people are saying the that would soon start. states and zonal levels as well the party from the Peoples to our people, forcefully exited
South-South should be given “Since we undertook our as the non-National Working Democratic Party while a itself from the nation’s political
a chance, but it all depends on last membership registration Committee (NWC) component former Speaker of the House of firmament by dissolving all
the disposition of the Villa,” the in 2015, about 25 million have of the NEC. Representatives, Yakubu Dogara its national, zonal and state
source said. reached the age of 18 and may The meeting thereafter also returned to the party from structures,” the PDP said.
want to join the party. So, we approved the immediate PDP. But the APC in a statement
We must respect pre-2015 want to capture those (people) reconstitution and composition El-Rufai said the waivers by its Deputy National Publicity
agreements and then after we complete of the dissolved excos to serve given to them formed part of the Secretary, Yekini Nabena, said,
In his remarks during the the registration, we will have in their respective offices in a resolutions of the meeting. “The PDP leadership has gone
NEC meeting, President Buhari congresses at various levels, caretaker committee capacity “By this, such new members senile”, adding “it is a beer
said the Buni-led caretaker leading up to the national with the exclusion of the non- will enjoy all the benefits and parlour rant.”
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
6 follow us on Twitter: @daily_trust NEWS
Court rejects Maina’s request, Nigeria’s population now 206m –NPC chair
continues trial today By Francis Arinze Iloani conducted a census in the to hold a census in 2021 and
By Hamisu Kabir Matazu the last proceeding brought back in court. last 14 years, thereby relying 2022.
that Maina attended He further said The National Population on population estimates. He said the EAD being
The Federal High Court was on September 29, the former counsel Commission (NPC) has said The NPC had estimated the held across the country
in Abuja has rejected until he was produced to the defendant was that Nigeria’s population country’s population at 198 was in preparation for the
the request by a former in court on December expected to hand has been estimated at 206 million in 2018. census.
chairman of the defunct 4, after he was arrested over the records at million for 2020. “In the absence of an He disclosed that 260 local
Pension Reform Task based on the warrant his disposal to the The Executive Chairman actual census, we formally government areas out of the
Team, Abdulrasheed issued by the court. counsel that newly of the commission, Nasir do projections and we have 774 in the country had been
Maina, for an adjournment Abang said Maina took over Maina's Kwarra, stated this in all along been doing our demarcated.
to prepare for his defence. had on his own case. Abuja on Tuesday while projections and we estimate The NPC boss said the
Justice Okon Abang jumped bail, so his The judge announcing the start that as of 2020, the estimated 11th phase of the EAD,
ruled that the request was right to fair hearing dismissed the of the 11th Phase of population of Nigeria is 206 which would begin on
a ploy to waste the judicial was not breached, and counsel’s application the Enumeration Area million,” he said. December 9, 2020, and end
time of the court. his trial had continued for re-adjournment Demarcation (EAD). Kwarra said the on January 20, 2021, would
The judge had on in absentia before and ordered that the Daily Trust reports commission was hopeful of be conducted in 95 LGAs
December 4, 2020, he was arrested and trial continue. that the country has not a presidential proclamation across the country.
adjourned the case
involving N2bn money
laundering to Tuesday $EXMD.DQR0DLGXJXUL/DJRV
based on a request by
Maina’s new lawyer, Mr
Adaji Abel.
Abel had pleaded that
the counsel needed more
time to study the case.
Earlier, the prosecution
counsel of the EFCC,
Farouk Abdullah, was
about inviting the ninth
prosecuting counsel,
Rouquaya Ibrahim, to
continue her testimony
when the defence lawyer
raised an objection.
He said in the previous
proceeding, he applied for
the court's record needed
by the defence to continue
with the case, via a letter
sent to the registry but he
was yet to get the record
from the registry.
Opposing the
adjournment application,
the EFCC prosecuting
counsel, Abdullah, said
Maina had been given
the opportunity to defend
himself but he refused to
utilise it.
In his ruling, Justice
Abang dismissed the
application, noting that
Yobe to support NUJ’s quest for effective journalism Buni congratulates Senate
present administration to
prioritizing ttraining and President on Zik prestigious
retraining of journalists
for efficiency.
The commissioner
award
commended members of
the NUJ family for leading
by example during their
Y obe State Governor
Mai Mala
has congratulated the
Buni
He described the
president of the Senate as
a “worthy ambassador of
elections, describing president of the Senate, the state that makes the
the sportsmanship Ahmad Lawan, for the state and its people so
they exhibited as 2019 Zik Prize in Political proud”.
commendable. Leadership awarded to He urged Senator
“I was excited with him in recognition of his Lawan to see the
the peaceful conduct of leadership qualities. award as a source of
the elections. NUJ as a
watchdog of the society Governor Buni encouragement to
has set an example, described the award as continue with his good
especially that those well deserved in view of leadership style.
who could not win his leadership style over The Senate president,
New Yobe NUJ Chairman Rajab Muhammad (left standing) speaking during a courtesy visit to cheerfully congratulated the years. who dedicated the
the State Information Commissioner Abdullahi Bego in his office in Damaturu yesterday the winners,” the “The president of the award to his colleagues,
commissioner said. Senate had consistently said the ninth assembly
T he Yobe
Commissioner
Information,
State
for
Home
to visit him at his office in
Damaturu.
The commissioner said
retrofitting the state-
owned media houses,
the Yobe Broadcasting
The NUJ chairman,
Comrade Rajab
demonstrated good
leadership qualities at
had remarkably
risen above partisan
Mohammed, said they
Affairs and Culture, Hon. the state government, Corporation (YBC) and all levels in the national differences to form a
were at the ministry on
Abdullahi Bego, has under the able leadership the Yobe State Television assembly. bond that is committed
of Governor Mala Buni, (YTV) within his short a thank-you-visit over
assured that the state “His leadership as to the progress and
government will support believes in sharing stay in office,” Bego the supports given by
the commissioner which, Senate President has development of Nigeria.
the Nigerian Union of credible information stated.
Journalists (NUJ) in its that would make people He assured the he noted, helped in the stabilized the system “I consider the award
quest for sanitizing and abreast of government chairman that the peaceful conduct of the through purposeful as a further call to duty,
rejigging the journalism activities, hence the role renovation of the NUJ association’s election. legislation and not just from a personal
profession in the state. of media is paramount. secretariat awarded by The chairman progressive cooperation point of view but on
Bego gave this “His Excellency Hon. the state government enumerated training and between the legislative behalf of the Senate of
assurance when the newly Mai Mala Buni is a media- would be completed and retraining, discipline, and executive arms of
friendly governor. provided with the needed and commitment to duty the Federal Republic of
elected state chairman government to serve
of the NUJ, Comrade “We are all living facilities. as some of the areas that Nigeria and the National
Nigeria better,” Governor Assembly in general,”
Rajab Mohammed, led witnesses to how he Bego restated the would receive attention Buni said.
members of his executive injected funds towards commitment of the during his tenure. Lawan said.
+LV([FHOOHQF\'U$EGXOODKL8PDU*DQGXMH2)5
([HFXWLYH*RYHUQRU.DQRVWDWH
0XOWL&LW\&KDOOHQJH$IULFD
LQFROODERUDWLRQZLWK
WKH8QLWHG1DWLRQV'HYHORSPHQW3URJUDPPH81'3
WKH*RY/DE1HZ<RUN8QLYHUVLW\WKURXJKWKH
2IÀFHRIWKH6SHFLDO$GYLVHUWR.DQR6WDWH*RYHUQRURQ6'*V
SUHVHQWV
7ZRFKDOOHQJHVWRLPSDFW\RXUFLW\
DVSHFLDOFRPSHWLWLRQRQKRZWRLPSURYH
.DQRSRVLWLYHO\
7KHWZRFKDOOHQJHVDUH
:KDWFDQ\RXGRWRUHGXFHWKHJHQHUDWLRQRIZDVWHDQGWKHPDQDJHPHQWRIZDVWH"
:KDWFDQ\RXGRRQEXLOGLQJXUEDQ5HVLOLHQFHLQVOXPVDQGLQIRUPDOVHWWOHPHQWV"
+RZZRXOG\RXVROYHWKHVHSUREOHPVDWWKHORZHVWDQGPRVWDIIRUGDEOHFRVWLQWKHVKRUWHVWWHUP"
'RQ¶WEHOHIWRXWDV\RXULGHDVFDQPDNHDGLIIHUHQFH
6XSSRUW*RY*DQGXMH
VHIIRUWVLQPDNLQJ.DQRDFOHDQUHVLOLHQWDQGVXVWDLQDEOHFLW\WROLYHDQGZRUNLQ
0DNH\RXULPSDFWDQGSDUWLFLSDWHRQRUEHIRUHWKRI'HFHPEHU
E\YLVLWLQJRXUZHEVLWH:::$)5,&$08/7,&,7<&+$//(1*(25*
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 9
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
10 follow us on Twitter: @daily_trust NEWS
Burglars steal millions from A/Ibom Govt House
and emptied the contents of a but they refused to share it to When contacted, the The Commissioner for
From Iniabasi Umo, Uyo
‘Ghana-must-go’ bag in which the people it was meant for. governor’s media aide, Mr Information and Strategy, Mr
R
obbers have invaded the money was kept. The thief came in the night, Ekerete Udoh, declined to Ini Ememobong, attributed
the Akwa Ibom State The incident was not the destroyed the keys and gained comment on the incident but the rising insecurity to the low
government house and first theft recorded in the access to the office of the assured that those to be paid morale among policemen.
carted away money running government house press secretary to the CPS." would get their money. The Police Public Relations
into millions. centre. Some months ago, It was learnt that except Meanwhile, residents of Officer, SP Odiko MacDon,
Inside sources said the three flat-screen television at the entrance of the Uyo, the Akwa Ibom State however, assured that the
robbers burgled the office of sets were stolen. government house, no capital now live in fear over police would get to the root
the secretary to the governor’s A source said: "The money security camera was installed rising insecurity, with robbery of every issue reported by
media aide, Mr Ekerette Udoh, came in yesterday afternoon at the centre. attacks recorded daily. members of the public.
=$0)$5$67$7(
$//352*5(66,9(6&21*5(66
2I¿FH$GGUHVV%\H3DVV2SS)HGHUDO6HFUHWDULDO*XVDX
(PDLODSF]DPIDUD#\DKRRFRP
7KH5HVLGHQW(OHFWRUDO&RPPLVVLRQHU 'HFHPEHU
,1(&
*XVDX
=DPIDUD6WDWH
'HDU0DGDP
5(WK'(&(0%(5%$.85$/2&$/*29(510(17
67$7($66(0%/<6833/(0(17$5<(/(&7,21
$
VWKHQDPHLPSOLHV,1(&LVVXSSRVHGWREHVHHQLQZRUGVDQGDFWLRQVWREHSHUIRUPLQJLWVFRQVWLWXWLRQDOUROH
RIDQXQELDVHGHOHFWRUDOXPSLUHLQHYHU\HOHFWLRQZLWKRXWIHDURUIDYRUPDOLFHRUMDXQGLFH6LPLODUO\WKH
6HFXULW\$JHQFLHVHVSHFLDOO\WKH1LJHULDSROLFHIRUFHDUHVDGGOHGZLWKWKHUHVSRQVLELOLW\RIVHFXULQJHOHFWLRQ
VRWKDWLWZLOOEHIUHHDQGIDLU
7KHUROHRIWKHVHWZRFULWLFDO6WDNHKROGHUVLH,1(&DQG6HFXULW\$JHQFLHVLQWKHFRQGXFWRIWK'HFHPEHU
%DNXUD/RFDO*RYHUQPHQW6WDWH$VVHPEO\%\H(OHFWLRQZKLFKFXOPLQDWHGLQWRUHUXQKDGOHIWPXFKWREHGHVLUHG
HVSHFLDOO\RQRXUSDUWWKH$OO3URJUHVVLYHV&RQJUHVV
7KHVDGVFHQHVZKLFKOHIWVFDUVRQWKHSDUWRILQQRFHQWHOLJLEOHYRWHUVDFURVVWKHSROOLQJXQLWVDQGYRWLQJ
SRLQWVGLGQRWUHÀHFWWKH&RQVWLWXWLRQDOUROHRI,1(&DQGWKH6HFXULW\$JHQFLHV
'HVSLWHRXUSOHDVDQGDSSHDOVIRUDPHQGPHQWVLQWKHUXOHRIHQJDJHPHQWE\,1(&DQGWKH6HFXULW\$JHQFLHVLQWKH
WK
EXLOGXSWRWKH 'HFHPEHU6XSSOHPHQWDU\(OHFWLRQLQWKH,1(&VHOHFWHGSROOLQJXQLWVDWWDFKHGOHWWHUVWR
WKDWHIIHFWQRWKLQJKDVFKDQJHGIRUWKHEHWWHU
,QWKHVDPHYHLQWKHVRFDOOHG6WDNHKROGHUVPHHWLQJRUJDQL]HGE\,1(&LQLWV*XVDX=DPIDUD6WDWHRI¿FHRQWK
'HFHPEHUDQGDWWHQGHGE\RXUUHSUHVHQWDWLYHVDVSDUWRISUHSDUDWLRQLQUHVSHFWRIWKH6XSSOHPHQWDU\
WK
(OHFWLRQVODWHGIRU 'HFHPEHUWKHUHZDVQRSUHVHQFHRIDQ\RIWKH6HFXULW\$JHQFLHVLQWKHVDLGPHHWLQJ
ZKLFKZDVDQLQGLFDWLRQWKDWQRIXUWKHUVHFXULW\PHDVXUHVZHUHWDNHQWRIRUHVWDOOWKHXQIRUWXQDWHKDSSHQLQJVWKDW
WK
FKDUDFWHUL]HGWKH 'HFHPEHUH[HUFLVH
7KDQNV
<RXUV
< I
IDLWKIXOO\
O
<RXUVIDLWKIXOO\
$OK
$OK 6DQL 0XVD 7
$OK6DQL0XVD70DIDUD
6HFUHWDU\$3&=DPIDUD6WDWH
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 13
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
14 follow us on Twitter: @daily_trust
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 15
DAILY TRUST, Wednesday, December 9, 2020
16 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
e-mail opinion@dailytrust.com
OPINION
THE WHITE PAPER Weakening of the Naira: A
Suleiman A. Suleiman
lesson for the next government
Twitter: @amusule1 (07066451983 SMS only) By Dr Nasir Aminu the charter by International Monetary
Fund (IMF) for its members to refrain
A
s opined by Blinder, central from “controlling exchange rates to
W
ho, precisely, is President approach, and we can agree that it The CBN operates a dual exchange
money and ideas, perhaps the three
Muhammadu Buhari? Or requires more than previous banking rate market following that it adopts one
most important skills a president actually
more appropriately, what is experience to lead the institution. The of the three regimes above, namely: the
needs to govern. The results are now bare
Buhari? The two questions are important current Central Bank of Nigeria (CBN) official currency market and the parallel
for all to see. After six years in Aso Rock,
for Nigeria today, and for the future, governor has not been successful in currency market. The parallel market
Buhari has not solved a single one of
because political leaders are judged not implementing a naira regime since is designed for every transaction in
Nigeria’s major problems, which is the
only by their personal traits and style he was appointed in 2014. One will the economy except those classified
real job description for presidents: to
of leadership, that is, who they are but not disagree that he met an inefficient under ‘official’. On average, the parallel
solve the major problems bedevilling the
also what they represent to the country and complicated currency system, and currency rates are 20 percent above the
society they lead.
and the people they lead. The two feed has not been successful in solving the official market rate. The rates are set
In his barely three years as president,
into and reinforce each other, of course, existing issues. based on bids from the (un)liberalised
to give just one example, Yar’adua solved
since what a leader represents is in part a The persistently low oil prices have Bureau de Change operators, who are
two, if not three, of Nigeria’s big problems.
consequence of who they are. limited the inflow of foreign exchange an additional burden to the system. The
His Presidential Amnesty Programme
For many Nigerians today, there is a into the Nigerian economy. It has official market is designed for special
brought conflict and militancy in the
simple answer to the question ‘who is created a hole in the country’s budget, purposes like paying for medical bills,
Niger Delta to a meaningful end. He
Buhari’? Millions of Nigerians believe given the sector accounts for about 65 tuition fees, religious pilgrimage, and
also ended Nigeria’s cycle of illegitimate
the outlandish claim that the President percent of the government’s revenue. imports for specific items.
elections, the worst of them being the
is a Sudanese clone, or that he is ‘Mr Go The coronavirus pandemic has added The implementation of these
very one that brought him to power. But
Slow’, for his snail-like style of leadership, to the problem, which has pushed multiple regimes is significantly costly
he promised to end the cycle, and he did.
or that we must distinguish between two the country to obtain several types for the apex bank and the commercial
The reforms he started in our electoral
very different versions of the same man: of external loans and funding, as the banks. It can also be an avenue for
system has no parallel in Nigerian history,
Buhari, the candidate (Daura Buhari) and viable way to fund its budget. It is not illegal round-tripping. The system is
and they remain robust to this day. His
the president (Abuja Buhari). a secret that the government has been unclear and complicated. It is creating
salary increases for workers consolidated
But what is Buhari? In my view, borrowing to fund growth after the confusion for foreign investors,
the expansion of the middle-class that
President Buhari represents a confluence 2016 recession. It has been weakening external lenders, and Nigerians who
had started under his two immediate
of two cultural and personal influences its currency as pressure from remit money from abroad. In April,
predecessors.
that give his government its peculiar concessionary lenders mount. In the after getting the approval for the IMF
No one in Nigeria has benefited from
character. The first is Buhari’s absolutist private sector, remittance from abroad emergency funding, the governor
these things than Buhari himself. Without
claim to superior moral purity over his has also declined. Remittance is second promised to unify the country’s
peers. No Nigerian leader, alive or dead, to oil revenue and more than foreign exchange rates, but no action has been
direct and portfolio investments in the taken since then.
has put so much political store in their Unfortunately for Nigeria, country. Currently, the country is faced with
own sense of moral purity and superiority
over others than Buhari. the president’s claim to moral The weakening in the value of the a persistent shortage of dollars in the
naira is a response to the declining official and parallel currency markets.
For 16 years, the President’s entire superiority over his peers oil prices, the pressure from external The government is also looking for
campaign was based on a single sentence:
‘I have more integrity than everyone else, intersects with a deeply lenders, and shortages of the US other avenues to increase the foreign
dollar. The weakening of the naira exchange inflow. Like the unpopular
therefore, I am the most qualified to lead’. entrenched cultural attitude, was called depreciation by the CBN, CBN policy of ensuring export sales
And all through those long campaign
years, he rammed this claim through particularly in northern Nigeria, while Goldman Sachs claimed it is a are repatriated and sold at the official
devaluation. The two names are used market rate. Overall, one can assume
the public mind again and again until it that sees virtue in a lack of means. to differentiate what type of currency the country is not willing to spend
acquired the social power of folklore or
myth. Now as President, he wears it as a I don’t know how it arose, but regime a country is adopting. Thus, a its foreign reserve to manage-float
wide confusion about who to believe its currency. It means the naira must
badge. It is what Buhari sees in himself in northern Nigeria, poverty is regarding what currency regime the be weakened to a level that it is
and the only thing he invites others to see
in him. regarded as a virtue in and by CBN is adopting. able and willing to support with its
Every country manages its currency, foreign exchange reserves. This is why
Worse still, it is the only thing Buhari itself. ‘I am poorer than you, usually through its central bank, Goldman Sachs reported the news of
sees in others as well. This is why the
President has hardly ever accepted therefore God is automatically in the foreign exchange market by devaluation. However, the timing and
that any Nigerian leader before him, or adopting one of the three exchange the extent to which the CBN weakens
any aspiring leader for that matter, has
on my side, not on yours’. This regimes: fixed exchange rate regime, the naira is increasingly uncertain in
ever done anything right. Where the is nonsense, of course, but it has floating exchange rate regime, and the financial markets.
The effects of weakening the naira
late President Yar’adua openly stated managed floating regime. If the CBN
that former President Obasanjo did
helped ensure Buhari’s firm grip on were operating the fixed exchange rate include more expensive imported
his best, even at a time when saying so northern political imagination at regime, they would use devaluation goods. In an ideal world, this should
was unpopular, Buhari’s view is that all and revaluation as the official changes discourage imports into the country.
previous leaders ‘destroyed’ the country.
the moment to value the naira relative to other For Nigeria, weakening the naira will
Everyone but himself is morally tainted. currencies. This type of regime was only increase its current account deficit
the sanity in the electoral system, he
Unfortunately for Nigeria, the Nigeria’s foreign exchange system until due to heavy reliance on imports and
would not be president today. Without
president’s claim to moral superiority 2016. the unpopular policy on export sales.
the peace in the Niger Delta, Nigeria
over his peers intersects with a deeply If the CBN were operating a floating By increasing the import prices and
would be completely ungovernable now.
entrenched cultural attitude, particularly (flexible) exchange rate regime, the leaving the demand for domestic
Without a larger middle-class to cushion
in northern Nigeria, that sees virtue market forces would be allowed to products unchanged, weakening the
the harsh effects of the terrible economic
in a lack of means. I don’t know how it generate changes in the value of the naira will provoke inflation in the
policies of the last five years, the whole
arose, but in northern Nigeria, poverty naira, as the naira depreciated or country. Theoretically, the CBN could
country would have been in #EndSARS
is regarded as a virtue in and by itself. appreciated. The CBN adopted this raise interest rates to control inflation
mode.
‘I am poorer than you, therefore God is currency regime in 2016 and is still at the cost of slower economic growth.
But what has Buhari done so far to
automatically on my side, not on yours’. recovering from the bitter experience, However, subsequent open-market
consolidate and build upon these? Your
This is nonsense, of course, but it has including the speculative attacks on operations conducted in the past four
guess is as good as mine. However, to
helped ensure Buhari’s firm grip on the currency by domestic and foreign years did not mitigate this issue. It left
make sure, I will spell mine: little. There
northern political imagination at the investors. the economy to bear a higher interest
is not much to say for Buhari’s leadership
moment. There is also the managed floating rate for bonds.
about unemployment, or mass poverty, or
Yet, the claim rests on shaky grounds. currency regime, which is similar to the Finally, a solution for these problems
decayed infrastructure, or rising fuel and
The man was a military head of state, floating exchange rate regime, but with requires a good understanding of the
food prices, or corruption, and absolutely
one who, in fact, came to power through a lower degree of flexibility. In 2019, the existing system by the policymakers.
not about Boko Haram and insecurity.
a coup. But a coup that upturns the CBN was reported to be adopting this An independent central banker, who
Yet, the president continues to
will of a people freely expressed in an system. Under this regime, the Central can commit to adopt one currency
be insulated by his feeling of moral
election, however imperfect the election Bank regularly intervenes in the foreign regime, is required. It means we have
superiority over everyone else. ‘It is not
might have been, is the worst form of exchange market to change the floating to wait for the next government to work
my fault if everyone does not do their
corruption, ever. He who steals the will direction of the naira, and to support on this.
jobs as well as I am doing mine’, the
steals everything. president seems to be saying in response its balance of payments during volatile
Even more, unfortunately, this weird periods. This type of regime is also called Dr Nasir Aminu is a Senior Lecturer
to all genuine cries for attention. Rome is
conception of virtue also intersects a dirty float exchange rate regime. The of Economics at Cardiff Metropolitan
burning to the ground, but all that Nero
with a limited ability to manage people, name might have been derived from University.
sees is the purity of his own inactions.
DAILY TRUST, Wednesday, December 9, 2020
I
“YES”.
n 2020, a statistical finding from the unemployment rate is synonymous system is at its worst moment and it’s never The notorious kidnappers
International Labour Organisation, with increased insecurity and poverty, a too late to pay attention to education as it usually storm the community
an agency of the United Nations situation that is also seen as a ticking time will change the whole narrative especially at their pleasure, brandishing
developing policies to set labour bomb. that which says ‘education is a scam’. dangerous weapons and
standards, says the estimated youth Coincidentally, Nigeria’s unemployed Quality education will be a foundational attacking people. They shoot
unemployment rate in Nigeria was at youth of 13.1 million is more than the progression for a lasting solution to sporadically, scare law-abiding
almost 14.2 percent. population of Rwanda and several other Nigeria’s unemployment misery. Our citizens and kidnap their
You may wonder why the percentage African countries. Youth population is vocational schools should be put under victims.
rate for youth unemployment is this also about 64 percent of total unemployed close watch as it was one of the reforms Rigasa, the once lively
small. Well, this is because the percentage Nigerians, suggesting that the most that countries like China, Japan, Korea and burstling community, is
of the unemployed in the age group of agile working-class population in the and India built on to compete with the today at the mercy of bandits.
15 to 24 years was the main focus as country remains unemployed. This is the western countries. If this is done, the The reign of terror visiting
compared to the total labour force. dilemma we face and severally, so many private sector will have to play a role on the peaceful community
In Nigeria, youth unemployment policies have been suggested and even in job creation as there will be enough by rampaging kidnappers
rates are often higher than overall put into action, yet, Nigeria struggles to skilled labour to help foster economic has forced many businesses
unemployment rates. The general rate meet the demands of the youths. and industrial growth. to close. The little ones who
of unemployment was approximately six It is another thing to initiate a policy, More so, policies and models should be summoned courage to stay
percent in 2018. A major reason for this project it, and yet it doesn’t meet the put in place by the government to enable and operate are living in
contrast is that many of the youths under demands and expectation of the people the private sector to create a friendly and apprehension.
age 24 are studying full-time and are it is meant for. enabling environment for businesses. Many people think that
unavailable for work due to this. It is high time government developed This will foster true capitalism rather with the train station located
Similarly, another data reveals that a long-term initiative or reform that will than a monopolised capitalist system we in Rigasa, adequate security
youths’ unemployment rate in Nigeria serve as a blueprint for other government see today in Nigeria. would be deployed or beefed
as at the second quarter of 2020 is 27.1 to come and other contemporary society. The media must also play a key role in up. However, we are all
percent, indicating that about 21.7 million One of the things to put into consideration promoting these reforms and sensitising wrong. The lax security at the
Nigerian youths remain unemployed. is the construction of a viable model that Nigerian youths on the need to embrace train station attracts these
It is also said that Nigeria’s youth will help in understanding the Nigerian education, learn vocational skill and also kidnappers, who abduct
population eligible to work amounts to society and how it can help solve the rate prioritise patriotism as an emblem of passengers with ease.
40 million out of which only 14.7 million of unemployment among youths. reform. There is, therefore, the need
are fully employed and another 11.2 Also very imperative is a reform of Aliyu Umar Aliyu, Abuja. (aliyu.umar@ for government to deploy
million are unemployed. A high youth educational system. Nigeria’s educational bpsr.gov.ng) adequate security personnel
to comb up the area. The
Sule Lamido and the disabled in Jigawa State kidnappers are likely to extend
their operation to other
E
very December in every aspect of political, allowance, which improved for free medical care and neighbouring communities
3 is observed as social, economic and cultural their standard of living. free education from primary unless their dangerous
International Day of life. He also ensured that they school to university for the activities are stopped.
people with disabilities as It is not an understatement were given a chance to aspire disabled persons in the The Kaduna State
proclaimed by the United to say that former Jigawa and contest elective positions state. In short, the disabled government should quickly
Nations in 1992. State governor, Sule Lamido, in the state. There was even persons are entitled to every come to the aid of Rigasa
The Day aims to promote is one Nigerian who used a time when a cripple won a opportunity available to community by actively
an understanding of his position to see to the seat in the state assembly. other citizens. engaging unemployed youths
disability issues and mobilise implementation of the aims Lamido appointed a Special These initiatives are worthy into the vigilante group to
support for the dignity, rights of the Day. Assistant on Physically of emulation by all leaders to work together with other
and well-being of persons He initiated a special Challenged Persons to give give this vulnerable group security outfits to protect the
with disabilities. package where 100 physically them a sense of belonging in of Nigerians a sense of community. There also is the
It also seeks to increase challenged persons, selected the state . belonging. need for government to deploy
awareness of gains to be from the 27 local government There were also laws more troops to secure the
derived from the integration areas in the state, were being enacted during his Adamu Muhd Usman community.
of persons with disabilities paid a monthly security administration that provided writes from Jigawa state. Lawal Adamu Usman
DAILY TRUST, Wednesday, December 9, 2020
18 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
e-mail opinion@dailytrust.com
OPINION
EDITORIAL
No. 20 P.O.W. Mafemi Crescent,
Off Solomon Lar Way, Utako
Interrogating Lt Gen. Buratai’s “spiritual
District, Abuja
warfare’’ and Boko Haram’s resilience
Time to save By Charles Onunaiju resources that flow to the
insurgent group. As far as the
supply lines to the insurgent
instance of the Japanese army
that invaded China and even
have the temerity to set up a
‘‘The spiritual knowledge is
poultry industry attained through divination;
that of natural science
group are open and thriving, no
amount of military pressure can
puppet regime.
On “protracted warfare,”
T
is obtained by deductive sufficiently decapitate them Mao argued that positional
he Poultry Association of Nigeria (PAN) last week said reasoning; the universal laws into surrender or negotiation. warfare is a doomed strategy,
the poultry industry could shut down by January 2021 are established and verified The supply line is crucial for preferring guerilla or mobile
due to the astronomical rise in the prices of maize and through mathematical the life of any insurgent group war-fare to sap the energy and
soybeans, the main components for producing poultry feeds. calculations. The knowledge of as much as a key artery to morale of the regular troops on
President of the poultry group, Ezekiel Ibrahim, said the the enemy’s dispositions in war, the regular army. The Nigeria invading army. In this context,
industry faces a dire situation unless the government acts fast. however, is gained only through Army regularly announces the Mao warned that such warfare
He stated that small and medium-sized poultry farms that spies and by no other means” number of insurgent fighters is protracted.
were the major players in the industry were shutting down, – Sun Tzu- “Art of War”. that it neutralises but because Boko Haram has not
threatening over five million jobs created by the industry. the insurgent’s line of supply demonstrated any serious
A
President of the All Farmers Association of Nigeria, Kabir t a recent event to is wide open and thriving, they territorial ambitions and has
Ibrahim, noting that stocks of grains have declined to less decorate 39 newly are never short of men, as new a major deficit of unfriendly
than 30,000 metric tons, a fraction of the requirements for promoted Major recruits attracted for a variety and uncooperative local
feeding Nigeria, lamented that the growing insecurity has Generals in the Nigeria Army, of reasons of either ideology or population, which capitulates
made it difficult to augment supplies. the Chief of Army Staff, Lt. money, soon and very quickly to its antics only through
In addition, production of the grains is being affected by General Tukur Buratai, was fill the vacuum. Therefore, terrorist compulsion. Boko
the long-running conflict between crop growers and cattle reported to have said that ”I am the number of insurgents Haram is not Tamil Tigers
herders, who are being forced by desertification to seek glad that we held the spiritual neutralised or killed can never armed rebel group in Sri
grazing pasture further South. warfare seminar and most of translate to degrading the Lanka that enjoyed the open
Experts also blamed the price hikes on the high demand the decorated generals today insurgency as their supply support of the minority
in the international market of Nigerian soybeans, as they are graduates of the spiritual lines keep recruits flocking Tamil ethnic nationality in
are non-GMO variant. In addition, there was a mop-up of warfare seminar.” to their den. And the tactical Northern Sri Lanka and even
maize grains for COVID-19 palliatives and an alleged lack of Because one has only, and I withdrawal of the insurgents its Diaspora or the Farubundo
incentives to the industry. am sure many people have also from its former wider theater Marti Revolutionary (FARC)
As a result, in the last seven months, about two million heard about “spiritual warfare including cities cannot be in Colombia, a sophisticated
poultry jobs have reportedly been lost. Industry sources said from Christian Pentecostal taken for the weakness of the Marxist rebel movement
the price of soybeans, which is a constituent of poultry feeds, preachers, for whom I thought, insurgents as the minister that enjoys huge rural
has increased by 87 per cent. it was only a bombast to keep of information, Mr. Lai support and even some left-
In comparison with the same period in 2019, the price of their congregation in awe of Mohammed naively insinuated wing governments in the
maize has risen by 82 per cent. Poultry feeds have increased by their theological learnings, but recently. If the terror group hemisphere. Boko Haram is
nearly 100 per cent. There are also unconscionable capitalist now with a military general decides that it has achieved an ideological and political
grain merchants and saboteurs who hoard the available at war involved in “spiritual enough national and global orphan, disowned by virtually
grains for maximum gain. warfare as obvious war strategy notoriety and now decided to everyone and most susceptible
There have also been policy flip-flops as in July, the Central got yours sincerely, scampering concentrate its forces in its base to summary defeat by credible
Bank of Nigeria (CBN) directed all authorised maize dealers and combing through all the for the extortion of the local intelligence operation that cuts
“to discontinue the processing of Form M for the importation works on warfare and military population to fund its more off its supply lines.
of maize/corn with immediate effect.” strategy, I could lay hands in urgent need of maintaining its General Buratai did not
It added that this was “to increase local production, one’s library. supply lines, it should be seen explain in detail what he
stimulate a rapid economic recovery, safeguard rural Encountering the inimitable for what it is, tactical dexterity called “spiritual warfare but
livelihoods and increase jobs, which were lost as a result of work of the ancient Chinese of the terror group and not sign one hopes, it does not consist
the ongoing COVID-19 pandemic.” strategist, Sun Tzu, in his of defeat. In war, according in divination and magic. It
classic text, Art of War in which to the British military writer, was such a situation where
The policy resulted in the excessive rise in the price of maize,
he identified and thoroughly B.H Liddell Hart, “the aim is Lumumbaist Guerrillas against
which pushed thousands of small and medium-sized poultry
appraised five fundamental to weaken the resistance of the Mobutu dictatorship
farmers out of business. Due to the outcry that followed, the
factors that determine the final the enemy before attempting in the Congo trusted more
CBN relaxed the policy once by allowing the importation of
outcome of war, as consisting to overcome it and the effect in magic that forced the
262,000 tons of maize. Also, the federal government released
in the followings: The political is better attained by drawing legendary Ernesto Guevara,
5,000 tons but these weren’t enough to drive down the prices. the enemy out of its defences.”
direction, the weather, the the Argentine-born Cuban
Mrs Blessing Alawode, Chairperson, Poultry Association of The implication of weakening internationalist to abort his
terrain, the quality of military
Nigeria, Ogun State, said: “We want the federal government leadership, and finally, the the enemy resistance is not military odyssey after an
to assist the local maize growers with high-yielding seeds and discipline of the troops by wishing away its strength 8-month stay with the rebel
fertilizer in order to increase their quantum of harvest per committed to the battle., one but by coming to terms with guerrillas in the thick Congo
hectare, so that in the next seven to ten years, the huge gap found nothing about spiritual its potential for resilience. forest in the 1960s.
between demand and supply of maize and soybeans can be warfare. Boko Haram’s resilience has To cultivate the military
filled. But in underlining the single always been completely spirit” which is more of it than
“Therefore, importation of maize and soybeans, in the most decisive factor that demonstrated, first by forcing “spiritual warfare,” the Prussian
short term, is the most pragmatic way to obviate further “enables the wise sovereign the army into a barricade or General Carl Von Clausewitz in
rising prices of the products and ameliorate the hardships of and the good general to what the military authorities his classical treatise “On war”
the citizens. strike and conquer, and called “super camp” and also opined that “An army which
“We appeal to the government to ban the export of achieve things beyond the series of successful ambush preserves its usual formations
processed soybeans and soybean meal and check the reach of ordinary men, is’’ in which troops have been under the heaviest fire, which
profiteering activities of grain merchants. Thousands of foreknowledge.” Continuing, neutralised and equipment is never shaken by imaginary
poultry businesses will shut down in the face of high operating Sun Tzu wrote “Now, this carted away. It makes absolute fears, and in which in the face
costs, leaving business owners and their employees without a foreknowledge cannot be ly no sense to suggest that the of danger disputes the ground
means of livelihood.” elicited from spirits; it cannot terror group is “technically inch by inch with the enemy…
There is a need for the quick provision of high-yielding be obtained inductively from defeated” or degraded,” simply and which looks upon all toils
seeds and varieties of grains and hybrid chickens through experience nor by deductive because it stopped throwing as the means to victory,… and
the nation’s agricultural research institutes. There should calculation. Knowledge of the bombs in Abuja and other which is always reminded of
be alternatives to maize or soybeans as components of enemy’s dispositions can only northern cities. its duties and virtues by the
producing poultry feeds. be obtained from other men,” If it is this fatal lacuna that short catechism of one idea
But in a country that runs a free market economy, there engaged and developed as Lt. General Buratai, the chief namely: the honour of its arms:
should not be any ban on the exportation of soybeans or maize spies. of army staff, want to address such army is imbued with true
or any product. If there is higher demand overseas, efforts In the war against the with his seminars on “spiritual “military spirit.”
should be made to increase local production and cultivate Boko Haram insurgency that warfare,” then Nigerians should Needless to say that
better varieties of grains to meet both local and international has raged for more than a be prepared for the long haul, any serious engagement
needs through CBN intervention loans. decade, the evident lacuna which he himself, was reported to interrogate the critical
in the military prosecution of to have posted in his verified elements and components
the war is the deployment of Facebook that insurgency may of “military spirit” would not
NURA DAURA: Ag Chief Executive Officer intelligence or what Sun Tzu last for upwards of 20 years. consist of any seminar on
NAZIRU MIKAILU: Executive Director/Editor-in-Chief called “fore-knowledge”. Only Mao Zedong’s” classic “on “Spiritual warfare”.
HAMZA IDRIS: Editor credible intelligence can lead protracted warfare”, was in the Mr. Onunaiju is research
AHMED SHEKARAU: General Manager, Business & Strategy to the disruptions of the supply context of an invading superior director of Abuja based Think
lines of human and material foreign army as in the specific Tank.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 19
'3*&/%40'(0%48*--
",1"#*0*//*(&3*" :PVS&YDFMMFODZ
'0("/
)"11:
#*35)%":
/LIH VKRXOG QRW RQO\ EH OLYHG LW
VKRXOGDOVREHFHOHEUDWHG
6WD\WUXHWRZKR\RXDUH\RXDUH
DQ DPD]LQJ SHUVRQ DQG WKH
IULHQGHYHU\ERG\FRXOGKRSHIRU
%HVWZLVKHV<RXU([FHOOHQF\
6HQDWRU*RGVZLOO2ERW
"LQBCJP
+RQRXUDEOH0LQLVWHU
&21
0LQLVWU\RI1LJHU'HOWD
20
BUSINESS
business@dailytrust.com
CBN EXCHANGE RATES COMMODITIES PRICE (Dec. 6, 2020) BUREAU DE CHANGE RATES
Dollar Euro Pound S.
SELLING BUYING
US DOLLAR Pound STERLING EURO YUAN/ RENMINBI RIYAL CFA CRUDE OIL BRENT $49.03
Buying 379 509.30 459.76 57.83 101.039 0.678 N465 N560 N625
GOLD $1,839.54
Central NGN 379.5 509.93 460.37 57.91 101.173 0.688 Dollar Euro Pound S.
SILVER $24.20
Selling NGN 380 510.60 460.97 57.99 101.306 0.698 N475 N575 N640
NATURAL GAS $2.55
Reps extend
Inflation rate to drop as FG recapitalisation
cuts fuel price by N5 — Experts of insurance firms
By Balarabe Alkassim
By Zakariyya Adaramola & Idowu However, he said it needs to
Isamotu be sustained for the effects to
The House of
eventually show.
Representatives has
T
he reduction in price of The economist said: “So, for
directed the National
fuel by N5, from N168 to food stuff this price cut can dent
Insurance Commission
N163 per litre may lead it a bit. Because fuel is one of the
(NAICOM) to suspend the
to a downward trend in the inputs of production, and since
planned December 31,
inflation rate which has been it has been reduced, it will force
2020 mandatory deadline
rising since early this year, down prices of foods, goods and
for insurance companies
analysts said. services.”
and intermediaries to
The economic experts Galadima said to cushion
pay off the new paid up
specifically said the fuel price the effect of high prices during
capital threshold.
cut could force down food and this Christmas, the government
This was sequel to a
headline inflations. should bring out foods from its
motion moved by the
The federal government on food reserves across the country.
House Spokesperson,
Tuesday morning succumbed He also said youths should
Benjamin Okezie Kalu
to the pressure from organised be motivated to go into
and others.
labour and reduced present agriculture and mining to help
The lawmakers said
price of Premium Motor Spirit N168, following the decision prices of foods, goods and in the diversification effort of the
there is the need for
popularly known as Petrol by N5. of the Petroleum Products services across all sectors of the government.
the first phase of 50%,
The Minister of Labour and Marketing Company to increase economy. “In the long term, we should be
noting that 60% of the
Employment, Chris Ngige, had the ex-depot price of petrol from An Abuja-based economist encouraged to be independent
minimum paid up share
announced after a meeting with N147.67 per litre to N155.17 per and financial expert, Mr Simon at producing our staple foods”,
capital for insurance and
leadership of Nigeria Labour litre in November. Galadima, said every other sector he said.
reinsurance companies
Congress (NLC) and Trade The ex-depot price is the price of Nigeria’s economy rests on A Lagos based financial expert,
to be put on hold for a
Union Congress (TUC) at the at which the product is sold by the oil sector, and as such, any Dr Ajibola Nurudeen, said N5
minimum of six months
Presidential Villa. the PPMC to marketers at the positive or negative news in the reduction in fuel price would go
from January 2021.
He said the reduction would depots. sector reflects on other sectors. a long way in reducing Nigerians’
They added that
be from N168 to N162.44 per litre Reacting to the agreed pump “The reduction will exert suffering.
the period will help
with effect from December 14. price reduction, some experts downward pressure on food He called for more palliatives
the companies for
Daily Trust reports that the explained that Nigerians would and headline inflation. That is to the poor as they bear the most
more time to cushion
product is presently sold at witness a slight reduction in certain,” Galadima said. brunt of the economic hardship.
the effects of COVID
and other unforeseen
CBN credit to banks hit N1.3trn in 2019 circumstances on the
insurance industry.
By Chris Agabi On payments, the report indicated rising President of Amasco International The lawmakers noted
electronics payment which also shows that Limited, Alhaji Mustapha Ado Mohammad, that NAICOM had on May
The Central Bank of Nigeria’s (CBN) the financial inclusion rate is improving. called on the authorities to fix the foreign 20, 2019 increased the
credit to banks rose by 10.8 per cent from The CBN Governor, Mr. Godwin Emefiele exchange crisis to save the manufacturing minimum paid up share
N1.099 trillion at end of December 2018 to in a foreward expressed hope that the 20% industry. capital for insurance and
N1.227trn in 2019, a report has shown. financial inclusion target will be met this He stated this when he received in his reinsurance companies.
The 2019 Annual Report for the year. factory a delegation from the Standard “The changes to the
implementation of the National Financial “Since inception, we have seen significant Organization of Nigeria (SON) led by the minimum paid up share
Inclusion Strategy (NFIS) showed that the progress towards the reduction in the organization’s Director General and Chief capital were as follows
total loans and advances by banks increased financial exclusion rates in Nigeria. Our Executive Officer Alhaji Farouk Salim. Life Insurance N2 billion
by 13.42% to reach N16trn in 2019 from periodic measurement of the financial “Many manufacturers are currently to N8bn, General N3bn to
N14.1trn in 2018. inclusion rate currently puts Nigeria’s facing serious challenges in their business N10bn, Composite N5bn
The NFIS was launched on October 23, performance at 63.2%, leaving us with a as a result of high foreign exchange in to N18bn and Reinsurance
2012 to reduce the percentage of adult 16.8% gap in projected achievement. Our respect to Naira ration to Dollar taking into N10bn to N20bn.
Nigerians who do not have access to headline target is to achieve 80% financial consideration the economic status of the NAICOM introduced
financial services from 46.3%in 2010 to 20% inclusion rate by the end of 2020,” he said. nation. a two phased
in 2020. A cursory look at the report showed that “It is unfortunate that a lot of recapitalisation
The report said the increase in the volume the volume and value of electronic payments manufacturers will be left with no option programmes, wherein, 50
of loans was supported by the increased in 2019 rose by 46.7 and 25.5% to 3 million than to close down their businesses if things percent of the minimum
loan-to-deposit ratio policy of CBN during and N167.bn, respectively, compared with are allowed to continue going the way they paid up share capital for
the year. This development also supported 2.1m and N133.5bn in 2018. are,” he said. insurance companies
inclusion efforts of the Bank. Local firm decries high forex rate The SON’s Director General, Mr Salim, must be met by December
However, the report also indicated that From Ibrahim Musa Giginyu, Kano said Amasco Limited has no doubt created a 31, 2020 and 60 percent for
Nigeria’s net foreign assets decreased A local manufacturer has said he is over good name for itself in sanitizing the country reinsurance companies
substantially from N216.4 billion in 2018 to the high foreign exchange (forex) rate as they through production of standard products must be met on the same
a deficit of N1.064trn in 2019. consider the option for closing businesses. that earns the country a good name. date,” they added.
NIGERIAN RAILWAY CORPORATION ABUJA – KADUNA TRAIN SERVICE (AKTS) TIME TABLE
SUNDAYS – TUESDAYS and THURSDAYS - SATURDAYS WEDNESDAYS (ONLY)
From DEPARTURE ARRIVAL From DEPARTURE ARRIVAL From DEPARTURE ARRIVAL From DEPARTURE ARRIVAL
ABUJA KADUNA ABUJA KADUNA
AK 1 AK 3 AK 5 AK 7 AK 1 AK 3 AK 5 AK 7 KA 2 KA 4 KA 6 KA 8 KA 2 KA 4 KA 6 KA 8 AK 1 AK 3 AK 1 AK 3 KA 2 KA 4 KA 2 KA 4
IDU 07:00 09:50 14:20 18:00 - - - - RIGASA 06:40 10:35 14:00 18:00 - - - - IDU 07:00 18:00 - - RIGASA 06:40 18:00
KUBUWA 07:17 10:07 14:41 18:15 07:14 10:02 14:36 18:16 KUBUWA 08:31 13:04 16:03 20:07 08:28 12:59 15:58 20:04 KUBUWA 07:17 18:15 07:14 18:12 KUBUWA 18:31 20:07 08:28 20:00
RIGASA - - - - 09:15 12:01 17:00 20:02 IDU - - - - 08:43 13:20 16:16 20:20 RIGASA - - 09:15 20:20 IDU - - 08:34 20:20
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
BUSINESS follow us on Twitter: @daily_trust 21
NEWS
From right:
Managing Director,
Federal Airports
FG scores firm low over
Authority of Nigeria,
Capt. Rabiu Yadudu;
slow port automation
Chairman, House From Eugene Agha, Lagos
Committee on
Aviation, Rep. Nnolim The federal government yesterday
Nnaji and Rep. Musa queried the management of Port &
Muhammed, Deputy Cargo Handling Services (P&CHS)
Chairman, during the over its inability to improve on its port
visit of members of automation processes.
the House committee The Executive Secretary of the Nigerian
on Aviation to the Shippers Council, Barr. Hassan Bello,
Murtala Muhammed who made this observation while on a
International Airport courtesy visit to the P&CHS, lamented
at Ikeja, Lagos as part that on some occasions, it takes a cargo
of their oversight
about four months to exit the terminal
function yesterday
via barges.
In the area of automation, Bello argued
that P&CHS has not been found to be
appealing. “In fact, the terminal scored
FAAN generates N30bn revenue, targets N69bn 25 percent when other terminals were
scoring 60 percent and 75 percent. By the
first quarter of 2021, we need all the ports
From Abdullateef Aliyu, Lagos the authority, Capt. Rabiu funded organisation is collected, N17.6bn was to be fully automated.”
Yadudu disclosed this on expected to remit 25 per from aeronautical source of He said, “There are issues we will like
T
he Federal Airports Tuesday when members of cent of its revenue to the revenue, N5.7bn from non- P&CHS to work on. This issues brothers
Authority of Nigeria the House of Representatives federation account even as aeronautical source and on efficiency and a host lot of others.
(FAAN) has generated Committee on Aviation there are moves to jack up the N5.2bn recovered from debts. Government is trying as much as possible
N30,084 billion as internally visited the authority during remittance to 40. “From January to to fix the roads, which is about 75 percent
generated revenue (IGR) an oversight tour of the But FAAN and other September 2020, the revenue completed. We know the roads are bad,
from January to September Murtala Muhammed Airport aviation stakeholders are target of aeronautical source but we will not take that as an excuse for
2020 out of the projected (MMA), Lagos. agitating for exemption from was N38, 988, 439, 354 and Nigerians to be exploited.
N69.5bn for the year. Meanwhile, the authority the remittance to meet the actual generation totaled The Managing Director of P&CHS, Mr.
The amount generated said it has remitted over infrastructural gaps with the N17, 823, 332,992 out of John Jenkins, while responding to the
represents 43.25 per cent of N2bn into the Consolidated nation’s airports following which N17, 610, 732, 478 is query, blamed the deplorable state of the
the target even as N28bn was Revenue Fund (CRF) during the COVID-19 impact and actual collection giving a ports access roads on the slow process of
the actual collection during the period. the near-collapse of revenue percentage performance of cargo evacuation at the terminal.
the period. Daily Trust reports that sources. 98.81 on revenue collected Jenkins said: “Yes, we can do more,
Managing Director of FAAN despite being a self- He said from the N27.9bn over generated,” he said. but not that we are not doing enough. I
don’t think we are under-performing, but
‘We’re stamping out corruption in business’ I agree we can do better.
“In the area of automation, we are
From Christiana T. Alabi, Lagos Africa. people begin to regard it as the norm. looking into this and very soon, we will
President of LCCI, Mrs. Toki She, therefore, noted that regional be bringing in IT experts to help look into
Participants of the Africa Business Ethics Mabogunje, lamented that corruption cooperation and development of this.”
Conference (ABEC) have said they are is one of the biggest developmental regionally agreed legal mechanisms to
working to stamp out in both the public challenges facing African economies, address the problems would be useful
and private spheres in Africa. noting that African economies cannot as well as international efforts to stop Crown Flour Mill unveils
The event held in Lagos and organised bear the increasing cost of corruption, large scale corruption in business
by the Lagos Chamber of Commerce which impedes socio-economic transactions. vitamin premix facility
and Industry (LCCI) in partnership with development and minimises the Mr. Andrew Wilson, the Executive
the Centre for International Private capacity of African governments to lift Director of CIPE also mentioned that From Risikat Ramoni, Lagos
Enterprise (CIPE). their citizens out of poverty and create integrity is the central pillar of society,
It is to promote conversations opportunities for the low-income noting that due to corruption, Nigeria Crown Flour Mill Limited, a subsidiary
regarding the practical solutions to segment of the society. businesses suffer losses. of Olam Group said it is committed to
address corruption as a strategic Mabogunje said once corruption “Though corruption is a global delivering Nigeria’s first state-of-the-art
approach in reducing the high incidence becomes entrenched, its negative effects problem, its impact in Nigeria is far- vitamin premix facility.
of poverty and unemployment across multiply as it induces cynicism because reaching,” he said. The delivery, it said, is in line with the
90% food fortification compliance target
set at the penultimate edition of the
‘Poor knowledge, trust affecting free trade’ NESG commends Shell, others for Nigerian Food Processing and Nutrition
Leadership Forum.
From Sunday Michael Ogwu, Lagos enforcement culture of arbitral
awards, the Conference, supporting #NES26 The food manufacturer made this
The dearth of knowledge and therefore, recommends By Francis Arinze Iloani reputable organisations known at the 3rd annual gathering of
trust deficit, are part of the “Continuous training of judges such as Giving.ng, Banwo the top players in the food industry in
hindrances to the success of and legal practitioners to be Nigerian Economic Ighodalo & Co, Shell, the country which was held virtually
African Continental Free Trade familiar with arbitration rules Summit Group (NESG) Flour Mills of Nigeria, recently.
Area Agreement, AfCFTA. and the importance of ADR has commended, a crowd- Nestle Plc, among others. Speaking at the forum on the firm’s
This was contained in a as a social and economic funding platform, Giving. Explaining the rationale commitment to participate in the
communiqué jointly signed infrastructure. ng, Shell, Flour Mills and behind the theme, Micronutrient Fortification Index (MFI),
at the end of the first 2-Day It said that with the AfCFTA Nestle for supporting “Building Partnerships for Managing Director, Crown Flour Mill
Conference Chartered Institute starting soon, African and the recently concluded Resilience,” Mr Jaiyeola Limited, Mr Ashish Pande, said, “Crown
of Arbitrators (CIArb), by the indeed Nigerian practitioners’ Nigeria Economic noted that “There is a Flour Mills has established a state-of-the-
Nigerian Branch Chairman, potentials of gaining global Summit (#NES26). need to come together art vitamin premix facility in Nigeria with
Mr. Tunde Busari and the recognition could only be The event which held in partnership to revive technical support from the international
2020 Conference Organising achieved by expanding the between 23rd and 24th the economy. Neither the nonprofit TechnoServe, under the
Chairman, Mr. Yakubu Chonoko frontiers of practice to multiple of November, 2020 had government nor private Strengthening African Processors of
Maikyari. jurisdictions and increasing participants from private sector alone can do it.” Fortified Foods programme.
The conference was attended their knowledge base and and public sectors Olapeju Ibekwe, the “The goal is to prepare vitamin premix
virtually by nearly 2000 services beyond Nigeria and the discussing how strategic Chief Executive Officer of according to the regulatory requirement
registered participants. African context. partnerships can be Sterling One Foundation, of the Standards Organisation of Nigeria
The 55 member states It was observed by the used as a tool to achieve owner of Giving.Ng, in (SON) and to supply Crown Flour plants
of the African Union, AU, Conference Speakers that “The economic growth. her reaction explained with high quality and food-safe vitamin
had established the AfCFTA AfCFTA provides an opportunity The Chief Executive why her organisation premix. This is the first-ever by any flour
Agreement on March 21, 2028, for African states to refocus the Officer of NESG, Mr. Laoye supported the event. miller in Nigeria.”
to create a single continent-wide arbitration global framework by Jaiyeola lauded sponsors “We decided to join It said it aims to improve food
market for goods and services removing structures that project for their support. hands together with NESG fortification levels of staple foods.
and to promote the movement a neo-colonial bias, focusing on He said the NESG to mobilise available “Providing access to nutrition which
of capital and persons among capacity building in terms of our looks forward to more resources to ensure the enables Nigerians to live healthy and
member states. negotiating power and capacity engaging and rewarding speedy recovery of the productive lives, therefore sits at the core
To improve the pro- of our arbitration practitioners.” partnerships with economy,” she said. of our purpose as a business.”
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
22 follow us on Twitter: @daily_trust BUSINESS
NEWS
REA energised Plateau Coca-Cola pledges N19m to relief platform
to the underserved in communities. impacted by the pandemic, while
community with 234KW By Simon Echewofun Sunday
The Public
Communications & Sustainability
Affairs, leveraging our robust distribution
network.”
Coca-Cola Nigeria Limited and its
solar grid bottling partner Nigerian Bottling
Company Limited (NBC) has
Manager, Coca-Cola
Limited, Nwamaka Onyemelukwe,
Nigeria Mr Kola Masha, Managing
Director of Babban Gona, the Lead
From Dickson S. Adama, Jos The Managing pledged N19 million to GiveFood.ng, explained that the organization will Coalition Partner for GiveFood.ng,
Director/ CEO of REA, an emergency food relief platform, be providing monetary support to said: “There is an urgent need to help
T
he Rural Ahmad Salihijo, said to feed vulnerable families in its host the initiative, leveraging the vast our neighbours in dire need at this
Electr ification the facility will provide communities. distribution network built by Give time.
Agency (REA) clean, safe, affordable Coca-Cola had endorsed the food.ng to ensure this food relief “The economic downturn
has energised a 234 and reliable electricity platform in May 2020, with the reaches those in need. caused by the COVID-19 pandemic
kilowatts (KW) solar for the community platform providing over 200,000 “The current economic climate has brought to the fore the strife
hybrid mini-grid power members. meals to Nigerians, a statement said. presents a level of hardship for many of individuals, families, and
plant at Shimankar He said the use The initiative comprises a coalition Nigerians who struggle to make a communities across the nation.”
Community in of clean energy of partners focused on reaching the living. Through this donation, we The platform has over 100 food
Shendam LGA, Plateau technologies in the quest most vulnerable people with a target believe the platform will be able collection points in partnership with
State. to provide electricity of providing over one million meals to feed over a million Nigerians various supermarket chains.
The agency said is an added advantage
to rural communities,
the projects are being
financed under the adding that the Ibrahim bows out of Buhari reinstates former
federal government’s
Nigerian Electrification
Project (NEP) with commitment to meeting NDIC after 10yrs Niger Delta PHCN GM
funding from the its developmental goals By Chris Agabi Aghatise Erediauwa By Olayemi John-Mensah & Aisha Mustapha stated in the
World Bank ($350 is also by providing exited the service. Yahaya letter that with a reference
million) and the African electricity access for all. Mr. Ibrahim Umar, the Ibrahim was first No SGF.50/S/4/II/621 and
Development Bank The Managing Managing Director/ appointed as MD/ President Muhammadu dated November 18, 2020,
($200m). Director, Green Energy Chief Executive, of CE in 2010. His tenure Buhari has reinstated the that President Buhari has
Speaking during the Village (GVE), Ifeanyi the Nigeria Deposit was subsequently General Manager, Niger approved her reinstatement
project commissioning, Orajaka, said the firm Insurance Corporation renewed by President Delta Power Holding as General Manager (Audit
Governor Simon Lalong got a grant from REA (NDIC), on Tuesday Muhammadu Buhari in Company of (NDPHC) & Compliance), Niger Delta
of Plateau State said the for the project with bowed out of office after January 2016, along with Nigeria, Mrs. Maryam Power Holding Company
people have been used installed capacity of 10 years in office. that of Prince Erediauwa, Danna, after four years of Limited with effect from
to using generators, 234kwp. He had served two at the conclusion of their wrongful retirement. 10th November 2020.
candles, kerosene lamps He also said 1,972 terms of five years each first term in office. Mrs. Danna was illegally “Consequently, the letter
and other unsafe energy households, 273 at the helm of NDIC. It noted that under retired in 2016 by the of your disengagement Rf.
sources. commercial users, A statement released Ibrahim’s leadership, Federal Government but NoSGF.55/S.4/52 dated
He stressed that with five productive users by the Director, the NDIC experienced her letter of reinstatement 10th June 2016 has been set
clean energy sources, and 19 public users Communication t r e m e n d o u s signed by the Secretary aside,” it read.
such as this solar in the community and Public Affairs transformation to the Government of the Mrs. Danna, who spoke
mini-grid, the health are being provided Department, Bashir towards the robust Federation, Boss Mustapha, with the press during
and environmental with uninterrupted Nuhu, indicated that implementation of its stated that the previous a Walima to mark her
wellbeing of our people electricity from the the Executive Director mandate and public letter of her disengagement reinstatement, said she now
will be safeguarded. mini-grid. (Operations), Prince policy objectives. has been set aside. has confidence in Nigeria.
/2&$/23(17(1'(5$11281&(0(17 /2&$/23(17(1'(5$11281&(0(17
1RUZHJLDQ&KXUFK$LG
1&$
LVDPHPEHURIWKH$&7$OOLDQFHDQGZRUNVZLWKSHRSOHDQGORFDO 1RUZHJLDQ&KXUFK$LG
1&$
LVDPHPEHURIWKH$&7$OOLDQFHDQGZRUNVZLWKSHRSOHDQGORFDO
DFWRUV HVSHFLDOO\ )DLWKEDVHG DFWRUV LQ PDQ\ FRXQWULHV ZKHUH LW ZRUNV LQ WKHLU VWUXJJOH WR HUDGLFDWH DFWRUVHVSHFLDOO\)DLWKEDVHGDFWRUVLQPDQ\FRXQWULHVZKHUHLWZRUNVLQWKHLUVWUXJJOHWRHUDGLFDWH
SRYHUW\ DQG LQMXVWLFHV :H SURYLGH KXPDQLWDULDQ DVVLVWDQFH LQ GLVDVWHUV DQG ZRUN IRU ORQJWHUP SRYHUW\ DQG LQMXVWLFHV :H SURYLGH KXPDQLWDULDQ DVVLVWDQFH LQ GLVDVWHUV DQG ZRUN IRU ORQJWHUP
GHYHORSPHQWLQORFDOFRPPXQLWLHVDQGVRFLHWLHV,QRUGHUWRDGGUHVVWKHURRWFDXVHVRISRYHUW\ZH GHYHORSPHQWLQORFDOFRPPXQLWLHVDQGVRFLHWLHV,QRUGHUWRDGGUHVVWKHURRWFDXVHVRISRYHUW\ZH
DGYRFDWHIRUMXVWGHFLVLRQVE\SXEOLFDXWKRULWLHVEXVLQHVVHVDQGUHOLJLRXVOHDGHUV DGYRFDWHIRUMXVWGHFLVLRQVE\SXEOLFDXWKRULWLHVEXVLQHVVHVDQGUHOLJLRXVOHDGHUV
1&$KDVDSUHVHQFHLQ1LJHULDWRUHVSRQGWRWKH+XPDQLWDULDQFULVLVLQ1RUWKHDVW1LJHULD1&$KDVLWVFRUH 1&$KDVDSUHVHQFHLQ1LJHULDWRUHVSRQGWRWKH+XPDQLWDULDQFULVLVLQ1RUWKHDVW1LJHULD1&$KDVLWV
FRPSHWHQFLHVLQ*HQGHU%DVHG9LROHQFHDQG:DWHU6DQLWDWLRQDQG+\JLHQH1&$KDVLWVVWUHQJWKVLQZRUNV FRUHFRPSHWHQFLHVLQ*HQGHU%DVHG9LROHQFHDQG:DWHU6DQLWDWLRQDQG+\JLHQH1&$KDVLWVVWUHQJWKV
DQGLQYHVWLQORFDOSDUWQHUVHQVXUHVEXLOGLQJWKHLUFDSDFLWLHVDUHEXLOWIURPWKHRQVHWRIUHVSRQVHWRHQDEOH LQZRUNVDQGLQYHVWLQORFDOSDUWQHUVHQVXUHVEXLOGLQJWKHLUFDSDFLWLHVDUHEXLOWIURPWKHRQVHWRI
WKHPWRKDYHWKHFDSDFLW\WRUHVSRQGLQDORQJWHUPLQWHUYHQWLRQLQFOXGLQJUHFRYHU\DQGGHYHORSPHQW UHVSRQVH WR HQDEOH WKHP WR KDYH WKH FDSDFLW\ WR UHVSRQG LQ D ORQJWHUP LQWHUYHQWLRQ LQFOXGLQJ
UHFRYHU\DQGGHYHORSPHQW
5HTXHVW IRU 3URSRVDO 5)3 IRU :DWHU 7UXFNLQJ 6HUYLFHV LQ 3XOND
1*$0*1 5HTXHVW IRU 3URSRVDO 5)3 IRU /DWULQH 'HVOXGJLQJ 6HUYLFHV P LQ 3XOND
1*$0*1
3URSRVDOVDUHLQYLWHGIURPVXLWDEO\TXDOL¿HGVHUYLFHSURYLGHUVIRU:DWHU7UXFNLQJ6HUYLFHV3URVSHFWLYH
YHQGRUVLQWHUHVWHGDUHH[SHFWHGWRPHHWWKHIROORZLQJUHTXLUHPHQWV 3URSRVDOV DUH LQYLWHG IURP VXLWDEO\ TXDOL¿HG VHUYLFH SURYLGHUV IRU /DWULQH 'HVOXGJLQJ 6HUYLFHV
x 0LUURU1&$
VFRUSRUDWHSKLORVRSK\DQGEXVLQHVVSULQFLSOH 3URVSHFWLYHYHQGRUVLQWHUHVWHGDUHH[SHFWHGWRPHHWWKHIROORZLQJUHTXLUHPHQWV
x 2IIHUFRPSHWLWLYHSULFLQJDQGFRVWVDYLQJVVROXWLRQV x 0LUURU1&$
VFRUSRUDWHSKLORVRSK\DQGEXVLQHVVSULQFLSOH
x +DYHSURYHQVHUYLFHUHFRUG x 2IIHUFRPSHWLWLYHSULFLQJDQGFRVWVDYLQJVVROXWLRQV
x +DYHSURYHQTXDOLW\DVVXUDQFHV\VWHPV x +DYHSURYHQVHUYLFHUHFRUG
x %H¿QDQFLDOO\YLDEOH x +DYHSURYHQTXDOLW\DVVXUDQFHV\VWHPV
x %H¿QDQFLDOO\YLDEOH
x 2IIHUYDOXHDGGHGFDSDELOLWLHV
x 2IIHUYDOXHDGGHGFDSDELOLWLHV
x 0DLQWDLQWKHKLJKHVWSRVVLEOHVWDQGDUGRILQWHJULW\DQGIDLUQHVV
x 0DLQWDLQWKHKLJKHVWSRVVLEOHVWDQGDUGRILQWHJULW\DQGIDLUQHVV
x +RQRXUDOOFRQWUDFWXDOREOLJDWLRQVDQG
x +RQRXUDOOFRQWUDFWXDOREOLJDWLRQVDQG
x &RPSO\ERWKZLWKWKHOHWWHUDQGVSLULWRIWKHODZVRI)HGHUDO5HSXEOLFRI1LJHULD x &RPSO\ERWKZLWKWKHOHWWHUDQGVSLULWRIWKHODZVRI)HGHUDO5HSXEOLFRI1LJHULD
6FRSHRI6HUYLFH 6FRSHRI6HUYLFH
x :DWHU7UXFNLQJRIWRWDOPLQ3XOND x 'HVOXGJLQJRIWRWDOPRIIDHFDOVOXGJHLQ3XOND
0DQGDWRU\5HTXLUHPHQWV 0DQGDWRU\5HTXLUHPHQWV
x <HDUV
H[SHULHQFHLQUHOHYDQWDUHDRIVHUYLFH x <HDUV
H[SHULHQFHLQUHOHYDQWDUHDRIVHUYLFH
x &RPSDQ\PXVWKDYHXSGDWHGWD[FOHDUDQFHFHUWL¿FDWH x &RPSDQ\PXVWKDYHXSGDWHGWD[FOHDUDQFHFHUWL¿FDWH
x &RPSDQ\PXVWKDYHFDSDFLW\WRGHOLYHUPLQLPXPGDLO\UHTXLUHPHQW x &RPSDQ\PXVWKDYHFDSDFLW\WRGHOLYHUPLQLPXPGDLO\UHTXLUHPHQW
x &RPSDQ\PXVWKDYHDIXQFWLRQDO7,1QXPEHU x &RPSDQ\PXVWKDYHDIXQFWLRQDO7,1QXPEHU
0HWKRGRI$SSOLFDWLRQ 0HWKRGRI$SSOLFDWLRQ
&RPSDQLHV DFURVV 1LJHULD LQWHUHVWHG LQ WKH SURFHVV VKRXOG GRZQORDG 5)3 IURP WKH &RPSDQLHV DFURVV 1LJHULD LQWHUHVWHG LQ WKH SURFHVV VKRXOG GRZQORDG 5)3 IURP WKH
OLQNKWWSVGULYHJRRJOHFRP¿OHG.$*3K3V+U33=$,O\JRZ4Z90=3YLHZ"XV OLQNKWWSVGULYHJRRJOHFRP¿OHG]HRER/4&
S VKDULQJ FRPSOHWH DQG IRUZDUG SURSRVDO DQG RWKHU UHOHYDQW VXSSRUWLQJ GRFXPHQWV WR *34BP=\TFJ-BZ/DKSYLHZ"XVS VKDULQJ FRPSOHWH DQG IRUZDUG SURSRVDO DQG RWKHU
3URFXUHPHQW1*#QFDQR UHOHYDQWVXSSRUWLQJGRFXPHQWVWR3URFXUHPHQW1*#QFDQR
25 25
3LFNXS5)3LQRXURI¿FH1RUZHJLDQ&KXUFK$LG1&$1R0DQGDUD6WUHHW$ORQJ'RFWRUV4XDUWHUV 3LFN XS 5)3 LQ RXU RI¿FH 1RUZHJLDQ &KXUFK $LG 1&$ 1R 0DQGDUD 6WUHHW $ORQJ 'RFWRUV
2II:KLWH$UHQD*DPEROH5RDG0DLGXJXUL%RUQR6WDWH1LJHULD 4XDUWHUV2II:KLWH$UHQD*DPEROH5RDG0DLGXJXUL%RUQR6WDWH1LJHULD
&/26,1*'$7(6XQGD\WK'HFHPEHUE\KUV &/26,1*'$7(6XQGD\WK'HFHPEHUE\KUV
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
BUSINESS follow us on Twitter: @daily_trust 23
NEWS
Senate urges NNPC to ...Considers bill to help banks recover bad loans
to recover past and due obligations bank credit and recovery system
patronise local ship owners in By Abdullateef Salau without recourse to the borrower, that will effectively fasten the pace
The Senate, yesterday, passed for provide penalties for breaches of growth in the financial sector.
shipping petroleum products a second reading, a bill seeking and violations of obligations, “Lest we forget, before the
to establish a unified scheme for and enhance loan recovery in the deregulation of our banking
By Abdullateef Salau million revenue annually
a sound financial system that banking sector. system, the ability of our banks to
to overwhelming
will facilitate and improve credit Senator Musa while leading recover loans has been the bedrock
The Senate yesterday patronage of foreign
repayment culture by empowering the debate on the Bill at plenary behind the collapse of many
urged the Nigerian shipping firms in the
Creditor Banks to track loan presided by the deputy Senate commercial banks,” he said.
National Petroleum shipment of petroleum
defaulters’ accounts in any Bank in President, Ovie Omo-Agege, he The bill was thereafter referred
Corporation (NNPC) to products.
Nigeria through Bank Verification said the legislation has become to the Senate Committee on
patronize indigenous The lawmaker said
Number (BVN). necessary because credit is seen as Banking, Insurance and other
shipping firms in there was also the need
The proposed legislation, the lifewire of the banking business Financial Institutions for further
the transportation of to build capacities of
according to its sponsor, Senator and the situation of Nigeria today legislative works to report back in
petroleum products. indigenous shipping
Sani Musa (APC, Niger), would help demands an injection of a healthy four weeks.
The Chairman, Senate companies.
Committee on Local
Content, Senator Teslim
“We understand that
they don’t have enough Entrepreneurship: SMEDAN trains 1143 youth in Borno, Katsina, others
Folarin, gave the advice vessels, they don’t have By Francis Arinze Iloani and vocational components Ibom, Benue, Kano and Osun
at a meeting with the capacity and capacity of the National Business Skills states for the training in Personal
NNPC management and cannot come from The Small and Medium Enterprises Development Initiative (NBSDI). and Business Vision, Business
Ship Owners Association heaven. The GMD (of Development Agency of Nigeria A statement from the Corporate Plan, Identification of Business
of Nigeria in Abuja. NNPC) here has capacity (SMEDAN) has announced the Affairs Unit of the Agency Opportunities, Selling and
He expressed concern to help build the capacity training of 1143 young people in revealed that 127 young people Marketing Strategies, Accessing
over the report that (of local ship owners),” Borno, Katsina and seven other will be drawn from Imo, Borno, Business Finance, Customer Care
Nigeria loses over $120 he said. states under the entrepreneurship Katsina, Delta, Enugu, Akwa and Legal Regulatory Issues.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
24 follow us on Twitter: @daily_trust
'HFHPEHU
+(*RYHUQRU8PDU*DQGXMH3K'2)5
([HFXWLYH*RYHUQRURI.DQR6WDWH
7KH)HGHUDO5HSXEOLFRI1LJHULD1LJHULD
5(81$9$,/$%,/,7<2)81,9(56,7<$332,170(17
'HDU*RYHUQRU
, DP LQ UHFHLSW RI \RXU FRUUHVSRQGHQFH GDWHG 'HFHPEHU
3OHDVH EH DGYLVHG WKDW , UHFRJQL]H \RXU FRPPXQLFDWLRQ SURYLGHV D
VXPPDU\RI\RXUHGXFDWLRQDODFFRPSOLVKPHQWVDQG\RXGHPRQVWUDWH
DSSURSULDWHFUHGHQWLDOVJHQHUDOO\KHOGE\WKRVHDSSRLQWHGWRIDFXOW\
SRVLWLRQV,DOVRUHJUHWWKDWWKLVVLWXDWLRQKDVFDXVHGDQ\HPEDUUDVVPHQW
DVWKDWZDVQRWWKHLQWHQWLRQRI(DVW&DUROLQD8QLYHUVLW\QRUZDVLWWKH
UHDVRQIRUP\OHWWHU3OHDVHEHDGYLVHGWKDW&KDSWHURIWKH1RUWK
&DUROLQD*HQHUDO6WDWXWHVPDQGDWHVWKDWSHUVRQQHOLQIRUPDWLRQRI(&8
HPSOR\HHVUHPDLQVFRQÀGHQWLDOVRWKDW,DPXQDEOHWRUHVSRQGWRWKH
DGGLWLRQDOUHTXHVWIRULQIRUPDWLRQPDGHE\\RXUFRUUHVSRQGHQFH
,ZLVK\RXUH[FHOOHQF\DOOWKHEHVWLQ\RXUIXWXUHHQGHDYRUVDQGRQFH
DJDLQH[SUHVVUHJUHWIRUDQ\FRQIXVLRQWKDWPD\KDYHUHVXOWHGIURPWKH
1RYHPEHUFRUUHVSRQGHQFH
\
6LQFHUHO\
%*UDQW+D\HV3K',QWHULP3URYRVWDQG
6HQLRU9LFH&KDQFHOORUIRU$FDGHPLF$IIDLUV
FF 'U3DXO6FKZDJHU'HDQ&ROOHJHRI%XVLQHVV
'U5DYL3DXO&KDLU'HSDUWPHQWRI0DQDJHPHQW,QIRUPDWLRQ
6\VWHPV
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 25
DAILY TRUST, Wednesday, December 9, 2020
26 DIGEST
(153) SUDOKU>>
How to play: The number 1 through 9 will appear once only in each row,
EASY CROSSWORD>>
column, and 3 x 3 zone. There are 9 such zones in each sudoku grid. There is
only one correct Solution to each sudoku.
Good luck!
SNAPSHOT>>
Across 60. Stew or miscellany 18. 1912 disaster cause •
1. “Les Misérables” novelist
5. Mythical trio
61. Speedy Atlantic hopper
(Abbr.)
22. Quicklime, e.g.
23. Annex
Man murdered mum, dad,
11. Sweet 16, e.g.
14. Place to worship from
62. Brings to the boiling point?
63. Glitzy sign
24. Stags’ mates
25. Kind of blinds grandma and sister to
15. Blackout 26. Leghorn, for one
16. Casual day at the co.
17. Denver stash
Down 28. Manhandle hide double life
1. Witchlike character 30. Beam
19. Land parcel 2. Amateur video subject, 31. Rockets grp.
20. Arm of the Mediterranean maybe 33. Former Nigeria capital
21. It takes a pasting 3. Hoedown honey 34. Bone in a column
23. Devoted fans 4. Admit to the clergy 35. New York canal
26. Focus obsessively 5. Makes groovy? 36. Word with anything but
27. Goings-on 6. Rapper in class? 37. Completely marbled?
28. Supervise 7. Place setting? 40. Great Britain’s inc.
29. Study 8. Abel’s undoing 41. Willies
30. Chewed on a bone 9. Vanity 42. Greek messenger
32. The Lone Ranger’s calling 10. Lookout 43. Quantity
cards 11. Drifting 44. Superhero endowment
38. Like some photographs 12. Cavern 45. Significant periods
39. Sci-fi computer 13. Partner of or 46. Miami River city
41. “Oh, no!” feeling 48. English coin
44. Teacher that SOLUTION TO CROSSWORD (152) 49. Stropped item
goes strictly by the 51. Berlin composition
book 54. Scurried From left, Malesa Zaman, 21, Moniruz Zaman, 59, Momotaz
47. Outlying 55. Hearty quaff Begum, 50, and Firoza Begum, 70, in a compilation of undated
48. Assessed 56. Maracana Stadium locale photographs.
proportionately 57. Ampersand follower, often
A
man, Menhaz Zaman, brutally murdered his
50. Jagged
51. Ocean route mum Momotaz Begum, 50, dad Moniruz Zaman,
52. Cassowary 59, sister Malesa Zaman, 21 and his 70-year-old
cousin grandma Firoza Begum in July 2019, in a bid to hide
53. Heroes’ rewards, the fact that he was leading a double life. The 24-year-
sometimes
58. Big house
old murdered them the day before they thought he was
59. Bitterness due to graduate from York University in Canada with
an engineering degree. Zaman, who is from Markham
SIGN LANGUAGE>> in Canada, had in fact enrolled at Seneca College. He
You have been warned. had dropped out of his course due to poor grades and
was spending his time at a local shopping mall, gym and
playing video games at the family home, Malaysia’s The
Star reported. He texted friends saying he had been
“planning this for three years” and that while he was a
“pathetic coward subhuman” his “shaking has stopped”,
a court heard. He pleaded guilty to the second-degree
murder of his mum and first-degree murders of his
grandma, sister and dad. An agreed statements of facts
states that he had slit their throats and then “sat around
playing video games and napping” as he waited for his
sister and dad to return home from work. Prosecutor
Kevin Stewart told the court: “These were horrible,
monstrous, brutal killings. They took place in the family
home.
— legit.ng — Mirror.co.uk
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 27
8UEDQ6KHOWHU1LJHULD/LPLWHGZRQWKH5HDO(VWDWH'HYHORSHURIWKH<HDU
DWWKHMXVWFRQFOXGHGWK1LJHULD+RXVLQJ$ZDUGVZKLFKKHOGDW
,QWHUQDWLRQDO&RQIHUHQFH&HQWUH$EXMD
)URPWKHOHIW%DU)HVWXV$GHED\RFRQYHQHU1DWLRQDO+RXVLQJ$ZDUG0')HGHUDO0RUWJDJH 0U)UDQFLV2ORUXQIHPL*HQHUDO0DQDJHU&RUSRUDWH6HUYLFHV5LWML*RZRQ3URMHFW0DQDJHU+DM
%DQN0'&(2RI8UEDQ6KHOWHU+DM6DDGL\D$PLQX$OL\X$OKDML'U$OL\X:DPDNR3UHVLGHQW 6DDGL\D$PLQX$OL\X0'&(22ODZDOH6KRODGHPL0DUNHWLQJ'LUHFWRU-LEULO$OL\X'LUHFWRURI
5HDO (VWDWH 'HYHORSHUV $VVRFLDWLRQ RI 1LJHULD 7SO 8PDU 6KXDLE IRUPHU FRRUGLQDWRU $EXMD &RUSRUDWH6HUYLFHV
0HWURSROLWDQ0DQDJHPHQW&RXQFLO
3URMHFW0DQDJHU5LWML*RZRQDQG0DUNHLWQJ
*HQHUDO0DQDJHU&RUSRUDWH6HUYLFHV0U)UDQFLV2ORUXQIHPL 'LUHFWRURI&RUSRUDWH6HUYLFHV-LEULO$OL\XDQG0'&(2-LEULO$OL\X 'LUHFWRU2ODZDOH6KRODGHPL
28 localnews@dailytrust.com WEDNESDAY, DECEMBER 9, 2020
ASOCHRONICLE PUBLICATION
FCT
NASARAWA
VOL. 1, NO 107
U
nlike the Kwali Main It was also gathered that it is farm. Bizhiri said, “To God be industries across the country,
Market which holds at the peak of the harvest that She said, “I think the major glory for the harvest of sesame but that lack of government
every four days, the its farmers smile to the bank challenge of sesame farming this year, even though the support had been a major
sesame seed market holds after selling the crop. is that if you are not the lucky price is down compared challenge.
daily with influx of people, Mrs. Asibi Adamu, a type, thieves will invade your with that of last year. I sold According to him, the Kwali
especially sesame farmers sesame farmer, who brought farm at night and harvest the a bag of sesame at N120,000 sesame market had been
who bring the produce to sell a large quantity of the seed crop because there is a lot of last year, but this year it was existing for 10 years, and that
to customers who are always to the market in Kwali, while money in it.” sold at between N60,000 and it was one of the organised
on ground to buy. speaking with our reporter, She explained that a big bag N70,000.” markets of the crop after
Aso Chronicle gathered said she had been into sesame of sesame was sold for between Speaking to our reporter, Dawanau Sesame Market in
that 70 per cent of sesame farming for over 15 years. N60,000 and N80,000. the Vice Chairman of the Kano State.
farmers are women due to its Mrs. Adamu who said she Another sesame farmer FCT chapter of Sesame Seed He explained that over 150
“easy” cultivation and harvest achieved a lot from sesame at the Kwali market, Samuel Traders Association of Nigeria trailers came to the market
process. cultivation, explained that she Bizhiri, from Paiko community (SSTAN), Alhaji Abdulyakeen every harvest season to load
The planting of sesame, built her personal house and in Gwagwalada Area Council, Hassan, said members of the sesame to the far North and
popularly called beniseed, purchased two pick-up vans said he had been into sesame association were responsible industries across the country.
mostly takes place between through the venture. farming for many years and for buying the seed from He further said, “Most of the
September and October when Mrs. Adamu, a Kwali that he had achieved a lot, farmers. people that control the sesame
the rains are subsiding, and its resident, said she always especially building a house Alhaji Hassan said SSTAN business are foreigners.”
A
Barr. Hafsat Sani Kabara, said American citizen on his
47-year-old man,
Whatsapp account and
Abdurazak Abubakar, the case was moved to the
Thai Friendly
accused of sodomising high court following lack of Application, with intent to
a seven-year-old boy was jurisdiction of the magistrate obtain money
yesterday granted bail by a court to grant bail on capital from unsuspecting Asian
high court in Kano after two offences, rape and unnatural women. He was however
years in a correctional facility. offences. given a fine option of
The case was first She said, “The case was N200,000
mentioned at a magistrate first mentioned there; where
court in Gwammaja in Dala we applied for the records
LGA in 2018, but suffered of proceedings and FIR to
several setbacks over time. enable us apply for his bail,”
Abubakar of Layin Gidan adding that “for the past two
Kara, Bachirawa quarters in years the accused has been in
Dala LGA, was said to have on custody.
02/12/2018 lured the boy into “The then judge has been
his provision store where he indisposed having travelled Photo: EFCC
sodomised him. out for medical treatment. We
The victim’s father had
on the same date reported
applied for redirection and it
was redirected to High court $140,000 fraud: EFCC urges court to dismiss
the matter to the police at
Bachirawa station, leading
1, we then applied for his bail
and was graciously granted at Atiku son-in-law’s no case submission
to the arrest and subsequent the first sitting”. From Adelanwa Bamgboye, Lagos sum exceeded the amount Ozekhome, in the
arraignment of the accused The presiding judge, Justice authorized by the law and application, also argued that
in court. Nura Sagir Umar, granted bail The Economic and Financial you thereby committed the prosecution had not lent
The action of the accused, to the accused in the sum of Crimes Commission (EFCC), an offence contrary to any credible evidence in
according to the police first N200,000 with two sureties on Monday, urged Justice Section 18(C) of the Money support of the counts in the
information report (FIR) in like sum with one having Chukwujekwu Aneke of the Laundering (Prohibition) charge preferred against his
deposited at the magistrate landed property in the area Federal High Court sitting in Act, 2011 as amended and client.
court, was an offence and and the other to swear to an Ikoyi, Lagos to dismiss the punishable under Section He, therefore, prayed
contrary to Section 284 of the affidavit. no-case submission filed by 16(2)(b) of the same Act.” the court to hold that “no
Abdullahi Babalele, a son-in- He pleaded not guilty to prima facie case has been
Anambra police arrest law to former Vice President
Atiku Abubakar.
the charge preferred against
him.
established in any way
or manner against the
AREWATRUST
Katsina
Kaduna
A
s part of effort to Government Area. fighting crime and expressed heart-warming and appealed foundation, describing the
assist in curbing Speaking at the presentation the hope that the vehicle and to well-to-do people to gesture as rare.
insecurity in parts of the items at the Kaura the communication gadgets emulate the donors by He assured that they would
of Southern Kaduna, the Council Secretariat, the Chief would be used for their assisting security agents in continue to render security
Amaje Foundation, an NGO, Executive Officer of Bamaje intended purpose. securing the area. services and urged the local
has donated a vehicle and Foundation, Mathew Jerome Also speaking, the Local Responding on behalf of government to assist them in
communication gadgets to Bature, said the donation Government Administrator, the service, the Commandant maintaining the vehicle.
TEAM: General Editor: Yusuf Zango. Arewa Trust team: Lami Sadiq, Maryam Ahmadu-Suka, Mohammed Yaba, Shehu Goro (Photo) Zaria: Isa Saidu, Aliyu Mohammed Baba Karfi Kafanchan: Ahmed Ali Katsina: Habibu Umar, Mahmud Idris Page Designer: Umar Muhsin Ciroma
WEDNESDAY, DECEMBER 9, 2020 localnews@dailytrust.com 31
KANO/JIGAWA Jigawa
CHRONICLE
Kano
T
he impact of the initiatives to save the situation farming techniques were farms but with support from output.
COVID-19 pandemic in most of the affected areas. provided to the farmers the Sasakawa, they were able On his part, the Deputy
coupled with issues In Kano State, farmers in especially the women. to go back to the farm to work Country Director, SG2000, Dr
of insecurity and poor Bagwai Local Government Hajiya Maryam with ease. Abdulhamid Gambo said that
marketing strategies have Areas have received farming Muhammad Kiyawa is Another member of the his organisation intervened in
held back farming activities relief packages from the chairperson of Bagwai association, Malama Binta Kano as well as Gombe State
in some agricultural states in Sasakawa Global 2000 (SG Women Farmers Association Musa Bagwai, noted that the to cushion the heat through
Nigeria leading to a reduction 2000) to cushion the heat of and according to her, life was training they received from linking the farmers with the
in farmer’s productivity. the pandemic on the farmers. very tough for the farmers at SG2000 had accorded them market and also giving them
In response to these The interventions, which the wake of the COVID-19 the privileges of increasing improved seeds and other
impediments, several include improved seeds, pandemic, noting that most their farm’s production as farm inputs.
General Editor: Yusuf Zango Editor: Clement A. Oloyede, Reporters: Ibrahim Musa Giginyu, Habibu Umar Amin, Richard P. Ngbokai, u, Sani I. Paki Page Designer: Umar Muhsin Ciroma
32 localnews@dailytrust.com
EKOTRUST
WEDNESDAY, DECEMBER 9, 2020
Oyo
Ekiti
Osun
Ogun Ondo
Lagos
T
he residents of Jakande demolished town of Maroko up leftover debris caused by Sanwo-Olu to come to their rainy season as a result of
Housing Estate, Eti- in 1990 during the regime of the recent rain in the area. aid. flood.
Osa, have appealed to General Ibrahim Badamosi The chairman of the “We are appealing to the “We have many problems
the Lagos State Government Babaginda as the Head of State Community Development state governor, Babajide that need to be solved but
for the provision of a good and Colonel Raji Rasak as the Association, (CDA), of the Sanwo-Olu, to come to our aid good roads and proper
drainage system to put an governor of the state. estate, Mr. Sulaiman Kazeem, before the 2021 rainy season drainage are very essential for
end to the perennial flooding Our correspondent, who who narrated some of the begins,” he said. now,” noted the Chief Imam
within the area. visited the estate recently, unpleasant experiences of A resident, Pastor Tunji Central
Lagos to review Centre wants speedy trial of cases of violence against women, children
Oba, Chiefs law From Bola Ojuola, Akure women. It also noted that Ondo 16-day of activism against
JDPC also raised the alarm State was the only state in the gender-based violence.
From Adelanwa Bamgboye, Lagos over the increasing rate of South-West yet to domesticate Ogunleye also said there is
Justice Development and
Peace Centre (JDPC) has violence against women, the Violence Against Persons a need for security agencies in
The Lagos State Ministry urging improved life-saving
appealed to Ondo State House Prohibition (VAPP) Act in the the state to do more in terms of
of Justice has begun a services for women and girls.
of Assembly to review and region. prosecuting cases of gender-
stakeholders’ meeting on the The Centre also wants cases
enact the Violence Against The JDPC Programme based violence, adding that the
review of the Obas and Chiefs of Gender-Based Violence to
Persons Prohibition (VAPP) Officer, Mr. Austin Ogunleye, state needs their patriotism in
of Lagos State Law, 2015. be given a speedy trial.
Bill to provide protection for said this in Akure during the fighting the social menace.
The meeting, organised by
the Ministry’s Directorate of
Legislative Drafting, is seeking Court ejects
to update the law to make it
responsive to current realities. man over failure
Emphasising the need
for the review, the Director,
to pay bills
Chieftaincy, Lagos State From Jeremiah Oke Ibadan
Ministry of Local Government
and Community Affairs, Mr A customary court sitting in
Folami Lukman revealed that Mapo, Ibadan, the Oyo State
there were no fewer than 93 capital on Tuesday ordered a
monarchs – 65 of whom are tricyclist, Sadiq Kamorudeen
first class obas – and 10 empty to quit a room he rented from
stools in Lagos State. his landlord, Ajibola Balaro
He said: “The law really at Omikunle Compound,
needs to be upgraded. They Ilupeju, Ibadan.
should help us fast-track this Eko Trust reports that the
review. Everybody wants to petitioner, Ajibola had told
become Oba, chief. Even the court that Kamorudeen
those with red blood, that are who moved into his house
not bluebloods, they want in 2018, arrested him and
to become obas. Let us do instructed the police to detain
something and help our laws him till the following day, due
and help save the state. to an argument that ensued
“The state’s size is not between them.
increasing. As of today, we He further told the court
have 93 Obas on ground; that Kamorudeen and his
about 10 stools that need to be friends had turned his house
Officials of Emergency Flood Abatement Gang (EFAG) evacuating refuse blocking into a shrine where they
occupied.”
drainage system along Lagos/Abeokuta Expressway by Ikeja bus stop in Lagos. deposited sacrifices at will.
Director, Legislative
Drafting of the ministry
December 8, 2020. Photo: Benedict Uwalaka. According to him, his
of Justice, Mrs Aderinsola tenant had stopped paying for
Olarenwaju, explained that the We won't tolerate second round of #EndSARS protest, says Ogun CP electricity supply and security
ministry identified gaps in the From Peter Moses, Abeokuta Oyeyemi, warned against what of properties and loss of lives in the house.
law and set up a committee, he termed EndSARS Phase II, occasioned by the recent Reacting to the allegations,
which came up with a draft The Commissioner of Police in stressing that the command #EndSARS protest would again Kamorudeen said it was true
containing proposals that Ogun State, Edward Ajogun says would not tolerate the second be contemplating another he took the man to the police
were presented at the meeting. no reasonable Nigerian would round of the protest in the state. violent protest so soon”. station because he forcefully
The interactive session revisit the #EndSARS protest His position followed the He, however, urged members disconnected his electricity.
considered amending several following wanton carnage that reported plans to resume of the public and youths not to The president of the court,
sections of the Law, including greeted the nationwide protest protest against police brutality allow themselves to be used for Chief Odunade Ademola
Section 12, which provides that before it was suspended. He said, "except for those who any act capable of undermining ordered the defendant to pay
amendment or replacement Ajogun while speaking see trouble making as a lucrative the peace of the state "as all the outstanding debts and
of registered declaration is through the Command business, no reasonable person such will be viewed with all leave the house on or before
permissible only once. Spokesperson, Abimbola after the massive destruction seriousness." December 15.
General Editor: Yusuf Zango. Regional Editor: Abiodun Alade, Correspondents: Nurudeen Oyewole, Eugene Agha, Sunday Michael Ogwu and Abdullateef Aliyu, Photo Journalists: Benedict Uwalaka, Page Designer:Umar Muhsin Ciroma
WEDNESDAY, DECEMBER 9, 2020 localnews@dailytrust.com 33
CALIPHATETRUST
Sokoto
Zamfara
Kebbi
W
orried by the activities Muhammad said he had just because I didn’t have my own because I have been coming from perpetrating criminal
of bandits in their started the business when he cattle but I cannot continue to here for long and have many acts because it was against the
various communities saw others engaged in it. risk my life for the little money customers,” he said. tradition, religion and humanity.
some Fulani youths have now “I only wash one or two cars they were giving me. Haruna, who said he has Yusuf Gandi, who works at the
flooded the state capital, Sokoto, in a day and get N300 to N400 Ibrahim Haruna, another never attended conventional secretariat said they were used
doing menial jobs. which is sufficient for my daily Fulani man engaged in car wash school, however, declared his to some of them and had so far
Caliphate Trust reports needs,” he said. said he was getting substantial interest to pursue western no problem with their activities.
that many of them have now Muhammad, who hails from return from the business. education. “They are doing this business
taken to washing cars at public Tangaza Local Government He said he washed up to “I even talked with one of to earn a living. I know some of
places such as the state’s Shehu Area, which is most affected 10 cars in a day, which was my customers. The owner of them who now own shops in
Kangiwa Secretariat. by the activities of the bandits, sufficient to feed and save from. this car that I am washing, and the Sokoto Central market and
One of them, Nasir said he was forced to leave his According to him, he decided he promised to enrol me. I am they are doing well.’’
Muhammad, said he now village. to run a carwash business still waiting for him to fulfil his Caliphate Trust reports that
makes a living from washing He said he abandoned cattle because he hated begging. promise,” he said. the youths are highly patronised
cars, adding that he and his rearing because it was no longer “This is what I have been He expressed concern over because they charge as low as
friends visit public places where safe because of the activities of doing to earn a living. I don’t the activities of bandits whom N150 per car.
NDE disburses
MEE loans to
1,600 women,
youths in Kebbi
The National Directorate of
Employment (NDE) in Kebbi
has disbursed the Micro
Enterprises Enhancement
Loans (MEEL) to 1,600
women and youths in Yauri
and Zuru Local Government
Areas of Kebbi.
The Director-General of
the agency, Dr Nasiru Ladan-
Argungu, while disbursing
the loans to beneficiaries
in Yauri LGA on Monday,
said the loans were part of Nasir Muhammad
the directorate’s statutory
function to generate jobs
through skill acquisition and 500 students trained on Gender Based Violence in Kebbi
entrepreneurship. From Aliyu M. Hamagam, Birnin Kebbi At the training, they were violence. would continue to live in pain
“The loans disbursed to the taught how to be a protector The Project Manager of inasmuch as she did not speak
women and youths in Yauri About 500 secondary schools but not a perpetrator as well WARIF, Mr. Adeyemi Asaba, out when sexually abused.
and Zuru local government students comprising boys as speak out on gender based told the participants to be good She urged mothers to also
areas are to enable them to and girls received training on violence. ambassadors of GBV campaign muster courage and speak out
revive their small businesses Gender Based Violence (GBV) Also as part of effort to as the training was meant whenever their daughters fell
that were affected by the at a three-day programme bring GBV under check, Boys to inculcate in them how to victim of sexual molestation as
COVID-19 pandemic. organised by Women At Risk Conversation Cafe (BCC), was become better parents. that is the only way to check the
“It is the statutory mandate International Foundation rolled out under which the boys He urged the boys to be ugly trend.
of the NDE to disburse loans (WARIF) in collaboration are trained as role model for protectors of Gender Based She called on the students to
to unemployed persons in with Kebbi State Ministry of GBV campaign. Violence by using their establish Gender BasedViolence
order for them to start up Education. Participants are expected muscularity. clubs in their respective schools
businesses with their skills The training, which took to cascade the training to The Executive Secretary saying, through such clubs the
and become self-reliant, as place in Jega and Kamba, drew their individual communities of Secondary Schools campaign would be dominant
well as become productive participants from 11 secondary with a view to promoting the Management Board, Nana not only in schools but in the
members of the society,” he schools across the state. campaign against gender Asma’u Alkali, said the girl child larger society.
explained.
The director-general,
who was represented by APGA set for Dec 9, supplementary election in Zamfara
Kebbi State Coordinator, The All Progressives Grand INEC also fixed Wednesday, and APGA is among them. the election could be a big
Alhaji Abdullahi Danjuma- Alliance (APGA) has expressed Dec. 9, for supplementary “We agreed with INEC threat to security.
Machika, advised the readiness for the Dec. 9, election in the 14 polling units decision to conduct the election “As a political party, we don’t
beneficiaries to use the supplementary election for the that were cancelled. and finish it so as to douse the want to create situations that
loans judiciously to assist Bakura State constituency seat Shinkafi said APGA was political tension in the state. will lead to security breach in
themselves, family members in Zamfara. among the 11 political parties “We all know that Saturday’s the state,” Shinkafi said.
and their communities at Alhaji Sani Shinkafi, the state that agreed to take part in the election was faced with However, some of the political
large. spokesman for the party, said election. serious security challenges parties that participated in the
Some of the beneficiaries this at a news conference in “INEC invited us for a such as thuggery, election box Dec. 5, election have rejected
thanked the NDE for finding Gusau on Tuesday. meeting yesterday and all snatching and others,” he said. the decision to conduct the
them worthy to benefit from The Independent National the 14 political parties that He added: “There was supplementary election on
the loans. Electoral Commission participated in the election serious violence, during the Dec. 9.
They promised judicious (INEC) had declared the Dec. attended the meeting. poll; we never experienced The All Progressives Congress
use of the loans to commence 5, by-election in the state “Out of the 14 political such situation in the history of (APC) and Action Peoples Party
repayment in time to allow as inconclusive following parties, 11 agreed with the the state. (APP) who were among the
others to benefit from the cancellation of results in 14 decision of INEC to hold the “We know the security parties urged INEC to shift the
scheme. (NAN) polling units due to over voting. election tomorrow, Wednesday, situation in the state; extending election by two weeks. (NAN)
TEAM: General Editor: Yusuf Zango. Caliphate Trust team: Abubakar Auwal (Sokoto), Aliyu Hamagam (Kebbi), Shehu Umar (Zamfara) Page Designer: Musa Yusuf
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
34 Follow us on Twitter: @dailytrust IT WORLD
EVERYDAY TECHNOLOGY OGY Safe browsing on the internet
With Prof. Foluso Ladeinde By Zakariyya Adaramola
M
State University of New York, Stony Brook, USA
any internet users
foluso.ladeinde@gmail.com innocently pick
up spyware or
A week on iPhone 12 Pro Max download malware or visit
fraudulent sites while surfing
L
et me tell you what me the directions to do this, the web. Although we do not
to expect from the which include downloading a have to be afraid of every
newly released iPhone “data transfer” app developed click we make, we should
12 Pro Max smartphone by my carrier, and ensuring take some precautions to stay
manufactured by Apple, based that my old phone (Galaxy safe while browsing.
on my using the device for Note) and new phone (iPhone) Keep your browser
a week. Although I have an were connected to the same updated
older version of iPhone, for network, which, in my house, New malware and phishing
the most part, for the past five is the 5G network. The Galaxy threats are constantly being
or so years my smartphone would give a QR code, which introduced by hackers. So
staple was Samsung, Samsung would read by the iPhone to get it is important to keep your
Galaxy Note, to be exact. I really them connected so that data browser updated. Make sure
didn’t want to switch from could flow between them. This you have the latest version of
Samsung to iPhone because I process is quite simple, except your browser. Not only that,
feel, and I believe it is true, that that getting iPhone to read the make sure you have installed
Android-based phones like the QR code was less intuitive than all recent updates.
Samsung products are more one would have expected. I Domain checking site. CNET is one reputable time.
advanced, particularly for the needed to place the back face of Malicious sites often use site where you can download Be cautions of P2P file
power user. Advanced in terms the iPhone on the front face of deceptive domains to trick files that have been checked sharing
of configuring the phone to the Galaxy to read the QR code users into believing they are for malware, spyware or Peer-to-peer (P2P) file-
do telco stuff like networking onto a square on the iPhone. on a legitimate site. Internet adware. sharing programs like
or deploying it as a surrogate This was the only hitch in the Explorer has a feature called Avoid illegal downloads BitTorrent and LimeWire
for a desktop. The iPhone felt process. Domain Highlighting for When you illegally have been known to contain
like a toy for the most part. It The first observation I checking domains. download copyrighted malware, adware, and illegal
was easy to use, but in those made was during unpacking. Download from trusted material like music, books, downloads. Therefore it is
days cell phones offered few That is, the packaging is a bit sites software, games, and videos, best to practise caution when
functionalities. I dabbled into more modest than those from Don’t download from a you are violating laws which downloading and sharing
the HTC products, which ran Apple in the past. Apple talks website unless you trust the can lead to fines and even jail from P2P sites.
Microsoft Windows Mobile up the unpack event of its
operating system,
switching to Galaxy Note,
before smartphones,with an unwritten
reference to the superior high 40m Nigerians use smartphones – Jumia
which is driven by Android. This quality of the package. So, I was By Zakariyya Adaramola smartphone users conducted said.
memory of iPhone stayed with a bit underwhelmed. Another in 2018. According to her, the
me for years. Moreover, Android observation I made is that the About 40million Nigerians The Country Manager, increase level of internet
products later incorporated pin code to the iPhone had now use smartphones in Jumia, Omolara Adagunodo, penetration would keep
some of the jazzy stuff that changed from four digits that the country, an online store, disclosed that 67 per cent pushing number of
iPhone is known for. But Apple I used on my old iPhone and Jumia Nigeria has said. of Nigerians would be using smartphone users up.
seems to be the master of my current iPad, to 6 digits, for Jumia in a virtual press smartphones by 2025. She said Jumia remained
jazziness. stronger security. Also, two- briefing said the figure was “This showed that Nigeria the online store to beat its
Why did I switch to iPhone? level authentication is now an increase of 4m from 36m it still has a large market for customers keep increasing by
My family. Everyone in my enforced, although sometimes got from a survey of Nigeria’s smartphones’’, Adagunodo the day.
immediate family – wife and it feels like the authentication
my three daughters - uses
an iPhone. Perhaps more
levels are three: the pin code,
my phone number, and my NDIC chairman donates JAMB ICT Centre to Ogun school
compelling is Face Time. apple ID credentials. I have not From Peter Moses, Abeokuta CCTV cameras. examination for students and
Because I did not have an setup the phone to use my face Speaking at the aid digital learning.
iPhone I could not Face to login into the device. (This The Chairman of the inauguration, Sokefun said The NDIC Chairman also
Time my daughters and the feature is embedded in FACE Nigeria Deposit Insurance the centre would ease the disclosed that the body
grandchildren on demand. ID.) Corporation (NDIC), bottleneck associated with had committed over N1
This is was a problem that I With my iPad synched to my Mrs Ronke Sokefun has students’ writing of JAMB billion into community
had to resolve. To cut the long iPhone, the two interoperated donated a state of the art examinations in the area. development projects across
story short, I logged into my seamlessly. It was magical that Information Communication She said students in the the country.
account with my phone carrier, I could access downloaded Technology (ICT) centre to area over the years travelled According to her, the
AT & T, evening of Sunday, 22 iTunes music located in my iPad Comprehensive High School, as far as Ibadan and Lagos NDIC has facilitated over 100
November 2020, and asked on the iPhone via streaming. Ayetoro, a community in Yewa in their quest to write JAMB community development
to have iPhone 12 Pro Max The speed of the iPhone is North Local Government examinations. projects in different parts
shipped to me. The bill for my phenomenal, compared to Area of Ogun State. Sokefun who variously of the state as parts of the
choice of 512 GB disk storage anything I have used recently. She graduated from the served as Commissioner corporation’s Corporate
model is $1,399, although I For example, you can never Comprehensive High School, for Agriculture, and later Social Responsibility (CSR)
didn’t have to pay cash down enter your pass codes too fast Ayetoro, over 30 years ago. posted to Urban and programme.
to have the phone shipped to – the device will process it. Well, The centre which will be Regional Planning, said she In his remarks, Governor
me. The cost would be added iPhone Pro Max is advertised as used for the Joint Admission had nursed the lofty idea of Dapo Abiodun said the
to my monthly bills with my 5G, although most of the time, and Matriculation Board donating a world class facility donation was in line with
carrier. To my pleasant surprise, 4G LTE shows up in the display. (JAMB) examination in the to the school. adopt a school or give back
FedEx shipment arrived the day The design of the phone is well area, boasts of 200 computer She noted that the to the schools as business of
after I placed the order; that is thought out, and app icons systems, two back up power internet enabled centre education is the business of
Monday 23 November 2020. stay where they are placed, supply, generating set and would enhance seamless all.
The following day I visited the unlike in my Galaxy Note. The
local office of my carrier to App library groups the apps
have my service switched from
Galaxy Note to iPhone 12 Pro
according to type, which I like.
Accessing stuff on the iPhone
Nigerian joins Forbes technology council
Max. is infinitely easier than on From Christiana T. Alabi, Lagos Founder and Chief Operating Scott Gerber, founder of
The process went very Android devices because of the Officer of Digital Encode Forbes Councils welcomed
fast. It turns out that the sim apparently superior design. A Nigerian IT expert, Dr Limited, was vetted and Obadare into the community,
card on the iPhone had been Not minding the slightly Obadare Adewale has selected by a review committe noting that the Forbes
customized for me when I inferior battery life of iPhone been accepted into Forbes based on the depth and Councils’ mission is to bring
placed the order, so that no when compared to that of Technology Council, an diversity of his experience as together proven leaders from
new card needed to be installed competing devices, I am afraid invitation-only community criteria for acceptance. every industry, creating a
at the local office. My mobile that the ease of use of iPhone for world-class Chief This include a track record curated, social capital-driven
account was finally switched. could get me hooked for a long Information Officers (CIOs), of successfully impacting network that helps every
Then I needed to transfer time. With so many features Chief Technology Officers business growth metrics, member grow professionally
my data (contacts, photos, and apps, the dearth of geek (CTOs) and Technology as well as personal and and make an even greater
miscellaneous data, etc.) to my tech in iPhone is not as obvious Executives. professional achievements impact on the business
new phone. The attendant gave anymore. Obadare who is the Co and honors. world.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 35
PORTS AUTHORITY WEEKLY
Co-created content
EVERY WEDNESDAY
Jakys Terminals ready for commissioning Kaduna Dry Port Receives More Endorsement
from Private Sector
There are strong indications that one of the
biggest container terminals in Lagos, Jakys
Container Terminals, may be commissioned
before the end of this month.
The multi-million naira container terminals
located in Satellite town, Ojo, Lagos would also
reduce the congestion witnessed in both Apapa
and Tin-Can Island seaports.
Aside congestion, it is expected that by the
time the container terminal come mainstream, it
would also help to reduce gridlock experienced
by port users on the Apapa and Tin Can Island
Port access roads.
Jakys Nigeria Limited which is located along
Kirikiri-Ojo water channel occupies about 32,000
Square metres and is expected to accommodate
over 5000 containers and over 25 trucks loading From left: Mr. Rasaki Salami, Warehouse Manager, KIDP; Olugbenga Owolabi, AGM- Commercial, ICNL;
at the same time. Ms Victoria Akai, Director General, Abuja Chambers of Commerce and Industry; Rotimi Raimi-Hassan,
The Managing Director and Chief Executive Port Manager, Kaduna Dry Port; Mallam Olawale Rasheed, Executive Director, ACCI; Mr. Ebenezer Iguoro,
Officer (MD/CEO) Jakys Nigeria Limited, Sir Technical Assistant to DG ACCI, during a recent sensitisation meeting between Kaduna Dry Port and Abuja
Henry Muogho, in a chat with our correspondent Chamber of Commerce and Industry.
said the management has also concluded plans
to site two more container terminals in Lagos and Following a recent sensitisation drive and Dry Port,” said the newly introduced
Managing Director, Jakys Terminal, Sir Henry
Ogun States respectively. series of business meetings aimed at drawing Automated System for Custom Data is a
Muogho, at the recent launch of the Police awareness to the Kaduna Inland Dry Port, more computerized system designed to administer a
Muogho while conducting officials of the Community Relations Committee (PCRC) Port members of the organised private sector has country’s customs.
Nigerian Ports Authority (NPA) on an inspection Authority Command, calendar held on Saturday at assured of using the facility “The aim is to build a computer system to assist
tour of the facility, said the terminal is over 95 the Lagos Ports Complex The series of engagements saw officials of the customs authorities (or their local equivalents)
percent completed port visiting notable private sector organisations all over the world to automate and control their
He said the strategic location of Jakys terminal and deepen engagements with government core processes and obtain timely, accurate and
Speaking, he said “Here is going to be like agencies like the Nigeria Customs Service. valuable information to support government
in Ojo would aid the easy clearance of cargos by According to the Port Manager, Rotimi Raimi- projections and planning.
a throuput jetty, no third party containers are
importers in Alaba and Trade fair markets. Hassan , the enlightenment drive to bring the “This system saves time and gives room
allowed to come in here, as you can see, it is only
Aside decongesting the Lagos Ports, he said, ease of doing business and trade facilitation for thorough clearance that would allows for
MSC containers that we have here, this means advantage of Kaduna Inland Dry Port to northern seamless transaction,” he added.
importers and exporters can now get their goods
there is also a call up system for trucks to come stakeholders to the fore. Mohammed Mustapha, Representative of
faster, instead of having them stay a day more
in here” Raimi-Hassan said potential port users should the Standard Organisation of Nigeria (SON) in
and paying huge demurrage. see the facility as a destination of choice for Kaduna applauded the operational standards put
“We have an MoU with the community that
He said NPA and terminal operators have northern businesses involved in importation and in place by KIDP saying the Port had provided a
made us to build the roads, this was part of the
increasingly looked at the hinterland to support export cordial working environment for SON to carry
lease agreement with MSC and Medlog” Endorsements and commitments for out it statutory function.
their core business, a strategy, which according
“Trucks that are coming here would not be patronage were secured from Abuja Chamber On his part, Mu’azu Abdulkadir, representative
to him, has often led to the setting of inland
parking on the road, therefore, the nuisance of Commerce and Industry (ACCI), Peugeot of National Food Drug Administration and
intermodal facilities. Automobile Nigeria (PAN) and others Control (NAFDAC) in Kaduna said the agency
value that we have at other ports and terminals, I
He said such a strategy takes different form “Kaduna Inland Dry Port was commissioned had also stepped up it’s operations to world
dont want to import them here”
based upon market conditions i.e balance on January 4, 2018, and since then we have been best practices especially in documentation and
“I also do not want to put the residents into operating. Although we have had little challenges analysis.
between imports and exports and the availability
confusion, that is why we say that there must which I believe is now sorted and that is why we “With the introduction of Post Inspection
of land and infrastructure connecting a port with
be a call up system for trucks coming into the are reaching out to you. Data Capture and Risk Management System
inland intermodal centers. “We looked at it that Abuja being the foremost (PIDCARMS), work especially at the KIDP has
terminals, they come in numbers, when they are
“Jakys container terminal strategically located destination of chamber and commerce in the been made a lot easier,” he noted
going back they go in tens”
along Kirikiri-Ojo water channel is few kilometers country, it will be the best place for us to come The events which attracted participants
“We have been carrying out partial operations and seek for support and partnership, because we from across representatives of manufacturers,
away from Alaba international market and trade
for eight months now and there has been no believe most of the big companies are established business groups and persons from all works of
Fair complex. These two markes are the biggest in
complaints from the community. It is not a here, in terms of trade, commerce and industries. life particularly those
the West Africa sub-region. “Kaduna Inland Dry Port being the first dry The Director General of Abuja Chamber
container depot as such, but a throuput terminal”
“Jakys container terminal is able to handle port in the country, has a reason why it was of Commerce and Industry, Ms Victoria
he said
over 5000 containers at a go and we are targeting established and we are here to present a slide to Also commended the initiative by the port
The Jakys Chief Executive Officer explained show you all our operations and facilities so that management to interface closely with her
two more major terminal. Another one in Lagos
that the condition for liaising with Medlog and you can help us tell other members to patronise organisation.
and the second in Ogun state.
MSC Shipping was that first, they must have a Kaduna Inland Dry Port. She also urged KIDP to leverage on its reach to
“With Lagos Ports accounting for about 80 “In addition to that, the objective is to connect it’s many members and affiliates while
truck park, and they already have it for all their
percent of all the container cargos coming in to discongest the port and help shippers in the assuring of robust relationship with the port.
trucks coming to pick cargoes at the terminal.
the country. Jakys is expected to handle about north to enjoy the same facilities the southern She also described the port as a laudable
According to him “You cannot see any truck importers are enjoying. At the same time, to help initiative that proffers answers to multiple
100,000 TEU per year” he added.
parked on the roads. And in the case of a truck both the commerce industry to promote their business needs of the chamber and other
From all indications, Jakys would handle
breaking down, two hours were given to them to businesses” Raimi-Hassan said. businesses requiring their services in states
import and export cargo from East and North The Port organised its maiden Business Talk enjoying proximity with the port location.
move the truck.
which are conveyed by truck and rail. where it rolled out improved operational plan The ACCI DG said “You can use our network
He described the project as a triple plan with
The initial intermodal capacity of the facility is ahead of 2021 to market the inland dry port. We have a very
holding bays and truck parks being within same Mr Rotimi Hassan, the Port General Manager good relationship with the shippers council as
about 5,000 TEUs, but can be expanded through
vicinity. spoke during the maiden edition of KIDP annual well. We are in the process of concluding a formal
phases to a capacity above 100,000 TEU.
He explained that there is a call-up system from Business Talk held in Kaduna. memorandum of understanding with them on
In its current setting, the terminal provides Hassan noted that the event was aimed at
the truck park around Trade Fair Complex along various activities.
two major roads directly connected to the Mile seeking Port patronage from manufacturers and
Badagry expressway to the bonded warehouse. “It will be nice to build your relationship
2 - Badagry expressway, placing it in an unique business groups in Kaduna.
There is also a call-up system between the jetty “It is my pleasure that the KIDP will very soon with us, leverage on our networks as we can
competitive position.
and the bonded warehouse. start receiving cargoes by rail, from the first market the inland dry port to our members and
One of the key advantages of the facility is its partners, because of our position in Nigeria and
“When the terminal becomes fully operational, quarter of 2021, which will in no doubt reduce
direct connectivity to both the sea and road. the cost of transportation of cargos to KIDP from relationship with NACCIMA. We and NACCIMA
the traffic volume on our roads would be reduced
This distance is at the threshold of commercial Lagos seaports. both leverage on each other’s strenght.
by not less than 50 per cent”
competitiveness for rail services in future. “We look forward to your patronage as the “We also work closely with the Federation
“While using the bridges as holding bay would KIDP is being strategically positioned for your of West African Chambers of Commerce and
Presently, the terminal is accessed by barges
no longer be happening as there would be no shipping services to allow you clear your import Industry. So I think our relationship will be very
from any of the port terminals, while trucks come
need for that any longer” consignment right here and the same time beneficial. You are already working with the
in through the roads to evacuate the containers forward your export goods from Kaduna Inland advocacy centre, so let us work together and I
“On the other hand, when other companies
around Satellite Town, Lagos. Dry Port to final destination ports abroad,” he believe we will make a lot of progress. Thank you
do same thing, the gridlock would be totally
Sir Henry as he is fondly called, told journalists explained. very much.
eliminated, bridges saved, money spent by Also, Deputy Controller of Customs, “Kaduna is my home town and I am so happy.
that the terminal was leased to Mediterranean
Government for road maintenance would reduce, Mohammed Yusuf of the Kaduna Command I am more relaxed when talking to other people,
Shipping Company (MSC Shipping) and its
and the suffering Nigerians are subjected to on a in a lectured delivered at the occasion tagged, but because it is Kaduna, I have this sentiment
logistics arm; Medlog with a lease agreement of “Process of Customs Documentation and about it. I am here for you. We are here for you as
daily basis would be eliminated completely”
5years. Seamless Delivery of Cargos at Kaduna Inland a chamber, honestly,” she assured.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
36 follow us on Twitter: @daily_trust
.$76,1$67$7(*29(510(172)1,*(5,$
0,1,675<2)5(6285&('(9(/230(17
.$76,1$
,19,7$7,21)25(;35(66,212),17(5(67)25/($6(2535,9$7(3$571(56+,32)12
)(57,/,=((5&277$*(,1'8675,(6/2&$7('$7%$.25,%$76$5,6$)$1$$1'0$,
$'8$
7
KH .DWVLQD 6WDWH JRYHUQPHQW XQGHU WKH )XOO QDPH RI FRPSDQ\ DQG FRQWDFW SHUVRQ
OHDGHUVKLSRI+LV([FHOOHQF\5W+RQ$PLQX SRVWDO DGGUHVV WHOHSKRQH QXPEHU DQG ( 0DLQ
%HOOR 0DVDUL LV LQYLWLQJ LQWHUHVWHG DQG DGGUHVV
TXDOL¿HGFRPSDQLHVWRH[SUHVVLQWHUHVWLQWKHOHDVH
RUSULYDWHSDUWQHUVKLSRILWV1RIHUWLOL]HUFRWWDJH &HUWL¿FDWHRILQFRUSRUDWLRQIURPWKHFRUSRUDWH
LQGXVWULHV ORFDWHG DW %DNRUL %DWVDUL 6DIDQD DQG DIIDLUVFRPPLVVLRQ&$&
0DL
DGXDUHVSHFWLYHO\
7KH LQGXVWULHV FRQVLVW RI D FKHPLFDO IHUWLOL]HU (YLGHQFH RI )LQDQFLDO &DSDELOLW\ %DQN
EOHQGLQJ 0HWULF WRQ EDWFK ZLWK D GDLO\ 5HIHUHQFHOHWWHU
SURGXFWLRQ FDSDFLW\ RI 0HWULF WRQV RI DVVRUWHG
13. IHUWLOL]HU HWF WKUHH 7HFKQLFDODQGRSHUDWLRQFDSDELOLW\
JUDQXODWRUV IRU PDUO DQG RUJDQLF IHUWLOL]HU
JUDQXODWLRQDZDUHKRXVH.9$*HQHUDWRUDQGD 3UR¿OH RI 0DQDJHPHQW DQG WHFKQLFDO VWDII
TXDOLW\FRQWUROODERUDWRU\ VKRZLQJTXDOL¿FDWLRQDQG\HDUVRIH[SHULHQFH
LQFDVHRIOHDVHRSWLRQ
,QWHUHVWHGFRPSDQLHVFDQFRQWDFWWKH0LQLVWU\IRU
SK\VLFDOLQVSHFWLRQRIWKHSODQWVDW1R+DVVDQ $OOH[SUHVVLRQRILQWHUHVWLQ)LYHFRSLHVVKRXOGEH
8VPDQ5RDG*5$.DWVLQD VXEPLWWHGLQDVHDOHGHQYHORSHDQGPDUNHGµ(2,
IHUWLOL]HU &RWWDJH ,QGXVWULHV¶ 1RW ODWHU WKDQ WKUHH
5(48,5(0(176 ZHHNV IURP WKH GDWH RI SXEOLFDWLRQ WR WKH
+RQRXUDEOH &RPPLVVLRQHU 0LQLVWU\ RI 5HVRXUFH
3URVSHFWLYH FRPSDQLHV VKRXOG SRVVHVV WKH 'HYHORSPHQW 1R +DVVDQ 8VPDQ 5RDG *5$
UHOHYDQW WHFKQLFDO DQG ¿QDQFLDO FDSDELOLWLHV WR .DWVLQD
RSHUDWHDIHUWLOL]HUEOHQGLQJSODQW
$OOHQTXLULHVVKRXOGEHGLUHFWHGWR
7KH FRPSDQLHV VKRXOG SRVVHVV DQG WHQGHU WKH
UHFRUGRIVXFFHVVIXORSHUDWLRQDQGPDQDJHPHQWRID L 7KH +RQRXUDEOH &RPPLVVLRQHU 0LQLVWU\ RI
IHUWLOL]HUEOHQGLQJSODQWLQ1LJHULDRUDQ\ZKHUHLQWKH 5HVRXUFH'HYHORSPHQW
ZRUOG 7HO
(PDLOLPDPDEGXOODKL#\DKRRFRP
02'(2)$33/,&$7,21 LL 7KH3HUPDQHQW6HFUHWDU\0LQLVWU\RI5HVRXUFH
,QWHUHVWHGFRPSDQLHVVKRXOGLQGLFDWHWKHLULQWHUHVW 'HYHORSPHQW 1R +DVVDQ 8VPDQ 5RDG
E\ SURYLGLQJ WKH IROORZLQJ LQIRUPDWLRQ DQG *5$.DWVLQD
GRFXPHQWV 7HO%R
(PDLOKPXVD#JPDLOFRP
6,*1('
$OK+DVVDQ0XVD$QGD
3HUPDQHQW6HFUHWDU\
0LQLVWU\RI5HVRXUFH'HYHORSPHQW
.DWVLQD6WDWH
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
INTERNATIONAL follow us on Twitter: @daily_trust 37
AROUND THE
WORLD
GHANA ELECTION
T
he race between are announced. control three out of five
incumbent Nana The NDC, in its regions in the north, The burnt electoral commission office at Fomena due to fire outbreak,
Akufo-Addo’s APP provisionary vote, had including the Savannah after collating results, in the early hours of yesterday. Ghanaians voted on
and former president claimed 36 flipped region where Mahama Monday in an election seen as a close fight between President Nana Akufo-
John Mahama’s NDC parliamentary seats last comes from. Addo and his longtime rival John Mahama Photo: AFP/Nipah Dennis
party is tight with both night, including some Although some
losing
seats.
parliamentary wins in the capital.
The implication
parliamentary seats
have flipped, according
Ghana postpones announcement of presidential result
being that these are to John Boadu, the The Ghana Electoral afternoon, the EC said it accurate and reflective
Also, the longtime
highly populated areas NPP Secretary-General, Commission has will extend its intended of the will of the people,
presidential opponents
and if those results are despite having lost announced that its timeline for declaring the commission entreats
have continued to claim
confirmed, it would some seats, the NPP has timeline has been the 2020 presidential the public and all
wins as early results
undoubtedly help the won, holding a 63 seat delayed until further election results. stakeholders to exercise
continue to trickle in.
presidential totals. majority over the NDC. notice. This is coming “The new timeline patience as the collation
John Mahama of NDC
The NDC would need Akufo-Addo posted despite promises of a will be communicated process continues in
tweeted a thank you
to win at least 32 more several messages speedy counting of votes shortly,” it said. the presence of political
message to Ghanaians
seats and hold the 106 throughout the voting to make known to the It said the party agents and election
for opting for change
that it currently controls day, urging Ghanaians electorate the winner commission has observers.”
five hours after voting.
to win a majority in to get out and vote. of Jubilee House, the continually reiterated “The commission
He has been telling
Ghanaian seat of power. that “transparency, thanks all the registered
I have not congratulated any person – Mahama Results were expected integrity and fairness voters that turned up in
to be released officially at are the yardstick by their numbers to vote on
The presidential expressed in us and it is attempt to subvert the
5 pm on Tuesday by the which it conducted 7th December 2020 and
candidate of the clear the people want a will of the people.”
electoral commission, the 2020 presidential reminds the public that it
National Democratic change in this country.” Mr Mahama said
making it one of the and parliamentary remains the only legally
Congress (NDC), John “Ghanaians are tired some of the things
fastest turnover elections elections.” mandated body that can
Dramani Mahama, says of Akufo-Addo and his that are happening are
in Africa and the world. “As such, to ensure that declare presidential and
he has not congratulated government. We thank “unacceptable and Nana
In a press statement the declared presidential parliamentary election
any person for winning the electorate for giving Akufo-Addo continues to
issued Tuesday results are 100% results in Ghana.”
the 2020 presidential us a working majority in show credentials that are
election. Parliament, 140 seats in very undemocratic. You
“I want to state Parliament, which is a cannot use the military 6($5&+)25&20021*5281'1,*(5,$
categorically and majority and no attempt to try and overturn the
firmly, that I have not should be made to results in constituencies 5)3126)&*1,*
congratulated any subvert that. that we have won.”
person. And no attempt “I have looked at the He said the right ,QYLWDWLRQWR%LG
should be made to steal results we’ve collated thing must be done and
6
HDUFK IRU &RPPRQ *URXQG LV DQ *HQHUDO5HTXLUHPHQW
this election; we will so far and I’m excited the NDC has collated 48$/,),&$7,215(48,5(0(176
LQWHUQDWLRQDO QRQVHFWDULDQ QRQ
resist it,” he said. and I’m happy with the its results and will give ,Q RUGHU WR EH FRQVLGHUHG IRU SUH
SUR¿W RUJDQL]DWLRQ SDUWQHULQJ ZLWK
At a press briefing on results. We’ve won in 10 further details later. He SHRSOHDURXQGWKHZRUOGWRLJQLWHVKDUHG TXDOL¿FDWLRQLQWHUHVWHGDQGFRPSHWHQW
Tuesday night, Mahama regions out of 16 and the urged NDC supporters VROXWLRQVWRGHVWUXFWLYHFRQÀLFWV FRQWUDFWRUVVXSSOLHUVVKDOO
said, “We thank the Ghanaian people have to remain calm as “we VXEPLWWKHIROORZLQJ
Ghanaian people for expressed confidence in wait for the final verdict,” D&RPSDQ\
V3UR¿OH
6HDUFKZRUNFXWDFURVVDOOOHYHOVRIVRFLHW\ E (YLGHQFH RI UHJLVWUDWLRQ ZLWK &RUSRUDWH
the confidence they’ve us and we will resist any he added. WREXLOGVXVWDLQDEOHSHDFHWKURXJKWKUHH $IIDLUV&RPPLVVLRQ
PDLQDYHQXHV F(YLGHQFHRI7D[UHJLVWUDWLRQ
ETHIOPIA G(YLGHQFHRIVLPLODUMREFDUULHGRXW
Tigray crisis: UN team fired at 'on way to refugee camp' 'LDORJXH0HGLD&RPPXQLW\ H (YLGHQFH RI ¿QDQFLDO FDSDELOLW\ RU EDQN
VXSSRUW
Ethiopian troops shot at that Eritrean troops are in incident. Many Eritreans 6HDUFKKDVEHHQZRUNLQJLQ1LJHULDVLQFH
and detained UN staff after Tigray to help defeat the have fled across the XVLQJ LQQRYDWLYH DSSURDFKHV WR & 2 / / ( & 7 , 2 1 2 ) 7 ( 1 ' ( 5
they drove through check- TPLF. border to Tigray over the '2&80(1763(&
SURPRWH SHDFH EXLOGLQJ LQ DUHDV RI
7KH WHQGHU GRFXPHQW LV REWDLQDEOH E\
points in the conflict-hit The UN has appealed to years to escape military WHQVLRQDQGWRHQFRXUDJHXQGHUVWDQGLQJ
VHQGLQJDPDLOWRQLJHULD
northern Tigray region, the Ethiopian government conscription and political DFURVVHWKQLFUHOLJLRXVDQGJHQGHUOLQHV SURFXUHPHQW#VIFJRUJ 'HDGOLQH IRU
government spokesman to give it “unfettered persecution. :LWK RI¿FHV LQ $EXMD -RV 0DLGXJXUL UHTXHVWLQJ WKH WHQGHU GRFXPHQW LV
Redwan Hussein has humanitarian access” Eritrea is a highly <ROD%D\HOVDDQG:DUULZHDUHZRUNLQJ 'HFHPEHU
confirmed. to Tigray amid concern militarised one-party WR DGGUHVV FRQÀLFW XWLOL]LQJ FRQVHQVXV
The UN team ignored about food shortages state that has been EDVHG DGYRFDF\ WUDLQLQJ FRQÀLFW ',6&/$,0(5$1'&21&/86,21
instructions not to be and medical supplies in a ruled by President Isaias UHVROXWLRQ WUDLQLQJ KXPDQ ULJKWV 6HDUFK )RU &RPPRQ *URXQG ZLOO 127 EH
PRQLWRULQJ DQG UHSRUWLQJ DQG WKH UHVSRQVLEOH IRU DQ\ FRVW RU H[SHQVHV
in the area, he added. region with a population Afwerki since it gained
IDFLOLWDWLRQ RI GLDORJXH SURFHVVHV WKDW LQFXUUHG E\ DQ\ LQWHUHVWHG SDUW\ V LQ
Government forces have of more than eight million. its independence from FRQQHFWLRQ ZLWK DQ\ UHVSRQVH WR WKLV
been battling the Tigray “Some of the UN staff HQJDJHDOOOHYHOVRIVRFLHW\
Ethiopia in 1993. LQYLWDWLRQ DQG RU WKH SUHSDUDWLRQ RU
People’s Liberation Front were actually detained Ethiopia’s Prime VXEPLVVLRQLQUHVSRQVHWRDQLQTXLU\
,Q DFFRUGDQFH ZLWK WKH GXH SURFHVV IRU
(TPLF) in the region since and some were shot at,” Minister Abiy Ahmed won
DZDUGRIFRQWUDFWV6HDUFKIRU&RPPRQ
4 November. The UN team Mr Redwan was quoted the Nobel Peace Prize last *URXQG 1LJHULD LV VROLFLWLQJ FRPSHWLWLYH
6HDUFKIRU&RPPRQ*URXQGLVQRWERXQGWR
was reportedly trying to by AFP news agency as year for making a deal with VHDOHG ELGV IURP LQWHUHVWHG DQG
DZDUG WKH FRQWUDFW V WR DQ\ ELGGHU DQG
visit a camp for Eritrean saying. Mr Isaias to end the “no UHVHUYHVWKHULJKWWRDQQXOWKHSURFXUHPHQW
U H S X W D E O H E U R N H U V D Q G + H D O W K SURFHVV DW DQ\ WLPH ZLWKRXW LQFXUULQJ DQ\
refugees on Sunday when “They broke two check- war; no peace” situation 0DLQWHQDQFH2UJDQL]DWLRQVZLWKUHOHYDQW OLDELOLWLHV
the shooting occurred. points to drive to areas that had existed between H[SHULHQFHWRHVWDEOLVKFRQWUDFWVIRUWKH
There has been much where they were not the two countries since IROORZLQJ 6HDUFK IRU &RPPRQ *URXQG UHVHUYHV WKH
concern about the fate supposed to go, and that their 1998-2000 border ULJKW WR DOWHU WKH UHTXLUHPHQWV EDVHG RQ
of the refugees following they were told not to go. war. /2712 352-(&77,7/('(6&5,37,21 H[LJHQFLHV ZLWKRXW OLDELOLW\ WR DQ\ RI WKH
unconfirmed reports When they were about Critics say the deal has 6)&*1,* *URXS/LIH,QVXUDQFHIRUDOO6HDUFKIRU DSSOLFDQWV
that Eritrean troops had to break the third one, turned out to be a “security &RPPRQ*URXQGVWDIILQ1LJHULD
3OHDVH QRWH WKDW WKLV DGYHUW VKDOO QRW EH
crossed into Tigray, and they were shot at and pact” with thousands of
+HDOWK,QVXUDQFHIRUDOO6HDUFKIRU FRQVWUXHGDVDFRPPLWPHQWRQRXUSDUWWR
had taken some of them detained,” he added. Eritrean troops entering DZDUGWKHDERYHOLVWHGSURMHFW
back to Eritrea. The UN has not yet Ethiopia to help defeat the &RPPRQ*URXQGVWDIILQ1LJHULD
Both governments deny commented on the TPLF.
DAILY TRUST, Wednesday, December 9, 2020
38 insidepolitics@dailytrust.com
INSIDE
PoliQuote
POLITICS
Even if another NEC decision or a court order reverses the dissolution, I will, with utmost
humility, decline to return as APC National Chairman - Comrade Adams Oshiomhole
T
he Deputy President of thee in terms of gender ministers, ambassadors, promote the 35 per cent affirmative
Senate, Senator Ovie Omo-- participation in the headship of MDAs, and state action for women, the number of
Agege, has disclosed plan by y affairs of the commissioners
commissioners. women holding electoral positions has
the National Assembly to considerr nation. in
“We also intend to make a kept dropping.
making quotas for women a “This would indige
woman’s indigeneship by marriage Meanwhile, the APC Women Leader
constitutional provision in thee cover both the a constitutional issue.” Omo-Agege in Kogi State, Hajiya Rabi Haruna,
ongoing constitutional amendment nt legislative said. has assured the electorate that the
by the 9th Assembly. a n d Also speaking at the event, December 12 Local Government
Omo-Agege spoke, y,
yesterday, the Chair
Chairman, House of Election across the state would be
at the roundtable discussion of Represen
Representatives Committee peaceful and orderly.
policymakers and stakeholders on n Elect
on Electoral Matters, Aisha Hajiya Rabi, in an interview,
female participation in politics Dukku reiterated the need
Dukku, commended Governor Yahaya Bello
organised by the Policy and Legal to have
ha more women in for pursuing the 30% affirmation for
Advocacy Centre (PLAC). gov
governance. women with the determination that a
Represented by his Senior Special In his welcome woman should become the assistant
Adviser, Omasa Agbalor, he said a
address, the PLAC chairman in each Local Government
the constitutional provisions, when Senator Ovie Omo-Agege Executive Director, Area (LGA) under the APC leadership.
Lagos East by-election: Anxiety as Reps minority leader protests as APGA rep joins APC
court hears suit against Abiru By Balarabe Alkassim over the plenary, said he joined the
APC from his ward in August.
is illegal and the Speaker should
declare his seat vacant. We are
From Abdullateef Aliyu, Lagos the requirements of Section The Peoples Democratic Party Hembe said he had been going to contest this,” Elumelu
285 (9) of the constitution. (PDP)-led minority leadership involved in the activities of the said.
There is anxiety in the APC The spokesman of the in the House of Representatives, party since then. But the deputy speaker
in Lagos as the Federal High PDP candidate, Dr Pearse yesterday, objected to the However, the Minority Leader dismissed the minority leader's
Court in Lagos will today hear Adetokunbo, told Daily Trust defection of Rep. Hernan Hembe of the House, Rep. Ndudi Elumelu, claim, saying that the crisis in
a suit seeking to disqualify yesterday that with all evidence from the All Progressives Grand asked the Speaker to declare APGA in Anambra State was
Tokunbo Abiru, winner of they have, it would be very Alliance (APGA) to the ruling All Hembe's seat vacant because his enough reason for the lawmaker or
last Saturday’s Lagos East difficult for the APC candidate Progressives Congress (APC). defection was illegal. any other APGA member to defect.
senatorial by-election. to escape. The lawmaker from Benue State, “By the grace of God, I am the It could be recalled that two
The suit, filed by Babatunde The APC had dismissed in a letter read on the floor of the Minority Leader of this House. I Peoples Democratic Party (PDP)
Gbadamosi, the PDP the application filed by House by the Deputy Speaker, am not aware that there is a crisis members had in October defected
candidate in the poll, sought to Gbadamosi. Ahmed Idris Wase, who presided in APGA and so, what he has done to the ruling APC.
disqualify the APC for fielding In another development, a
“an ineligible candidate.”
Abiru had won the election
Federal High Court sitting in
Ikoyi, yesterday, ordered the
Zamfara APC withdraws from today’s runoff poll
with a landslide on Saturday Inspector General of Police, From Shehu Umar, Gusau Economic Planning, Alhaji wrongs including the issue of
with the APC rejoicing and Mr Mohammed Adamu, to Ibrahim Muhammad Birnin security but INEC insisted that it
describing the victory as prosecute Gbadamosi for The APC in Zamfara State has Magaji, said the situation was would hold the election.
endorsement of the popularity alleged forgery and perjury. withdrawn its participation reviewed and it was agreed that “We therefore wish to notify
of the party. The presiding judge, Justice from today’s runoff after the justice and security of lives and the Independent National
Gbadamosi, who had Chukwujekwu Aneke, gave electoral body declared last property could not be guaranteed Electoral Commission of our
prayed the court to disqualify the order following a motion Saturday’s state assembly by- during the election. resolve not to participate in the
Abiru on the grounds that he filed by the APC, Lagos State, election election in Bakura “We appealed to the said supplementary election
registered twice and possessed asking the court to compel constituency inconclusive. Independent National Electoral holding December 9th 2020,”
two voters cards, said the act the IG to investigate and Announcing the decision, Commission (INEC) for the Birnin Magaji said while reading
was a violation of Section 31 of prosecute Gbadamosi. yesterday, at the party’s shifting of the exercise to a more a statement signed by the State
the Electoral Act. Before the order was headquarters in Gusau, a former convenient date, not December Secretary of the APC, Alhaji Sani
Counsel representing PDP, granted, counsel to the APC, commissioner for Budget and 9th 2020, in order to correct the Musa Talata Mafara.
Ebun-Olu Adegboruwa (SAN), Mr Olukayode Enitan (SAN),
had prayed the court for an
order “nullifying, cancelling
told the court that he had filed
a motion exparte, affidavit PDP, APC bicker as thugs attack counsel’s driver at Ondo tribunal venue
and voiding the nomination, in support, statement in From Bola Ojuola,Akure The arrival of military personnel sponsoring the thugs.
submission and acceptance support, verifying affidavit and officers of other security A statement by the PDP
of the name of Abiru as the and written address as part The driver of one of the counsels agencies saved the situation as spokesman in the state, Kennedy
candidate of the APC for the of conditions to grant his of the PDP, Mr Sola Oke, was they chased away the hoodlums. Peretei, accused APC of mobilising
by-election”. application. one of those attacked yesterday The High Court complex was thugs to the venue to harass and
Counsels representing In addition to these court outside the venue of the Ondo later cordoned off while shop and attack their supporters.
APC's candidate, Abiodun processes, the counsel added State Governorship Election office owners were warned against In a statement by its Publicity
Owonikoko (SAN) and Kemi that he had equally filed Petition Tribunal sitting in Akure. the gathering of more than two Secretary, Mr Alex Kalejaiye, APC
Pinheiro (SAN) asked the court exhibits in support of the The driver, Mr Sunday persons within their premises. said both Governor Akeredolu
to dismiss the suit for lack of affidavit and further affidavit Oladunmoye, was attacked by PDP, however, accused APC and and the party have no reason to
jurisdiction and failure to meet already filed before the court. thugs who stormed the venue. Governor Rotimi Akeredolu of mobilise thugs to the venue.
ePaper
DAILY TRUST, Wednesday, December 9, 2020
BUSINESS 39
NIGERIA STOCK EXCHANGE MARKET CAP. N18,310,749TR (-0.09%) ALL SHARE INDEX 35,033.74POINTS (-0.09%) MARKET TURNOVER 306,918,503BN SHARES
Tuedsday, December 8, 2020
OIL AND GAS BANKING CONSUMER GOODS INSURANCE INDUSTRIAL
221.25 0.26% 386.76 -0.34% 562.60 -0.09% 159.30 0.45% 1,617.97 -0.10%
NSE GENERAL INDEX
COMPANY NAME MARKET(NM) PRICE CHANGE TRADES VOLUME FCMB GROUP PLC. 59,408.13 3.00 - 78 2,582,279
COMMODITIES ROYAL EXCHANGE PLC. 1,183.44 0.23 9.52 10 1,087,097
FINANCIAL SERVICES PRICE STANBIC IBTC HOLDINGS PLC 488,663.89 44.00 - 19 75,621
ACCESS BANK PLC. 295,025.37 8.30 -2.35 192 7,419,444
UNITED CAPITAL PLC 27,540.00 4.59 -0.22 99 4,418,838
UNITED BANK FOR AFRICA PLC 282,145.23 8.25 0.61 214 142,435,680
OTHER FINANCIAL INSTITUTIONS 290 10,871,870
ZENITH BANK PLC 734,677.95 23.40 -1.27 566 33,857,329
FINANCIAL SERVICES 1,354 61,444,010
BANKING 972 183,712,453
HEALTHCARE
FBN HOLDINGS PLC 253,061.81 7.05 -0.70 232 12,632,137
EKOCORP PLC. 2,991.61 6.00 - 1 682
OTHER FINANCIAL INSTITUTIONS 232 12,632,137 CRUDE OIL UNION DIAGNOSTIC & CLINICAL SERVICES PLC 888.28 0.25 - 1 714
FINANCIAL SERVICES
ICT
1,204 196,344,590
(BRENT) HEALTHCARE PROVIDERS 2 1,396
MORISON INDUSTRIES PLC. 484.69 0.49 - 2 63,857
MTN NIGERIA COMMUNICATIONS PLC 3,179,374.94 156.20 - 112 594,844
MEDICAL SUPPLIES 2 63,857
TELECOMMUNICATIONS SERVICES 112 594,844
EVANS MEDICAL PLC. 366.17 0.50 - 0 0
ICT 112 594,844
FIDSON HEALTHCARE PLC 10,181.44 4.88 - 12 18,283
INDUSTRIAL GOODS
GLAXO SMITHKLINE CONSUMER NIG. PLC. 7,892.78 6.60 - 26 358,628
DANGOTE CEMENT PLC 3,391,060.97 199.00 - 76 117,840
MAY & BAKER NIGERIA PLC. 6,107.33 3.54 - 23 277,353
LAFARGE AFRICA PLC. 362,425.40 22.50 -1.32 130 4,444,703
BUILDING MATERIALS 206 4,562,543 $44.94 NEIMETH INTERNATIONAL PHARMACEUTICALS PLC
NIGERIA-GERMAN CHEMICALS PLC.
4,804.87
556.71
2.53
3.62
0.40
-
28
0
1,302,169
0
INDUSTRIAL GOODS 206 4,562,543
PHARMA-DEKO PLC. 325.23 1.50 - 0 0
OIL AND GAS
PHARMACEUTICALS 89 1,956,433
SEPLAT PETROLEUM DEVELOPMENT COMPANY PLC 236,731.25 402.30 - 63 257,068
HEALTHCARE 93 2,021,686
EXPLORATION AND PRODUCTION 63 257,068
ICT
OIL AND GAS 63 257,068
CHELLARAMS PLC. 1,814.54 2.51 - 2 37
NATURAL COURTEVILLE BUSINESS SOLUTIONS PLC 745.92 0.21 - 3 3,041
40
photonews@dailytrust.com
PHOTO NEWS
From left: Country Director, Harvest Plus Nigeria, Dr. Paul Ilona;
Deputy Senate Chairman on Agriculture, Sen. Mohammed Enagi; Minister
Officer cadets of the Nigerian Navy Direct Short Service Course 27 in
of Agriculture’s representative, Dr. Razak Oyeleke and Country Director,
a slow march parade, during their passing- out ceremony at the Nigerian
Global Alliance for Improved Nutrition, Dr. Michael Ojo, during the official
Naval College at Onne in Port Harcourt at the weekend
launch of the Commercialization of Biofortified Crops (CBC) Project in
Abuja yesterday
MRS. BENEDICTA = I, formerly AUWAL: I was formerly YUNUS: I formerly known and I, formerly known as HAFSAT MRS. OKUYADE = I, formerly I, Formerly known as Rabiu I.
known as MISS. ASIRA BENEDICTA known as HARUNA SANI SOJA addressed as. INUSA ABIBU YUNUS. UMAR BABAYI Now wish to be known as MISS. SHOKARE, FELICIA Mohammed now wish to be known and
ASIRA. Now wish to be known as MRS. Now wish to be known and addressed as known and addressed as HAFSAT UFUOMA . Now wish to be known as addressed as Rabiu Ibn Mohammed.
BENEDICTA MFON WILLIAMS . All and now wish to be known and UMAR MUHAMMAD and my D.O.B is MRS. OKUYADE, FELICIA UFUOMA
HABIB YUNUS. All former documents All former documents remain valid.
documents bearing my former name addressed as AUWAL ABUBAKAR. remain valid. Authority concerned and 15/05/2002 All my documents remain . All documents bearing my former name
Authority concern and the General
remain valid. The general public should All former documents remain valid. general to take note. Valid. Authority concerned and general remain valid. The general public should
please take note. public Should take note. please take note. public should please take note.
ANTHONY = I, formerly known CHISOMEBI: I formerly known BEKISU: I formerly known I formerly known as MISS PAMELA = I, formerly known INNOCENT: I formerly known
as OGBOJI TOCHUKWU VINCENT as CHISOM DEBORAH OKPOKO, and addressed as. DAVID ODUFA OKE RUKAYAT ADEJOKE as PEACE SYLVERNUS OKORE . and addressed as AYODELE INNOCENT
. Now wish to be known as ANTHONY now wish to be known and addressed BLESSING. Now wish to be known and Now wish to be known as PAMELA OLUMIDE NOW wish to be known and
now wish to be known as MRS
TOCHUKWU VINCENT . All documents as CHISOMEBI DEBORAH OKPOKO addressed as. ASEKOMHE ODUFA OROK EDET . All documents bearing addressed as AYODELE INNOCENT
bearing my former name remain valid. which are my full names. All documents BEKISU. All former documents remain LAWRENCE RUKAYAT ADEJOKE. ANDREW. All former documents remain
my former name remain valid. The
The general public should please take affected remain valid. Authority concerned valid. Authority concerned and general All former documents remain valid. valid. Authority concerned and general
general public should please take note.
note. and the general public to take note. public to take note. General public to note public take note.
IBRAHIM: I, formerly KUDI I. formerly known AJI: I. formerly known and I formerly known as I, formerly known as LAWAN We, Olajumoke Abayomi and
known as ANAS ABDULLAHI, now and addressed as ABDULWAHAB addressed as DORCAS AJIDI now Formally known as DOOSHIMA YAU, now wish to be known and Olakunle Gidado, parents of a child
MOHAMMED now wish to be known wish to be known and addressed as MARTINA IGBA now wish to be formerly known as Omotanwa Zerena
wish to be known and addressed addressed as LAWAN ALHAJI
and addressed as ABDULWAHAB DORCAS AJI All former document Abayomi now wish for her to be known
as IBRAHIM ALIYU. All former MOHAMMED KUDI All former document known as DOOSHIMA MARTINA YA’U. DOB: 06/06/1994. All
remain valid concerned authority and the as Omotanwa Oreoluwa Gidado all other
documents remain valid. General remain valid concerned authority and the IKPAMBESE. All former documents former documents remain valid. The documents remains valid. General public
general public should please take note.
public should please take note. general public should please take note. remain valid. General public to note general public to please take note. take note.
INNOCENT: I, formerly known as HARUNA: I, formerly known MUHAMMAD I. formerly known I formerly known and addressed Anthonia: I’ Formerly known, called ALHASSAN: I, formerly known
CHRISTIAN E. INNOCENT, now wish to and addressed as ABBA MOHAMMED now as 1. MARYAM UMAR 2. AMINATU and addressed as Miss Chiedozi Anthonia as ALHASSAN ADO DOGUWA, now
and addressed as USMAN HARUNA wish to be known and addressed as ABBA
be known and addressed as INNOCENT UMAR now wish to be known and Ugochinyere, now wish to be known, wish to be known and addressed as
AUYO now wish to be known and MUHAMMAD MUHAMMAD DOB1/1/1966 called and addressed as Mrs Nwachukwu
CHRISTIAN CHUKWUEMEKA. All addresses as AMINATU UMAR ,all ALHASSAN GARBA ADO. All former
former documents remain valid. General addressed as USMAN HARUNA. NOT20/1/1966 All former document remain
former documents remain valid, All Anthonia Ugochinyere. All former document documents remain valid. Authority
All former documents remain valid. valid concerned authority and the general remain valid. General public and authorities
public should please take note. public should please take note. authorities concerned and General public concern and the General public should
General public to take note. please take note. concern should please take note. please take note.
EZEKIEL: I, formerly known FRANCES: I, Formerly known and SAIDU I. formerly known and ALKALIJE: I Formerly known AGNES: I’ Formerly known, called Blessing: I, formerly known as
addressed as MISS OFORMA CHINWENDUM addressed as AISHATU SULEIMAN and addressed as OCHIGBO GRACE Blessing Enotse Ogbu, now wish to
as AMOS EMMANUEL ISAH, now FRANCESS with wrong DOB 29/03/1989 ,now
and address as NASIRU ALU. Now
wish to be known and addressed now wish to be known and addressed as ONYECHE, now wish to be known, called be known and addressed as Blessing
wish to be known and addressed as MRS MACBY wish to be known and address as
AISHATU SAIDU All former document and addressed as ANTHONY AGNES. All Enotse Ogu. All former documents
as MARKUS EZEKIEL. All former CHINWENDUM FRANCES with correct DOB ABUBAKAR ALIYU ALKALIJE. former document remain valid. General
29/03/1995 . All formal Documents remains remain valid concerned authority and the remain valid. Authority concern and the
documents remain valid. General general public should please take note. All former documents remain valid public and authorities concern should
public should please take note.
valid. General public take note. General public should please take note.
general public should take note. please take note.
LAWAL: I, formerly known as RE-ARRANGEMENT OF NAME: GALADIMA I. formerly known SAFEEYAH: I Formerly known I, formerly known as MUHAMMED SAKA: I, FORMERLY KNOWN AND
OLAFIRANYE AZEEZAT TEMITOPE, I , formerly known and addressed as MR and addressed as ABDULLAHI DAUDA and address as SAFIYA ALIYU AUWAL with the date of birth as 1st CALLED SAKA OLUWATOSIN AYOBAMI
AGBAPU ALOYSIUS CHUKWUNONSO now wish to be known and addressed MUHAMMAD. Now wish to be known JANUARY.1961, now wish to be known and NOW WISH TO BE KNOWN SAKA-KAREEM
now wish to be known and addressed addressed as YAHAYA MUHAMMED AUWAL OLUWATOSIN AYOBAMI. ALL FORMER
as LAWAL AZEEZAT TEMITOPE. . Now wish to be known as MR AGBAPU as ABDULLAHI DAUDA GALADIMA and address as NASIRU SAFEEYAH
with actual date of birth as 1st JANUARY.1961. DOCUMENTS REMAIN VALID. GENERAL
All former documents remain valid. CHUKWUNONSO ALOYSIUS. All DOB12/4/1995 All former document ALIYU MUHAMMAD. All former All former documents remain valid authority PUBLIC AND OTHER AUTHORITIES
former documents remains valid . General remain valid concerned authority and the documents remain valid general public
General public should please take note. concern and general public take note. SHOULD PLEASE TAKE NOTE.
public take note. general public should please take note. should take note.
PENI: I, formerly known as OYAKA: I formerly known and WAZIRI I. formerly known and I formerly known as AUWAL USMAN: I, formerly known as MRS. ANYANWU-UCHENNA =
ORO ABDULLAHI, now wish to be addressed as OYAKA HAPPINESS. addressed as NUHU BAUJI MELA MANSUR now wish to be known USMAN RABI, now wish to be known I, formerly known as MISS. AHUKANNA
Now wish to be known and addressed as now wish to be known and addressed and addressed as USMAN RABIU. SYLVIA NWANYIEZE . Now wish to be
known and addressed as YAKINI and addressed as MANSUR known as MRS. ANYANWU-UCHENNA
OCHEMHEN HAPPINESS OYAKA. All as MELA NUHU WAZIRI All former
O. PENI. All former documents MUHAMMAD All former documents All former documents remain valid. SYLVIA NWAYIEZE . All documents
former documents remain valid. Authority document remain valid concerned
remain valid. General public should concerned and general public to take authority and the general public should remain valid General public to take Authority concern and the General bearing my former name remain valid. The
please take note. note. please take note. note public should please take note. general public should please take note.
MARIAM: I, formerly known FRANCIS: I formerly known ABBA I. formerly known and SANI: I was formerly known as NUHU: I formerly known as NDAK = I, formerly known as
and addressed as. JOHNSON AMOS. addressed as ABDULLAHI HAMMARI SANI LAWAL ABUBAKAR now wish INNOCENT PRISCILIA. Now wish
as MARYAM UMAR AWAH, now KAMANI NUHU, but now wishes
Now wish to be known and addressed now wish to be known and addressed
wish to be known and addressed as to be known and address as ABUBAKAR to be known and addressed as to be known as NDAK, UNYIME
as ABDULLAHI HAMMARI ABBA
as. FRANCIS JOSPHEN. All former SANI and all documents remain valid. INNOCENT . All documents bearing
MARIAM UMAR AWAH. All former DOB10/11/1984 NOT1/1/1990 All former MSHELIA KAMANI NUHU. All formal
documents remain valid. Authority document remain valid concerned authority Authorities Concerned and the general my former name remain valid. The
documents remain valid. General concerned and general public to take documents remain valid. General
and the general public should please take note. public should please take note. general public should please take note.
public should please take note. note. public should please take note.
TERHEMBA: I, formerly OKHALE: This is to con¿rm that. IDRIS: I, formerly known NAFISA : I was formerly known I WAS FORMERLY AJINGE I, formerly known as HAJIYA
known as DANIEL LOKOJA, now OKHALE OFURE SHALOM and OKHALE as NAFISA ABUBAKAR HARUNA now BLESSING IANNAVE. THAT I NOW WISH
and addressed as HAJARA TO BE KNOWN AND CALLED AYOHOL
AISHATU MARAFA now wish to be
wish to be known and addressed as OFURE. Refer to me and same person. wish to be known and address as MRS
Now wish to be known and addressed ADAMU now wish to be known and BLESSING IANNAVE. ALL FORMER known and addressed as AISHATU
AHUNGWA DANIEL TERHEMBA. NAFISA ABUBAKAR HARUNA and
as. OKHALE OFURE SHALOM. All addressed as HAJARAT IDRIS. all documents remain valid. Authorities
DOCUMENTS REMAIN VALID. GENERAL YAIYA RAHA. All former documents
All former documents remain valid. former documents remain valid. Authority PUBLIC AND OTHER AUTHORITIES
All former documents remain valid. Concerned and the general public should SHOULD PLEASE TAKE NOTE.
remain valid. General public should
General public should please take note. concerned and general public to take note.
General public to take note. please take note. please take note.
BISHOP: I, formerly known MERCY: I formerly known and I formerly known and addressed RABIU : I was formerly PAUL: I formerly known as I, formerly known as
as ODOH PATRICK, now wish to addressed as. MOSES ESE MERCY. as ALA TIAYAH PATIENCE now wish known as JAMILU IDRIS now wish PAUL BARKA YANTE, but now HUSSAINA BELLO now wish to be
Now wish to be known and addressed to be known and addresses as BEGE to be known and address as RABIU known and addressed as HUSSAINA
be known and addressed as ODOH wishes to be known and addressed
as. MRS OSHIOKE ESE MERCY. All PATIENCE ALA ,all former documents DANSALE and all documents remain
BISHOP OTEIKWU. All former former documents remain valid. Authority as BARKA YANTE PAUL. All formal MUHAMMAD. All former documents
remain valid, All authorities concerned valid. Authorities Concerned and the remain valid. General public should
documents remain valid. General concerned and general public to take note documents remain valid. General
and General public please take note. general public should please take note. please take note.
public should please take note. public should please take note.
MAIYE: I, formerly known as BELLO: I formerly known and AISHA: I was formerly known WILLIAMS : I was formerly USMAN: I formerly known I, formerly known as
FESTUS TIMOTHY MAIYE with DOB addressed as. MUSAH KARIMAT. Now as MATHEW TOPE now wish to known as WILLIAMS AMEH AGADA as USMAN ABDULLAHI, but now TAWAKALTU BELLO now wish
3rd April, 1996, now wish to be known wish to be known and addressed as. be known and address as AISHA now wish to be known and address as wishes to be known and addressed as to be known and addressed as
and addressed as FESTUS MAIYE with BELLO KARIMAT OMONEGHO. All IBRAHIM and all documents remain WILLIAMS SUNDAY AGADA and all
USMAN ABDULLAHI B. All formal TAWAKALTU B PEDRO. All former
data of birth 3rd April, 1998 . All former documents remain valid. Authority valid. Authorities Concerned and the documents remain valid. Authorities
former documents remain valid. General concerned and general public to take note Concerned and the general public should documents remain valid. General documents remain valid. General
general public should please take note. public should please take note.
public should please take note. please take note. public should please take note.
I formerly known and called ZIKA: This is to con¿rm that. I formerly called as HAUWA’U TAMUNOIPIRINYE = I, AKERIYYO: I formally known and I, formerly known as
OZOS AMINATU, OZO AMINETU and formerly known as TAMUNOIPIRINYE address as Iorbee Rosemary Aver now
MAJI FATIMAThat I want to be MOHAMMED, now wish to be SHAFAATU UMARAHMAD now
SALAMI AMINATU ZIKA. Refer to me and ROGERS TOLOFARI . Now wish to be wish to be call and address as Akeriyyo
now know and henceforth address same person. Now wish to be known and known and called as HAUWA’U wish to be known and addressed
known as TAMUNOIPIRINYE ROGERS Rosemary Aver, all former documents
as AUDU FATIMA . All former addressed as. SALAMI AMINETU ZIKA. BOBBO MOHAMMADU. All former LEGGJACK . All documents bearing my remain valid, First bank, authority concern as SHAFAATU AHMED. All former
document remain valid, public to All former documents remain valid. Authority documents remain valid. General documents remain valid. General
former name remain valid. The general and general public should take note.
concerned and general public to take note
take note public to note public should please take note. public should please take note.
VERONICA I, formerly known as OMOAKE: This is to con¿rm that. I, formerly known as CHIROMA NWOSU = I wish to state that ADURE : I, formerly known as I, formerly known as SIDDIQ
KALU VERONICA VIVIAN now wish to NABERU MICHAEL, NABERU MICHAEL ACABA Now wish to be known and my MARYANN UGOCHI NWORGU as ADURE KATOR, now wish to be known
OMOAKE and MICHAEL OMOAKE. Refer to me
MUSA now wish to be known
be known and addressed as VERONICA addressed as IBRAHIM AHMED and my on my BVN is same person as NWOSU, and addressed as ADURE KATOR
and same person. Now wish to be known and and addressed as ABDULMALIK
THOMAS KALU. Date of birth: 20th DOB is 07/02/1980 All my documents MARYANN N . Now wish to be known as CYPRIAN. All former documents
April, 2000. All former document remain
addressed as. NABERU MICHAEL OMOAKE.
NWOSU, MARYANN N. All documents MUSA. All former documents
All former documents remain valid. Authority remain Valid. Authority concerned and remain valid. Authority concern and the
valid, public to take note. general public Should take note. bearing my former name remain valid. remain valid. General public should
concerned and general public to take note. General public should please take note.
General public should take note. please take note.
This is to inform the general public that SALEH I. formerly known and I, formerly known as UMMI SUNDAY = I, formerly known IORUNDU : I, formerly known I, formerly known as AMINU
the name AHMAD RUFA’I MUHAMMAD addressed as HARUNA SALEH now as SUNDAY JONAH IKONO . Now as IORUNDU ASHITAVER, now
BUNZA and AHMAD RUFA’I MUHAMMAD
DADAYO Now wish to be known ABUBAKAR now wish to be known
wish to be known and addressed as wish to be known as SUNDAY ETIM wish to be known and addressed as
refers to one and the same person. All and addressed as UWANI DADAYO and addressed as HARUNA BELLO.
JIBIRIN SALEH All former document ALEXANDER . All documents bearing IORUNDU FRANCIS ASHITAVER. All
Documents bearing both names remain
remain valid concerned authority and the
All my documents remain Valid. former documents remain valid. Authority All former documents remain valid.
Valid. The General public and the Authorities my former name remain valid. The
concerned should please take note. general public should please take note. Authority concerned and general concern and the General public should General public should please take
general public should please take note.
public Should take note. please take note. note.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
42 follow us on Twitter: @daily_trust
I, formerly known as ALHAJI: I formerly known 2. ABDULLAHI I formerly known I formerly known as SHAMSU MARYAM: I formerly known as REARRANGEMENT OF NAME
as ISMAIL ABDULLAHI ISMAIL 08- MARYAM IDRIS ALIYU now wish to GIWA: I, formerly known and addressed as
ABUBAKAR USMAN now wish as SHUAIBU ALI, now wish to be LAWAN now wish to be called and OKEKUNLE GIWA DAMILOLAA . Now
06-1992 now wish to be called and be called and addressed as MARYAM
to be known and addressed as known as ALHAJI SHUAIBU ALI. addressed as SHAMSU LAWAN wish to be known and addressed as GIWA
addressed as ISMAIL ABDULLAHI 24- IDRIS MUHAMMAD all former
ABUBAKAR USMAN KD. All former D.O.B. 02/02/1990. All former 10-1997 All former documents remain HARUNA. All former documents documents remain valid. Any authority
DAMILOLA OKEKUNLE. All former
documents remain valid. Authority Concerned
documents remain valid. General documents remain valid, general valid authority concern and general public remain valid Authority concern and concern and general public should please and General public please take note.
public should please take note. public take note to note general public to note take note
I, formerly known as FATIMA JOSHUA: I, formerly known and 3 MUHAMMAD I formerly I formerly known as SHAMSU LAWAN DANBABA: I Formerly known BELLO: I, formerly known and
addressed as JOSHUA MOLVI ABRAHAM, now wish to be called and addressed as SHAMSU as HASSAN IBRAHIM Now wish to addressed as AKOBE OZAVINOYI
NUHU GALADANCHI now wish to known as IBRAHIM ALI now wish to LAWAN HARUNA. All former documents remain
now wish to be called and addressed as be called and addressed as DANBABA TAIYE . Now wish to be known and
be known and addressed as FATIMA MAMAKI JOSHUA IBRAHIM, and correct
be called and addressed as IBRAHIM valid Authority concern and general public to noteI
HASSAN DOB is 1/Jan/1960 All Former addressed as BELLO ABDULKAREEM
NUHU ABDULLAHI. All former DOB is 05-08-1999. All former documents MUHAMMAD .All former documents formerly known as SHAMSU LAWAN now wish
documents remain valid Any Authority TAIYE. All former documents remain
documents remain valid. General remain valid. Constituted authorities and the remain valid authority concern and to be called and addressed as SHAMSU LAWAN
concern and the General public to please valid. Authority Concerned and General
HARUNA. All former documents remain valid
public should please take note. general public should please take note. general public to take note Authority concern and general public to note take note public please take note.
I was formerly known as UMAR: I, formerly known and 4. ISMAIL I formerly known as I formerly known as MUHD ISHAQ: I, formerly known I, Professor CLARA RAQUEL
addressed as UMAR YUSUF, now wish ISMAIL SANAHUDON -1-1-1988 YAKUBU now wish to be called as ISHAQ JIBRIL, now wish to be BERNSLEIN OGUNTONA, Want the
PATIENCE IDI BANKI now wish to be to be called and addressed as UMAR wish to be called and addressed as Banks and General Public to know that I
and addressed as MUHAMMAD known and called ISHAQ JIBRIN.
known and called PATIENCE IDI . All YUSUF HUDU, and my correct DOB is ISMAIL SALAHU -2-8-1992 .All remain CLARA RAQUEL I.B OGUNTONA,
01-01-1997. All former documents remain YAKUBU. All former documents All former documents remain valid. C.R.B OGUNTONA. All former documents
my former documents remain same and former documents remain valid authority
remain valid Authority concern and The general public and any authority remain valid. Authority Concerned and
valid. Constituted authorities and the concern general public to note.
valid. General public should take note. general public should please take note. general public to note concerned to please take note General public please take note.
MARYAMA: I, formerly known RICHARD: I formerly known 5. HARUNA I formerly known I formerly known as SADIYA: I formerly known AYINDE: I, formerly known and
as MARYAM AHMED. Now wish to as TERKOP RICHARD JACOB, now as SALEH HARUNA now wishes to DANAZUMI MUSA now wish to be as AMINA IBRAHIM now wish to addressed as Miss AYODELE AMINAT
be called and addressed as MARYAMA be called and addressed as SADIYA OLAIDE . Now wish to be known and
AHMED MOHAMMED DAURA. My date
wish to be known as WAYO TERKOP be called and addressed as HARUN called and addressed as ABDULLAHI
KABIRU all former documents remain addressed as Mrs AYINDE AMINAT
of birth is 15/07/1965 not 10/10/1963. All RICHARD. All former documents SALEH HARUNA .all former MUHAMMED. All former documents
valid. Any authority concern and OLAIDE. All former documents remain
former documents remain valid. Authority remain valid. Authorities concerned documents remain valid authority remain valid Authority concern and valid. Authority Concerned and General
concerned and general public to take note. and general public should take note. concern and general public to note general public to note general public should please take note.
public please take note.
HALIMATU: I, formerly known NANBYEN: I formerly known 6. MUHAMMAD I formerly I formerly known as Sadiya AISHA: I formerly known as OWOIYA: I, formerly known and
as ROSEMARY PIUS. Now wish to be as DAFFA NANBYEN REBECCA, known as JIBRIN SHEHU wish Musa now wish to be called AISHA SALE now wish to be called addressed as OWOIYA IFEOLUWA
called and addressed as HALIMATU now wish to be known as DAFFA to be called as NUHU JIBRIN TAIWO . Now wish to be known
and addressed as Sadiya Suraja and addressed as AISHA SALEH all
MUHAMMAD . All former documents and addressed as OWOIYA TAIWO
SANI. All former documents remain NANBYEN VONGJEN. All former Abdullahi. All former documents former documents remain valid. Any
remain valid. Authority Concern and the OLUWAKEMI. All former documents
valid. Authority concerned and general documents remain valid. All Authorities remain valid Authority concern and authority concern and general public remain valid. Authority Concerned and
public to take note. and general public should take note. general public should please take note.
general public to note should please take note. General public please take note.
RABI: I, formerly known as MARGARET: I formerly known : I, formerly known as 1. MOHAMMED : I, formerly ITODO: I, formerly known as OWOIYA: I, formerly known and
ADEMU RABI now wish to be known as SERI MARGARET AKA’A and NAZIRU S ABDULLAHI now known as MUSTAPHA MOHAMMED EJEMBI GRACE EDOBO, now wish addressed as OWOIYA ABDULRASAQ
and addressed as ALMUSTAPHA RABI. MARGARET AKA SERI is one and now wish to be known and addressed to be known and addressed as ITODO OLUWATOBI . Now wish to be known
wish to be known and addressed as
All former documents remain valid. the same person wish to be known as as IBRAHIM MOHAMMED . All WISDOM GRACE.All former documents and addressed as OWOIYA RASAQ
STANBIC IBTC BANK, GTB, FIRST SERI MARGARET AKA’A. All former NAZIRU SULAIMAN . All former OLUWATOBI. All former documents
former documents remain valid. remain valid. The general public and any
BANK and the general public should documents remain valid. All Authorities documents remain valid. General authority concerned to please take note remain valid. Authority Concerned and
General public should please take note.
please take note. and general public should take note. public should please take note General public please take note.
ABALO: I, formerly known REBECCA: I formerly known as 1. MUHAMMAD : I, formerly 1. ADAMU : I, formerly SALISU: I FORMERLY SALISU ODUOLOWO: I, formerly known
CYNTHIA STEPHEN IGEH, now wish to be known as NUHU MUHAMMAD AMINU known as MUHAMMED ADAMU ABUBAKAR NOW WISH TO BE and addressed as SHUAIB DAUD
as ABDULLAHI MUSA, now wish to known as STEPHEN REBECCA IGEH and my
be known and addressed as ABALO now wish to be known and addressed as RABIU now wish to be known and CALL AND ADDRESS AS SALISU OLAMIDE . Now wish to be known
date of birth was wrongly captured on my BVN
ALIYU ADAMU . All former documents addressed as ADAMU RABIU . ABDULLAHI. FORMER DOCUMENTS and addressed as ODUOLOWO DAUD
ABDULLAHI MUSA. All former as 8th November, 1992 instead of 25th March,
remain valid. The Authority concerned REMAIN VALID.ACCESS BANK, OLAMIDE. All former documents remain
documents remain valid. General 1995. All former documents remain valid. All All former documents remain valid.
and general public should please take ZARIA AND GENERAL PUBLIC TO valid. Authority Concerned and General
public should please take note.
Authorities and general public should take note General public should please take note.
note. NOTE. public please take note.
ADAM: I, formerly known JEMIMAH: I formerly known I, formerly known as ABDULLAHI ABDULMUMINI : I, KATDANZAK:I formerly known as AJIBOLA: I, formerly known and
as GORIP JEMIMAH HABILA, USMAN BABA. Now wish to be called formerly known as UMAR INUSA DAUDA JOSEPH now wish to be called addressed as Miss ABOLADE VICTORIA
as ADAM SHEHU now wish to be OLUWAWEMIMO . Now wish to be
now wish to be known as GOPEP and address as ABDULLAHI USMAN. ABDULMUMINI now wish to be known as KATDANZAK DAUDA JOSEPH all
known and addressed as ADAM known and addressed as Mrs AJIBOLA
All former documents remain valid. and addressed as UMAR YUNUSA . former documents remain valid GTB
SHUAIBU. All former documents JEMIMAH KICHIME. All former VICTORIA OLUWAWEMIMO. All former
Authority concern and General public All former documents remain valid. The bank APT pension KSDPC general public
remain valid. General public should documents remain valid. All Authorities Authority concerned and general public all authority concern should please take
documents remain valid. Authority Concerned
should please take note. and General public please take note.
please take note. and general public should take note. should note.
IBRAHIM: I, formerly known : I, formerly known as HAUWA : I formerly known as 1. ADAM : I, formerly ZAKKA: I Formerly known as BELLO: I, formerly known and
and address as MUHAMMAD AJI, ABDULLAHI ALIYU now wish to HAUWA AHMADU. now wish to be known as DANJUMA IDRIS now ZAKKA EMMANUEL Now wish to addressed as Miss BELLO ILAMOSI
now wish to be known and addressed known and addressed as HAUWA be called and addressed as ZAKKA RACHEL . Now wish to be known and
be known and addressed as ALIYU wish to be known and addressed
as MOHAMMED IBRAHIM with DOB. LAWAN AHMADU. All former documents EMMANUEL JOSEPH All Former addressed as Mrs OYAWOYE ILAMOSI
20/08/1989. All former documents ABDULLAHI MAGAMA . All former remain valid, Authority Concerned and as YUSIF ADAM . All former documents remain valid Any Authority RACHEL. All former documents remain
remain valid. General public should please documents remain valid. General the general public should please take documents remain valid. General concern and the General public to please valid. Authorities Concerned and General
take note public should please take note. note. public should please take note. take note public please take note.
AMINU: I, formerly known 1. BASHIR : I, formerly known ALIYU : I formerly known as 1. 2. SA’ID : I, formerly FAIZA: I formerly known as OWOSENI-FAGBENRO: I, formerly
and addressed as AMINU ABDU as BASHIR USMAN KABIR now wish ALIYU IDRIS. now wish to be known FAIZA ALIYU SHANONO now wish known and addressed as FAGBENRO-OWOSENI
known as ZAYYAN JADID now
DAN AZUMI, now wish to be called to be known and addressed as KABIR and addressed as ALIYU IDRIS KAFAYAT AFOLASADE . Now wish to be
wish to be known and addressed as to be called and addressed as FAIZA known and addressed as OWOSENI-FAGBENRO
and addressed as AMINU MAMMAN. USMAN BASHIR . All former documents NAMISALI. All former documents remain ALIYU all former documents remain
ZAYYAN JADID SA’ID . All former KAFAYAT AFOLASADE. All former documents
All former documents remain valid. remain valid. The Authority concerned valid, Authority Concerned and the valid. Any authority concern and remain valid. Authority Concerned and General
Constituted authorities and the general and general public should please take general public should please take note. documents remain valid. General
public should please take note. general public should please take note. public please take note.
public should please take note. note.
HARIS: I, formerly known and 1. ZAKARIYA: I, formerly known ABUSAFIYYANU : I formerly 1. FIDDAUSI: I, formerly YAKUBU: I formerly known OLOYEDE: I, formerly known
addressed as KAMALU AHMAD, now as FATIMA UMAR now wish to be known as SAFIYANU HABU. now known as FIDDAUSI BELLO now as MANSIR YAKUBU now wish to and addressed as ADEOTI TITILADE
wish to be called and addressed as HARIS known and addressed as FATIMA UMAR wish to be known and addressed as be called and addressed as YAKUBU ELIZABETH . Now wish to be known
wish to be known and addressed
SALE. All former documents remain valid ZAKARIYA. All former documents remain ABUSAFIYYANU ABBAS. All former MANSUR all former documents remain and addressed as OLOYEDE TITILADE
constituted authorities and the general valid. Access Bank Plc and General public documents remain valid, Authority as FIDDAUSI BALA . All former ELIZABETH. All former documents
valid. Any authority concern and
public should please take note. should please take note. Concerned and the general public should documents remain valid. General remain valid. Authority Concerned and
general public should please take note.
please take note. public should please take note. 2. General public please take note.
LAMI: I, formerly known and . SHAMSUDDEEN: I, formerly 1. MUSA : I, formerly known I WAS FORMERLY KNOWN AS NAFIU YAKENTIM: I formerly known as OHANUKA: I, formerly known and
addressed as BILHATU JEBGA, now known as SHAMSUDDEEN IBRAHIM MOHAMMED MUNSHALL NOW WISH TO YAKENDIM BARU RABU now wish to addressed as OKOYE EKWUTOSI ANN . Now
as AISHA ADAMU MUSA now
now wish to be known and addressed as BE CALLED NAFIU ALHAJI ZURKALLAINI , I wish to be known and addressed as OHANUKA
wish to be called and addressed as LAMI wish to be known and addressed as be called and addressed as YAKENTIM
WANT TO CHANGE MY DATE OF BIRTH FROM ADAEZE ANN. That I was born on 14th day of
JEBGA. All former documents remain SHAMSUDDEEN IBRAHIM MUSA. All BARU PARPASHI all former documents
AISHA MUSA HALIRU . All former 2/7/1995 to 11/10/1998.ALL MY FORMER February, 1984 not 14th day of February, 1985.
valid. Constituted authorities and the former documents remain valid. Authority remain valid. Any authority concern and
concern and General public should please
documents remain valid. General DOCUMENT REMAIN VALID RELEVANT All former documents remain valid. Authority
general public should please take note. AUTHORITY AND PUBLIC SHOULD TAKE NOTE general public should please take note. Concerned and General public please take note.
take note. public should please take note. PLEASE
SUNUSI: I formerly known 3. KALTUME: I, formerly known I formerly known as USMAN Tue, Dec 8 at 1:30 PMI was OYEWOLE: I formerly known as IRIABE: I, formerly known and
as MOHAMMED SUNUSI, now as UMMUKULSUM MUHAMMAD IBRAHIM now wish to be called formerly known as ZULFAA ABUBAKAR OYEWOLE BIU RUKAYAT now wish to addressed as IGBINOVIA DOLLY
now wish to be known and addressed as AIKAWA now wish to be known and be called and addressed as OYEWOLE OSAFAMWEN . Now wish to be known
wish to be known as MUHAMMAD KALTUME MUHAMMAD MUSA DOB
and addressed as HAFIZU
called as ZULFAA ABUBAKAR SANUSI. BOLA RUKAYAT all former documents and addressed as IRIABE DOLLY
SUNUSI. All former documents 08/02/1998. All former documents YAHAYA. All former documents All my former documents remain valid. remain valid. my correct date of birth is OSAFAMWEN. All former documents
remain valid, general public should remain valid. Authority concern and remain valid Authority concern and General public should please take note 24/9/1990 Any authority concern and remain valid. Authorities Concerned and
please take note General public should please take note. general public to note general public should please take note. General public please take note.
MUSA: I formerly known as 4. ABDULHADI: I, formerly I formerly known as Auwal I was formerly known as HARUNA: I formerly known EMEH : I formerly known and
BABANGIDA MUSA, now wish known as TIJJANI ABDULHADI now haruna labbo now wish to be called BASHIR HALADU SULAIMAN now as HARUNA IBRAHIM IBRAHIM addressed as NKEM OLUCHI
wish to be known and addressed as wish to to be a known and called as now wish to be called as HARUNA VERONICA Now wish to be known
to be known and addressed as and addressed as Auwal Haruna
TIJJANI ABDULHADI S. SHANU. All BASHIR HALADU BASHIR. All IBRAHIM all former documents and addressed as EMEH OLUCHI
DALI MUSA. All former documents former documents remain valid. Authority Muhammad. All former documents VERONICA. All former documents
remain valid. general public should remain valid Authority concern and my former documents remain valid. remain valid general public all authority
concern and General public should please remain valid, General public kindly take
please take note take note. general public to note General public should please take note concern should please take note note.
ISAKA: I formerly known as 5. GIDADO: I, formerly known formerly known as SANIMU 1. ALIYU : I, formerly HAUWAU: I formerly known ADDITION OF NAME. ESTHER: That my
as AHMED MAIRI GIDADO now wish name reÀects as. ESTHER JOHN in my Bank
IBRAHIM ISHAQ, now wish to be MUHAMMAD 12/07/1967 now wish known as HINDATU A. WAZIRI as HAUWAU IDRIS now wish to be Details. That i now want to add. UYOYO to my Name
known as ISAKA ALHAJI KEYARI. to be known and addressed as MAIRO to be called and addressed as SAMINU now wish to be known and addressed called as HAUWAU ADAMU IDRIS to read as. ESTHER UYOYO JOHN. as it is in my
AHMED GIDADO. All former documents ISAH 14/04/1975. All former as HINDATU ALIYU WAZIRI .
All former documents remain valid, remain valid. Authority concern and
all former documents remain valid National identity Card. That my correct and full name
documents remain valid Authority All former documents remain valid. is. ESTHER UYOYO JOHN. All former documents
general public should please take General public should please take note. general public all authority concern
concern and general public to note General public should please take note. remain valid General public should please take note.
note should please take note
GANA: I formerly known as : I, formerly known as I formerly known as MISS ISAIAH: I, formerly known SANI: I, formerly known as FASEYI: I, formerly known
BULAMA MUSTAPHA, now wish to MOHAMMED KAKUMI now wish to Fatima Basiru now to be called and as ELIJAH YUSUF, now wish to be SANI ALIYU, now wish to be known and addressed as RUFAI IBITOLA
be known and addressed as LAWAN be known and addressed as MALAM and called SANI ABUBAKAR ALIYU. OLUBUNMI . Now wish to be known
addressed as MRS Fatima Isyaku known and called ISAIAH YUSUF.
MODU GANA with DOB 02/02/1953. and addressed as FASEYI IBITOLA
MAHAMMADU MALLAM . All former Bashir. All former documents remain All former documents remain valid. All former documents remain valid.
All former documents remain valid OLUBUNMI. All former documents
documents remain valid. General valid NYSC, Authority concern and The general public and any authority The general public and any authority remain valid. Authority Concerned and
general public should please take note public should please take note. general public to note concerned to please take note concerned to please take note General public please take note.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 43
Classifieds made easy PUBLIC NOTICE Page 3
ABANISE: I, formerly known and I formerly known as MAGAJIYA SADIQ : I formerly known as YUSUF. I formally known I formerly known and addressed I, formerly known, called and
addressed as ROMOKE TOYIN . Now ALIYU. Now wish to be known ALI MAINA YAKURA now wish to as Yusuf Favour Aminu I am now as ADO GARBA now wish to be addressed as FAVOUR ASUQUO
wish to be known and addressed as and addressed as MAGAJIYA known and addressed as UMARU EDET. I now wish to be known, called
be known as SADIQ ZANNA ALI. wish to be call as Aminu Yusuf, All
ABANISE KEHINDE ROMOKE. All MUHAMMAD. All former documents and addressed as FAVOUR UNYIME
All former document remain valid. my document remain valid. WIth SALEH. All former documents remain
former documents remain valid. Authority remain valid. Authority concerned and BEN. Documents bearing my former
Concerned and General public please take Borno State University and General DOB 15, Aug. 1983. General Public valid. Authority concerned and name remain valid. General public, banks,
general public should please take note. General public to note.
note. public should take note. should please take note institutions note.
OKPALA-UMENNADI: I, formerly AISHATU: I formerly known ABDU : I formerly known BASHIR : I formerly known PERPETUA: I formerly CHRISTIAN - I
known and addressed as UMENNADI was formerly known as CHRISTIAN
CHARITY CHIZOBA . Now wish to
as AISHA MUSA UMAR , now as ABDU BUJI now wish to be as MOHAMMED BASHIR ALI now known as PERPETUAL CHUKWU,
VITALIS ROBERT. That I now wish
be known and addressed as OKPALA- wish to be addressed as AISHATU known as ABDU BUJI YALARI. wish to be known as BASHIR ALI. now wish to be addressed as
to be known as CHRISTIAN VITALIS
UMENNADI NNEDINMA. All former MUSA UMAR. All former documents All former document remain valid. All former document remain valid. PERPETUA NDUBUISI. All former CHINEMEREM. All documents bearing
documents remain valid. Authority Concerned
remain valid. General Public Should General public should take note. documents remain valid. General my former name remain valid. The
and General public please take note. General public should take note.
please take note. Public should please take note. general public should please take note.
CORRECTION OF NAMEODUGBEMI: I, SALISU. I formerly known MARYAM : I formerly known ZARA : I formerly known as JALO I formerly known and OSSAI - I was formerly known
formerly known and addressed as ODUGBEMI addressed as ALHAJI BABA ABBAN as VICTORIA HUNGIOYEN OGBOIN,
SING OLAYIWOLA wrongly written in Drivers
as SALISU UMAR ADAM, now as MARYAM B DERIBE now ZARA USSAINI now wish to be OGBOIN VICTORIA and UGAH VICTORIA.
JALO now wish to be known and
Licence . Now wish to be known and addressed as wish to be known and addressed wish to be known as MARYAM known as ZARA ALHAJI MUSA. That I now wish to be known as MRS. OSSAI
addressed as ALHAJI BALA ABBA
ODUGBEMI OLUSINA OLAYIWOLA. as SALISU UMAR. All former BABAGANA DERIBE . All former All former document remain valid. JALO All former documents remain valid.
VICTORIA HUNGIOYEN. All documents
All former documents remain valid. Authority bearing my former name remain valid. The
documents remain valid General document remain valid. General All concern and authority General public
Concerned and General public please take note. General public should take note. general public should please take note.
public should please take note public should take note. should please take note.
SAMUEL: I, formerly known and SARATU. I formerly known ABUBAKAR : I formerly known ANAS: I Formerly Known As ALI I FOMERLY NOWN AS DERIKOMA - That I
addressed as ABOBADE OLA AKANO as ADAMA ALI, now wish to be as ABUBAKAR ISAHAGA now wish to ANAS SHEHU now wish to be known BABA GONI MODU NOW WISH was formerly known as WAIDIKIBIA
. Now wish to be known and addressed be known as ABUBAKAR HARUNA. TO BE KNOW AND ADDRESSED ESTHER NENGI. That I now wish to
known and addressed as SARATU and addresses as ANAS USMAN
as SAMUEL OLASUNMBO ABOLADE With D O B 5/04/1984 to 01/01/1995. AS MUHAMMED ALI. ALL FOMER be known as DERIKOMA ESTHER
AKANO. All former documents remain UMARU. All former documents all former Documents remain valid DOCUMENT SHOULD BE VALID. NENGI. All documents bearing my former
All former document remain valid.
valid. Authority Concerned and General remain valid General public should general public should take note. GENERAL PUBLIC SHOULD PLEASE name remain valid. The general public
General public should take note.
public please take note. please take note TAKE NOTE should please take note.
OJADI: I, formerly known and ALI. I formerly known as MOHAMMED : I formerly USMAN I formerly known and MALA: I formerly known as OBILOR - That I was
addressed as ALEX NKECHI PRAISE ABDULRAHMAN ALI, now wish known as BUKAR ADAM now addressed as ABDULAZIZ SANI now ADAM BUKAR DOGOLI, now wish formerly known as OBULOR RUTH.
. Now wish to be known and addressed to be known and addressed as wish to be known and addressed as SANI That I now wish to be known as
wish to be known as MOHAMMED to be addressed as MALA BUKAR.
as OJADI NKECHI PRAISE. All ABDURRAHMAN ALI GONI . ADAYE USMAN All former documents OBILOR RUTH. All documents bearing
former documents remain valid. Authority DAUDA. All former document remain valid. All concern and authority All former documents remain valid
All former documents remain valid my former name remain valid. The
Concerned and General public please take remain. General public should take General public should please take note. . General Public Should please take general public should please take note.
note. General public should please take note note. note.
ODEGBULE: I, formerly known and HASSAN:I Formerly known as ABDULLAHI I formerly known SALISU: I formerly known as BUKAR: I formerly known DORCAS - That I was
addressed as YEKEEN OLUSOLA FASILAT Hassan Muhammad DOB 01/01/1999 and addressed as IBRAHIM KHALIDU SALISU UMAR now wish to be known formerly known as MISS. DORCAS
. Now wish to be known and addressed as
as ABA AMA BUKAR, now wish
Now wish to be known and addressed M now wish to be known and addressed and addressed as SALISU MUHAMMAD UWEM ESSIEN. That I now wish to
ODEGBULE OLUSOLA FASILAT. That all to be addressed as MUSTAPHA
as Hassan Muhammad Mustapha DOB as IBRAHIM ALI ABDULLAHI All UMAR MY DOB 02/10/1999. All be known as MRS. DORCAS DAVID
my documents bearing YEKEEN OLUSOLA
03/05/2000 All former documents former documents remain valid. All former documents remain valid authorities MUSTAPHA BUKAR. All former EDWARD. All documents bearing my
FASILAT remain valid, the public and
Authority Concerned should take note. remain valid General public should please concern and authority General public concerned and general public should take documents remain valid . General former name remain valid. The general
take note should please take note. note. Public Should please take note. public should please take note.
MODU: I formerly known as MALAMI:I Formerly known as AUDU I formerly known and CORRECTION OF NAME I I, formerly known, called and UDU: That i was formerly known
MODU MODU BULLET, now wish BASHAR IBRAHIM ABDULLAHI addressed as ADAMU AUDU SAIDU formerly known as BASHIRU LAWALI addressed as HENRY AKPAN. I now as MISS. ALICE WARIBOKO TAMUNO.
Now wish to be known and addressed now wish to be known and addressed as BUNGUDU now wish to be known and wish to be known, called and addressed now wish to be known called and
to be addressed as MODU USMAN
ADAMU AUDU All former documents addressed as BASIRU LAWALI. All former as ANTHONY HENRY BASSEY. addressed as MRS. ALICE WARIBOKO
ALHAJI. All former .documents as MALAMI BASHAR All former
remain valid. All concern and authority documents remain valid authorities Documents bearing my former name UDU. all documents bearing my former
remain valid. General Public Should documents remain valid General concerned and general public should take remain valid. General public, banks, name remains valid. General public should
public should please take note General public should please take note.
please take note. note. institutions note. please take note.
HAYATU: I formerly known as FATSUMA I formerly known and ALHASSAN I formerly known and MARYAM I formerly known AMAECHI: That i was formerly OMONI: That i was formerly known
MODI YAWO & MODI NJIDDA addressed as FATSUMA UMARA now addressed as HASSANA NUHU ISMAEL as MARYAM ABDULLAHI SA’IDU known as MISS. ALEX LINDA as MISS. EWOMAZINO OZERO. now
now wish to be known and addressed wish to be known and addressed as now wish to be known and addressed as now wish to be known and address ONYINYECHI. Now wish to be known wish to be known called and addressed
as HAYATU NJIDDA. All former FATSUMA MOHAMMED All former LAMI ALHASSAN All former documents called and addressed as MRS. AMAECHI as MRS. EWOMAZINO OZERO OMONI.
as MARYAM SA’IDU SAULAWA. LINDA ONYINYECHI. All documents
documents remain valid . UBA PLC And documents remain valid. All concern and remain valid. All concern and authority all documents bearing my former name
authority General public should please General public should please take note. All former documents remain valid bearing my former name remains valid. remains valid. General public should
General Public Should please take note.
take note. and general public should take note General public should please take note. please take note.
REUBENI formerly known as GAGARAU I formerly known and UMAR I formerly known and MUINAT: I formerly known as I, UMOHRISON, NSIKAK MOSES, That
DAUDA REUBEN now wish to be known addressed as ASMAU GAGARAU now addressed as HARUNA YUNUSA now during the opening of my Bank Account with
MUINAT MUHEEB,MUINAT LOLA StanbicIBTC BANK, I used the name UMOHRISON,
and addressed as REUBEN DAUDA wish to be known and addressed as wish to be known and addressed as MUHEEB now wish to be known and NSIKAK. That i wish to add my middle name “NSIKAK”
YOHANNA. All former documents ASMAU BIZI GAGARAU All former IDRISSA AHMADU UMAR All former
address as MUINAT LOLA MUHEEB.
remain valid . FIRST BANK PLC And
General Public Should please take note.
documents remain valid. All concern and
authority General public should please
documents remain valid. All concern and
authority General public should please
All former documents remain valid and
from my names That I now wish to be known called
and addressed as UMOHRISON, NSIKAK MOSES. All Requirement for
documents bearing my former name remains valid.
take note. take note. general public should take note General public should please take note.
Change of Name
SHAFAUDEEN: I formerly known ISHYAKU I formerly known and BWALA I formerly known TAJO I formerly known as ERINAUGHA: That i was formerly
as MOHAMMADU SHAFAUDEEN addressed as MOHAMMED ISIAKU as SULEIMAN MOHAMMED now AMINU HASSAN now wish to known as USIOBAIFO NMACHUKWU
YAHAYA now wish to be known and
addressed as SHAFAUDEEN YAHAYA.
now wish to be known and addressed
as KALANDA ISHYAKU All former
wish to be known and addressed as be known and address as TAJO FAITH. Now wish to be known called and
addressed as ERINAUGHA NMACHUKWU
Women:
SULEIMAN MOHAMMED BWALA YAHAYA. All former documents
All former documents remain valid . documents remain valid. All concern and FAITH. All documents bearing my former
former documents remain valid.
UNITY BANK PLC And General Public
Should please take note.
authority General public should please
take note. general public should please take note
remain valid and general public
should please take note
name remains valid. General public should
please take note.
Marriage
SAMAILA: I formerly known as GERA I formerly known and
addressed as MOHAMMED KOLO ALI
LUKA I formally known as HOSSAYA
ZAKKARIYA , D.O.B 01/01/1987,now
UMAR: I, formerly known TEME: That i was formerly known Certificate or
LADI ADAMU now wish to be known as UMAR FARUK now wish to be as FAVOUR KINGSLEY CHIMA. Now
and addressed as LADI SAMAILA ALHAJI now wish to be known and wish to be known and addressed as YIGO wish to be known called and addressed
known and addressed as UMAR
All former documents remain valid
addressed as KOLO MAIYADI GERA All
former documents remain valid. united
LUKA, D.O.B/06/02/1988, All former
documents remain valid, Authorities FARUK MUHAMMAD. All former
as ORIDIKITORUSIA TEME CLIFFORD.
All documents bearing my former name
Court Affidavit;
. ZENITH BANK PLC And General security registers All concern and authority concerned and general public should documents remain valid. General remains valid. General public should
Public Should please take note. General public should please take note. please take note. public should take note. please take note. Men: Court
ALIYU I formerly known and That I was formally known Reconciliation of name That KABIRU AMINA: I, formerly known as ADEBAYO: That i was formerly
addressed as ALIYU AHMED and
HAMMED ALIHU ISHOLA now wish to as HADIZA IBRAHIM now
SALE AND SALE KABIRU ALHAJI are all referring
to one person. That SALE KABIRU ALHAJI was
AMINA ALIYU DALA now wish to known as MISS. ELEM NAOMI EZIOMA. Affidavit
Now wish to be known called and
be called and addressed as ALIYU AHMED mistakenly Captured on my (WAEC) Certi¿cate be known and addressed as AMINA
ISOLA. All former document remain valid.
wish to be called and address with number 4061801412 Dated WASSCE(SC) ALIYU EL-NAFATY. All former
addressed as MRS. NAOMI EZIOMA
ADEBAYO. All documents bearing my
Federal College of Education Katsina and as FALMATA ALI general 2018,but now wish to be address with my correct
documents remain valid. General former name remains valid. General public
name KABIRU SALE. all the concern authorities and
general public should take note and others.
public to take note general public should take note. public should take note. should please take note.
MUHAMMAD I formally known That I was formally known as HAUWA. I Formally known BUHARI: I, formerly known as
as MUHAMMAD LABBO ALHAJI KARUSKEMA MOHAMMED ALI as HAUWA MUKTAR MAGAS now BUHARI ABUBAKAR now wish to
now wish to be known and addressed and MOHAMMED KABUSKEMA wish to be called and address as be known and addressed as BUHARI
as KAKALE MUHAMMADU all former now wish to be called and address as HAUWA MUKTAR ABDU, general ABUBAKAR MOHAMMED. All
documents remain valid general MOHAMMED KABUSKEMA ALI public should please take note. former documents remain valid.
public should please take note. and general public to take note General public should take note.
GADDAFI I formally known as JAMES: I formerly known MALLAM. I Formally known as MIRS: I, formerly known
GADDAFI MUHAMMAD KALGO now as JAMES HASSAN now wish to MUHAMMAD ABDULHAMID, now wish as EDNA ELISHA DUNIYA now
wish to be known and addressed as be known and addressed as JAMES to be called and address as MUHAMMAD
wish to be known and addressed as
GADDAFI MUHAMMAD DANTANI TUMBA. All former documents remain MALLAM ABDULHAMID, All former
documents remain valid, general public MIRS EDNA YOHANNA ABBA.
all former documents remain valid valid . DIAMOND/ACCESS PLC And
should please take note. All former documents remain valid.
general public should please take note. General Public Should please take note.
General public should take note.
NAFISA I formally known KYARI I Formerly known as MUSTAPHA. I Formally MAMZA: I formerly known and
as NAFISA ALIYU ARZIKA now ABDULLAHI ALHAJI MALLI, now known as MOHAMMED MUSTAPHA, address as RHODA MARKUS ISHAKU,
wish to be known and addressed wish to be known and addressed now wish to be called and address now wish to be known and address
as BABAGANA MALLAM KYARI. as RHODA NGAMARIJU MAMZA.
as NAFISA YAZIDU all former as MUSTAPHA KARUBE, All former
All former documents remain valid. All former documents remained valid,
documents remain valid general documents should public should general public should take note please.
General public should please take note.
public should please take note. please take note.
. I formerly known as Sani FATIMA : I formerly known HAYATU. I Formally known FATIMA: I formerly known
Surajo. Now wish to be known and as YAGANA ABUBAKAR now wish as HAYATU YAHAYA now wish to as FATIMA MAIAJI, now wish
addressed as Sani Surajo Safana. All to be known as FATIMA GONI be called and address as HAYATU to be addressed as FATIMA
former documents remain. Authority ABUBAKAR . All former documents HASSAN, All former documents MOHAMMED. All former
concerned and general public should remain valid. General public should general public should please take documents remain valid. General
please take note. take note. note. Public should please take note.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
44 follow us on Twitter: @daily_trust
/(*$/127,&( /(*$/127,&(
,17+(+,*+&28572)-867,&(2)7+( ,17+(+,*+&28572)-867,&(2)7+(
)('(5$/&$3,7$/7(55,725<$%8-$ )('(5$/&$3,7$/7(55,725<$%8-$
:KHUHDVWKHSHUVRQSHUVRQVZKRVHQDPHLVVHWRXWLQWKH¿UVWFROXPQKHUHXQGHU :KHUHDVWKHSHUVRQSHUVRQVZKRVHQDPHLVVHWRXWLQWKH¿UVWFROXPQKHUHXQGHU
GLHG LQWHVWDWH RQ WKH GDWH DQG SODFH LQ WKH VDLG FROXPQ $QG ZKHUHDV WKH GLHG LQWHVWDWH RQ WKH GDWH DQG SODFH LQ WKH VDLG FROXPQ $QG ZKHUHDV WKH
SHUVRQVZKRVHQDPHDQGDGGUHVVLVVHWRXWLQWKHVHFRQGFROXPQKHUHXQGHU SHUVRQVZKRVHQDPHDQGDGGUHVVLVVHWRXWLQWKHVHFRQGFROXPQKHUHXQGHU
FODLPHGWKHUHODWLRQVKLSRIWKHVDLGGHFHDVHGDQGKDVDSSOLHGWRDERYHQDPHG FODLPHGWKHUHODWLRQVKLSRIWKHVDLGGHFHDVHGDQGKDVDSSOLHGWRDERYHQDPHG
FRXUWIRUWKHJUDQWOHWWHUVRIDGPLQLVWUDWLRQRIWKHSHUVRQDOSURSHUW\1RWLFHLV FRXUWIRUWKHJUDQWOHWWHUVRIDGPLQLVWUDWLRQRIWKHSHUVRQDOSURSHUW\1RWLFHLV
KHUHE\JLYHQWKDWWKHVDLGOHWWHUVRIDGPLQLVWUDWLRQEHJUDQWHGWRVXFKSHUVRQV KHUHE\JLYHQWKDWWKHVDLGOHWWHUVRIDGPLQLVWUDWLRQEHJUDQWHGWRVXFKSHUVRQV
XQOHVV ³127,&( 72 352+,%,7´ WKH JUDQW WKHUHRI LV ¿OHG LQ WKH SUREDWH XQOHVV ³127,&( 72 352+,%,7´ WKH JUDQW WKHUHRI LV ¿OHG LQ WKH SUREDWH
UHJLVWU\RIWKHDERYHQDPHGFRXUWZLWKLQWZHQW\RQHGD\VIURPWKHGDWHRI UHJLVWU\RIWKHDERYHQDPHGFRXUWZLWKLQWZHQW\RQHGD\VIURPWKHGDWHRI
SXEOLFDWLRQ SXEOLFDWLRQ
6&+('8/( 6&+('8/(
'(&($6('1$0($1'$''5(66 $33/,&$176)25*5$17 '(&($6('1$0($1'$''5(66 $33/,&$176)25*5$17
+ ( / ( 1 8 . : 8 1 1 $ ,)(20$ -8',7+ 1=2*%8 05 '$1/$', %252 :+2 056 &+5,67,( '$1/$',
2.$)25 :+2 ',(' 21 $1'&+,&+,526$/<1$/(. ',(' 21 7+( '$< 2) %252$1''$1/$',%252
1'
7+ 2)+286(12&5(6&(17 2&72%(5 $1' :$6 -81,25 2) 3257 1292
7+( '$<2)6(37(0%(5
52$'*:$5,13$$%8-$
$1':$65(7,5(' : 2 5 . , 1 * 8 1 ' ( 5 7 + ( 675((7:86(,,$%8-$
'$8*+7(5$1''$8*+7(5 :,'2:$1'621
=(1,7+%$1.3/&
'$7('$7$%8-$7+,67+'$<2)'(&(0%(5 '$7('$7$%8-$7+,67+'$<2)'(&(0%(5
6,*1(' 6,*1('
08+$00$'0867$3+$$'$08
08+$00$'0867$3+$$'$08
&+,()5(*,675$5 &+,()5(*,675$5
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
NEWS follow us on Twitter: @daily_trust 45
Anambra bans revenue collection on roads
Titus Eleweke, Awka
T
government’s revenue agents in officer any person who purports he Inspector-General not fold its hands and watch He explained that the
Onitsha. to be a revenue officer or agent of Police, Muhammed miscreants killing, maiming force was ready to allow
The state’s Commissioner and demands payment on any Adamu, has vowed and destroying public and peaceful protest in any part
for Information and Public of the roads in the state. that the Nigeria Police Force private property. of the nation but would deal
would not allow a repeat Also, the police boss, decisively with any group that
Ekiti Chief Judge pardons 34 inmates of the EndSARS protest
that claimed lives of police
during a working visit
to Ebonyi State Police
violates the rules.
Earlier, the state
From Raphael Ogbonnaiye, Ado-Ekiti Twenty-seven inmates were officers and destruction of Command, charged police Commissioner of Police in
set free unconditionally, while property. officers to apply “Force Order Ebonyi, Philip Maku, said the
The Chief Judge of Ekiti State, seven others were granted bail Adamu, who spoke 237” whenever their lives are command lost five officers
Justice Ayodeji Daramola, has on a liberal term. yesterday while inspecting endangered. during the EndSARS protest.
pardoned 34 inmates in the Justice Daramola, however, police formations destroyed “So when it comes to a In Anambra, the
state’s correctional centre. lamented that the prosecuting in Anambra State during the situation where you need to Commissioner of Police,
The inmates pardoned were system in Nigeria, which recent protest, said the police use maximum force especially John Abang said four police
among the 386 whose cases he said was far behind would resist any attempt to in the use of firearms, don’t officers lost their lives, while
were reviewed during Justice international best practices, attack government property forget to apply the rule as 15 others were injured.
Daramola’s working visit to the had contributed to prison
correctional centre in Ado Ekiti. congestion.
NDLEA takes fight against drug abuse to Ado LG Two shot dead in Benin
From Usman A. Bello, Benin his residence at Obanor Street, Osahon, who spoke with
From Hope Abah Emmanuel, Makurdi organised by the National
off College road, Aduwawa, journalists, said the family
Drug Law Enforcement
Two persons were yesterday Benin City. members were still in shock
Traditional rulers in Ado Local Agency (NDLEA) and
reportedly shot dead by gunmen A witness said the gunmen over the killing of one of their
Government Area of Benue facilitated by Francis Ottah
at Aduwawa and Ogida areas of stormed Osahon’s residence breadwinners.
State have pledged their Agbo, the Chairman, House of
Benin City, the Edo State capital. and met the deceased relaxing He called on the police to
support to the fight against drug Representatives Committee on
It was gathered that one of the with his immediate family investigate the killing and bring
addiction and abuse. Narcotic Drugs.
deceased identified as Ighodaro members and shot him dead. perpetrators to justice.
The monarchs, who spoke Speaking on the campaign,
Edigin Osahon was reportedly It was also gathered When contacted, the Police
during the Advocacy and Ottah Agbo said he
shot dead at his residence at that Osahon, who hails Public Relations Officer, Zone 5
Sensitisation Programme to commissioned a survey to
Mechanic Road, Ogida quarters, from Iguoshodin Nebudin Police headquarters, Benin City,
highlight the dangers of illicit ascertain the true picture of
Benin city. community near Benin City ASP Tijani Momoh confirmed
and narcotic drug use, held in drug use and abuse in the entire the killing of Osahon.
It was also gathered had a disagreement with some
Igumale, Ado Local Government Enone axis. He said two suspects have
that the second deceased, persons in the locality.
of Benue State, vowed to take “The result was shocking. been arrested in connection
whose identity was yet to be The elder brother of the
the campaign to their respective So I approached the NDLEA with the murder of Osahon.
ascertained, was shot dead at deceased, Pastor Sunday
chiefdoms to eliminate drug impressing on them the need
abuse and addiction. to conduct an aggressive
The three-day campaign
against drug abuse was
sensitisation campaign against
drug abuse in the area,” he said.
Kano cancer centre to treat over 100 patients daily
From Clement A. Oloyede, Kano to be completed by July 2021, state government is going to
Kogi gets diaspora focal point officer according to the contractor,
Engineer Kabir Usman.
install in the centre, you can
treat up to 50-100 patients
The Cancer Centre being
By Hamisu Kabir Matazu Yakubu Bassi, who received constructed by the Kano Addressing journalists per day with a single machine
the Kogi DFPO in Abuja, State Government, when during an assessment of the because the treatment time is
Nigerians in Diaspora urged her to create a database completed, is expected to project yesterday, Idris said faster; the image appreciation
Commission (NiDCOM) has of every Kogi native in the attend to over 100 patients the centre would be equipped is within 15 seconds and the
received the newly appointed diaspora and engage them. per day, the head of the state’s with three latest machines treatment delivery time is
Kogi State Diaspora Focal Bassi also advised the new Health Trust Fund, Dr. Nura (Halcyon radiation therapy within 2 minutes as against the
Point Officer (DFPO), Mrs DFPO to design a programme Idris said. system, TrueBeam and Brachy conventional one that takes
Medina Nene Anako. of empowerment and discuss The centre, situated at the Therapy) capable of treating like 30 minutes to 1 hour to
The Secretary of the areas which Kogi indigenes in Muhammadu Buhari Specialist over 100 patients per day. finish a single treatment of a
Commission, Engr. Dr Sule the Diaspora could key into. Hospital in Giginyu, is expected “For the new machines, the patient,” he explained.
DAILY TRUST, Wednesday, December 9, 2020
Like us on Facebook.com/dailytrust
46 follow us on Twitter: @daily_trust NEWS
N/Assembly to
Insecurity: Work with traditional establish rural dev’t
rulers, Buhari charges governors agency, health
infrastructure bank
By Muideen Olaniyi
Borders to be reopened soon By Abdullateef Salau &
P
resident Muhammadu Buhari his administration had done well in the President Buhari assured that that the Balarabe Alkassim
yesterday charged the governors to North East and South South, adding that the country’s military would continue to get the
work more with traditional rulers South South situation was still worrisome. support they needed to fight criminals. The National Assembly has
and community members to improve local “Every day I get situation reports about “I am not going to the public to speak commenced the process to
intelligence gathering to tackle the security illegal refineries and the blowing up of about the vehicles and equipment we establish a National Integrated
challenges facing the country. pipelines. You must stop local rogues from have ordered. What I can say is that the Rural Development Agency
Buhari stated this during a meeting with sabotaging oil installations,” he added. military received armoured cars and other and Health Infrastructure
the state governors on the issue of security The President, while addressing the issue equipment and they are training the trainers. Development Bank for
at the State House, Abuja, after listening to of banditry and kidnapping reported in each More of such equipment, including military the mobilisation and
presentations by a governor from each of of the geo-political zones, said “security is aircrafts will come in,” he added. development of rural
the six geo-political zones on their specific important and we must secure the whole Buhari, who noted that the foreign press communities in the country.
security challenges. country. We are thinking very hard on the coverage of the EndDSARS protest was not The bills for the establishment
“The sub-region is no longer safe, more so issue of kidnapping. We will make it possible balanced, cited specifically the CNN and of the two organisations have
with the collapse of the former Libyan leader, for the military to get to the bandits and BBC, for omitting the number of policemen scaled second reading at the
Muammar Gaddafi’s regime and the cross kidnappers and eliminate them.” killed, police stations that were razed, and federal parliament.
border movement of weapons and criminals. He said the closure of the nation’s land the prisons that were thrown open for The bill seeking to establish
“Governors must work with traditional borders was partly an attempt to control the inmates to escape. the National Integrated Rural
rulers. Try and work with traditional rulers to smuggling in of weapons and drugs. The President, while commenting on Development Agency, yesterday,
boost intelligence gathering,” he was quoted “Now that the message has sunk in the eight-month long strike by Academic scaled through second reading
by his spokesman, Garba Shehu. with our neighbours, we are looking into Staff Union of Universities, said lecturers in the Senate. The proposed
Buhari, while giving an overview of the reopening the borders as soon as possible,” had not taken into consideration the larger legislation titled 'Integrated
security situation in each of the zones, said he said. challenges facing the country. Rural Development Agency Bill
2020', is sponsored by Senator
Stella Oduah (PDP, Anambra
Reps lament rising South).
banditry, kidnapping in Meanwhile, at the House
of Representatives, a bill for
Dutsin-Ma, Kurfi, others the establishment of Health
Infrastructure Development
By Balarabe Alkassim Bank scaled second reading. It
was sponsored by Rep. Mansur
The House of Representatives has Manu Soro and co-sponsored by
called on the federal government the Speaker, Femi Gbajabiamila.
to tackle the menace of bandits, Leading the debate, Soro
kidnappers and armed robbers said the need for the bank
operating in Dutsin-Ma, Kurfi and was to address the gaps and
other parts of Katsina State. infrastructure challenges facing
This was sequel to a motion moved the Nigerian health sector.
by the member representing Dutsin-
Ma/Kurfi Federal Constituency, Rep.
Armaya'u Abdulkadir, during plenary Basic education:
on Tuesday.
Presenting the motion, the Kano gov’t injects
lawmaker lamented that the
incessant killings, kidnappings,
banditry and armed robbery in his From left: Former Kaduna State Deputy Governor, Barnabas Yusuf Bala (Bantex);
N6bn, records 2.3m
constituency were causing very high
losses in lives and properties as well
South African Ambassador to Nigeria Thami Mseleku; Book presenter, Sen. Uba Sani;
Author of the book, Dr. Omano Edigheji; Governor Nasir el-Rufai of Kaduna State and
increase enrolment
as displacement of people from their his wife Ummi, during the public presentation of the book titled ‘Nigeria Democracy By Chidimma C. Okeke
villages. without Development: How to fix it’, in Abuja yesterday Photo: Abubakar Yakubu
The Executive Secretary,
Universal Basic Education
Democracy can’t thrive without development – Fayemi Commission (UBEC), Dr
Hamid Bobboyi, says Kano
By Abbas Jimoh Fayemi, represented by democracy because democracy current stability they enjoy, they
State injected the sum of
Senator Olubunmi Adetunmbi, presupposes that people are want to use the instrument of
N6bn into the basic education
Ekiti State Governor Kayode said democracy can only be interested in enforcing freedom democracy to sustain that.
sub-sector between 2018 and
Fayemi has said it will be sustained by people who are and participation in governance “I hold the view that to have
2019.
difficult to sustain democracy happy. through the contribution of a democratic state, we first and
He disclosed this at the
without development. “I think development will representation. But how do you foremost must succeed as a
on-going two- day retreat
The governor said this on deliver democracy and not the do this while the majority of the developmental state because
organised for the board and
Tuesday in Abuja at the launch other way round because in an people are not even able to put it is when we get rid of poverty,
management members of the
of the book ‘Nigeria Democracy environment where you have food on their table. illiteracy and insurgency that
commission holding in Kano.
without Development: How to poverty, lack of consensus, vision “Democracy can only be you can talk of democracy,” he
He explained that with
fix it’ authored by Dr Omano for the people and nation, it is sustained by people who are said.
that huge amount, the state
Edigheji, a Special Adviser to difficult to talk about democracy. happy, who can foresee a El-Rufai, in his remarks, said it
recorded the construction
Kaduna State Governor, Malam “Without development, future for themselves and their is a paradox to have democracy
of 817 new classrooms,
Nasir el-Rufai. it is difficult to sustain children. And because of the without significant progress.
renovation of 685 classrooms,
sports@dailytrust.com
47
SPORT
Inter look to
Lukaku for
Champions
League
survival
P. 48
Cricket: New foreign coach charged to make Nigeria best in Africa talented players for the
future through the Caddy
tour. We must continue
By Joshua Odeyemi to constructively engage
our energetic youth both
Nigeria Cricket Federation male and female and to
(NCF) has set a target for its continue to support them.
new Sri Lankan coach, Asanka “I am also glad to
Gurusinha, to make Nigeria note that this Pro Am
the best in Africa within the tournament has set the
first year of his contract. record as the first time
President of NCF, Professor that a lady professional
Yahaya Ukwenya, disclosed golfer participated in the
this at the Moshood Abiola professional tour in the
Stadium, Abuja on Tuesday country. This affirms
December 8, 2020 during the that Nigeria has talents to
unveiling of the foreign coach. compete at global levels
He said: "Mr. Gurusinha's with appropriate exposure
appointment is a major and support". Buratai
statement of intent by NCF said
and he has been offered a The Chief of Army Staff
renewable contract to run for directed that the Pro Am
three years. Golf tournament be made
"He will double as Head an annual event of the
Coach and High Performance Nigerian Army and be
Manager of NCF. captured in the budget
"Coach education and of 2021 Army Sporting
mentoring has been added to Asanka Gurusinha, the Head Coach and High Performance Manager of Cricket for Nigeria events.
his responsibilities in addition handed the national team jersey during his unveiling yesterday at the Abuja National stadium Meanwhile, Michael
to developing a national Ubi of Python Golf Club,
framework for grassroots current position of 39 by the Nigeria batsmen and three up this job and I am really Port-Harcourt in Rivers
cricket coaching unique to end of his first tenure." bowlers should be ranked looking forward to the best State has promised to
Nigerian setting. Prof Ukwenya added that within Africa top 20 by the first we can achieve with the level work harder next year
"We expect him to work Gurusinha must make Nigeria 18 months of the Sri Lankan of enthusiasm, talent and to defend the Chief of
towards the long term goals to become "one of the most contract. support that the Nigerian Army Staff Pro Am Golf
of NCF stated above but physically fit teams and Gurusinha was picked Cricket Federation has.” Tournament trophy
the immediate measurable attaining number 1 ranked ahead of 32 top coaches who His immediate assignment won at the inaugural
expectations will include; fielding status in Africa within applied for Nigeria's top job. is a close camping for the top TYB -international Golf
Nigeria approaching top 20 first year." Responding Gurusinha 36 players in the country who Resorts and Country Club,
ICC T20 ranking from the He also said, at least, three said “I am very excited to take are already in Abuja. Abuja.
SPORT REPORT>>
Flying Eagles tackle
Ghana’s Satellites P. 47
Wednesday, December 9, 2020
Rabi Al-Akhar 23, 1442 AH www.dailytrust.com N200
Vol. 51, No. 88
for semi-final spot
would tap into the stronghold of the Lazio qualify for Champions
THE WEDNESDAY Dr. Hakeem Baba-Ahmed APC, but it will have to step on some big
COLUMN hakeembabaahmed@dailytrust.com, 08074520852 SMS Text Only
toes. It will have to hope it has enough League last 16
clout and traction to withstand powerful
assaults with a formidable national army
Living history
“Around a flowering tree there are many insects”.
of progressives, or at least their versions of
progressives. It will also count on the mass
loss of memory by people of Kaduna State
who lived through el-Rufai’s rule, and the
abdication of the considerable opposition
from the south west to the emergence of
African proverb a bloc that is bent on re-inventing Yoruba
A
few weeks ago, an event with great politicians, especially Chief Obafemi politics.
symbolism took place in Kaduna. Awolowo. Peddlers of political maneuvres There will be people who will remember
It was the 50th Anniversary of the and dispositions saw the hands of host that el-Rufai chose the residence of
founding of Arewa House, the name Governor Nasir el-Rufai in the decision to the Sardauna to signal a northern
for Center for Historical Research and give Fayemi such prominence at an event capitulation in the battle over rotation. He
Documentation of Ahmadu Bello with significant emotional attachment to was one of the first northern politicians to
University, Zaria. The Center itself is a past carefully protected by northerners. make the case for his party to concede its
located in Kaduna. Its size and elaborate A few indignant voices murmured presidential ticket to the south. Whether
structures will defy understanding disapproval, but these were smothered by he wants to be number two, or pave the Ciro Immobile
without the explanation that its nucleus the huge turn-out of northern governors way to another northerner as deputy,
C
used the official residence of the who sat through an unusual event that he has gone on record for making the iro Immobile scored his fifth
murdered Premier of Northern Nigeria,Sir delivered a powerful message in velvet case for a southern presidency in 2023. Champions League goal this
Ahmadu Bello, Sardaunan Sokoto. The gloves. The message was the imperative Other politicians from the south would season as Lazio reached the last
actual building where he was shot along of restructuring the nation, an idea that kiss and hug el-Rufai, but will hold back 16 for the first time in two decades on
with his wife has been preserved to serve the bulk of the northern elite agrees with, because he takes it to a person of his Tuesday with a 2-2 draw against 10-
as a piece of physical history and a tourist but is uncomfortable with the manner it choice from the wrong part of the South. man Club Brugge.
attraction. In reality, it serves as a poignant is being owned as a lethal weapon by the The cacophony of voices in support of an Immobile scored Lazio’s second
reminder of a period and a personality south. Igbo presidency without preconditions goal from the penalty spot at a rain-
that has always been larger-than-life to may have noted the arrival of a new drenched Stadio Olimpico after
northerners. The Sardauna has become a threat. These are voices that trace the Joaquin Correa had put the hosts
myth invoked to serve so many purposes foundational case for justice in a national ahead on 12 minutes.
Ruud Vormer had cancelled out
by generations that had only heard of There will be people consensus for an Igbo presidency in 2023
Correa’s opener with a Hans Vanaken
him. Arewa House keeps that myth alive, all the way back to 1966. Places like Arewa
a contrivance of a regional elite that had who will remember House tend to create difficult obstacles header on 76 minutes reviving the
clung to a past to remind itself of a strong that el-Rufai chose the to a smooth narrative on a deliberate, hopes of the visitors who played a man
symbol of northern unity, a model of good sustained and unimpeachable offensive down after Eduard Sobol’s sending off
residence of the Sardauna at Igbo peoples’ fortunes in Nigeria six minutes before the break.
governance and an event of great injustice
to the North around which so much of the to signal a northern starting with the pogroms, the civil war
history that followed his murder is hung capitulation in the battle and everything else that followed to date. Inter look to Lukaku for
by popular and scholarly historians. Some Northerners insist that the story
To celebrate 50 years since the
over rotation. He was must start from the night of January Champions League survival
Sardauna’s Spartan official residence one of the first northern 15,1966 with the murder of the Sardauna.
became a unit under Ahmadu Bello politicians to make the They tend to tally up numbers of federal
University, the drums were rolled out. soldiers who fell in an avoidable war;
Management of the Center, leadership case for his party to the post-war reintegration processes,
of the university and the State Governors concede its presidential the reinvention of Igbo politicians and
who now run the 19 States from the one ticket to the south. businessmen in the Nigerian political
region he led until the night of January economy and the pride of place which
15,1966 were small children when he Whether he wants to be Igbo enterprise occupies in every inch of
died. Many were starting school when number two, or pave the the country.
the decision was taken in 1970 to donate The invocation of experiences of the
his official residence to the University
way to another northerner Igbo in Nigeria as justification for rotating
he founded in 1963.Yet, they all knew as deputy, he has gone on the presidency to the East suffers from
enough of the power of the mystique record for making the case weak foundations in many quarters.
around the hallowed establishment to When it is reinforced by ‘shortchanging’
engineer an impressive series of activities
for a southern presidency the Igbo with only five States and the
to remind northerners and the country in 2023 failure of other Nigerians to accord the
of a past and a person whose half- myth, Igbo their right to have one of them
half- reality character represents a key become president like other groups, Romelu Lukaku
part of North’s version of its journey into It is quite possible that the event at it waxes stronger in circles that have
I
modern Nigeria. It was also turned into the Sardauna’s residence served to invite become increasingly hardened by nter Milan are counting on prolific
an occasion to celebrate the achievement more attention to a kite and a rumoured repetition and fringe politics which offers striker Romelu Lukaku to power
of a Center which started as a political alliance that will make bold statements alternatives to live in an unjust nation. the former three-time winners
statement and became a strong evidence about the nature of the competition for the It is only weakened by the poor quality into the Champions League last 16
that good scholarship can have strong country’s presidency in 2023. One among of Igbo political leadership which seeks on Wednesday in a must-win clash
roots in politics. many of these statements will strengthen concessions and benefits from the rest against Shakhtar Donetsk.
A key element in the celebrations the hand of the real ‘progressive’ elements of Nigeria only by drawing attention The Belgian scored a double in a 3-2
was the decision to yield its highest in the APC who el-Rufai and Fayemi think to its wounds and tolerating crippling win over Borussia Moenchengladbach
point to Governor Kayode Fayemi of they are. For Fayemi, it will highlight his tendencies that weaken the Igbo claim last time out to keep the Italian giants
Ekiti State to deliver a lecture with the incipient challenge of received wisdom that it is overwhelming in favour of alive in the continental competition
theme, ”Unfinished Greatness: Towards that Tinubu is and will continue to be remaining in and with Nigeria. whose knockout rounds they have not
a More Perfect Union.’’ The lecture itself the only game in the south west until There are many issues that represent reached since the 2011-2012 season.
was a master class, and it will stand as a he flies the party’s flag or hands it over major challenges to political and elite Bottom of Group B, Inter need to
reference point to excellence in scholarly to a favoured loyalist, which Fayemi is cohesion, and these will get worse as we win at the San Siro and for ‘Gladbach
research feeding a political project. The not. For el-Rufai, it will strengthen his move nearer to 2023.The past will always and Real Madrid not to draw their
selection of Governor Fayemi raised a few impatience and exasperation at the be an asset and a liability for all groups as match.
eyebrows owing to its audacity in flying drift in his party and his characteristic politicians compete against each other. “I’ve never played so well in my life,”
in the face of history of the Sardauna’s contempt for waiting in line for tradition There will be great benefits in addressing said Lukaku after bagging four goals in
fabled cat-and-mouse with Yoruba to open doors. A Fayemi-el-Rufai ticket today’s challenges with today’s solutions. as many European games this season.
Printed and published by Media Trust Limited. Corporate Office: 20 P.O.W Mafemi Crescent, off Solomon Lar Way, Utako District, Abuja. Tel: 09033477994. Lagos office:10 Acme Road, NEWSROOM 08077383812
ADVERT 08100491948
(Textile Labour House), Agidingbi - Ikeja, Tel: 09033103802. Kaduna Office: Abdussalam Ziza House, A9 Mogadishu City Centre, Kaduna. Tel: 09033044691. Kano Regional Office: 08061262474
Plot 56 behind Kano International Trade Fair complex, off Zoo Road, P.O Box 2277, Kano. Tel: 09033442116. Port Harcourt Office: No. 50 Ikwerre Road Mile 1 Diobu, Beside Diamond MARKETING 08092793662 - Abuja
Bank, Port Harcourt. All correspondence to P.O Box 6873, Wuse, Abuja. email: news@dailytrust.com A member of the Newspaper Proprietors’ 08036435009 - Kano
Association of Nigeria. ISSN119-1732 08035897055 - Lagos