Professional Documents
Culture Documents
How Enzymes Work - From Structure To Function (2015)
How Enzymes Work - From Structure To Function (2015)
medicinal chemistry, biotechnology, and medicine must be familiar with. It is the extreme
feature of protein that works in the cells. This concise book covers classic and modern
enzymology and, therefore, is an excellent guide for those who possess the basic knowledge
of chemistry and want to proceed to advanced courses.”
Prof. Takeshi Nishino
University of Tokyo, Japan
For a long time, enzymes have been studied by measuring their activity, which has
led to the advancement of “enzyme kinetics.” In recent years, the mechanism of
enzyme reaction has been explained in detail on the basis of the 3D structure. Genetic
engineering and the 3D structural analysis of enzymes contribute to these advancements
in enzymology. This book starts with an introduction to various enzymes to show how
interesting enzymes are, which is followed by historical kinetic studies on enzymes and
the overall and rapid-reaction kinetics. The subsequent topics describe the basics of
protein structure, the control of enzyme activity, and the purification of enzymes. A case
on the kinetic and structural studies of l-phenylalanine oxidase is also presented. There
are many good books on enzyme kinetics, but few describe their kinetic and structural
aspects. This book deals with both and contains many references that can be good
sources for further reading. It is handy and is especially helpful for beginners. A number
of figures, including some with stereo expression, facilitate observing the 3D structure
of enzymes.
V424
ISBN 978-981-4463-92-8
How
Enzymes Work
1BO4UBOGPSE4FSJFTPO3FOFXBCMF&OFSHZ7PMVNF
How
Enzymes Work
FROM STRUCTURE TO FUNCTION
editors
Preben Maegaard Haruo Suzuki
Anna Krenz
Wolfgang Palz
Wind Power
for the World
CRC Press
Taylor & Francis Group
6000 Broken Sound Parkway NW, Suite 300
Boca Raton, FL 33487-2742
© 2015 by Taylor & Francis Group, LLC
CRC Press is an imprint of Taylor & Francis Group, an Informa business
This book contains information obtained from authentic and highly regarded sources. Reason-
able efforts have been made to publish reliable data and information, but the author and publisher
cannot assume responsibility for the validity of all materials or the consequences of their use. The
authors and publishers have attempted to trace the copyright holders of all material reproduced in
this publication and apologize to copyright holders if permission to publish in this form has not
been obtained. If any copyright material has not been acknowledged please write and let us know so
we may rectify in any future reprint.
Except as permitted under U.S. Copyright Law, no part of this book may be reprinted, reproduced,
transmitted, or utilized in any form by any electronic, mechanical, or other means, now known or
hereafter invented, including photocopying, microfilming, and recording, or in any information
storage or retrieval system, without written permission from the publishers.
For permission to photocopy or use material electronically from this work, please access www.
copyright.com (http://www.copyright.com/) or contact the Copyright Clearance Center, Inc.
(CCC), 222 Rosewood Drive, Danvers, MA 01923, 978-750-8400. CCC is a not-for-profit organiza-
tion that provides licenses and registration for a variety of users. For organizations that have been
granted a photocopy license by the CCC, a separate system of payment has been arranged.
Trademark Notice: Product or corporate names may be trademarks or registered trademarks, and
are used only for identification and explanation without intent to infringe.
Visit the Taylor & Francis Web site at
http://www.taylorandfrancis.com
and the CRC Press Web site at
http://www.crcpress.com
Contents
Preface xi
1. Introduction 1
1.1 General Properties of Enzyme 1
1.1.1 Enzyme Specificity 2
1.1.2 Rate Enhancement 2
1.2 Examples of Enzyme 4
1.2.1 Neurotransmission and Muscular Action 4
1.2.2 Gastric Juice and Proton Pump 6
1.2.3 Genetic Test of Alcohol Sensitivity and
DNA Polymerase 9
1.2.4 Enzyme Sensor Determination of Glucose 12
6. Structure of Protein 87
6.1 Amino Acids 87
6.2 Polypeptide and Protein 92
6.3 Analysis of Primary Structure 92
6.3.1 Protein Chemical Methods 93
6.3.2 cDNA Sequencing: Dideoxy Method 96
6.4 Three-Dimensional Structure 99
6.4.1 Weak Interactions 99
6.4.1.1 Electrostatic interaction 99
6.4.1.2 Hydrogen bond 100
6.4.1.3 Hydrophobic interaction 100
6.4.1.4 van der Waals force 101
6.4.2 Secondary Structures and Their Determination 102
6.4.2.1 a helix 103
6.4.2.2 b sheet and b turn 104
6.4.2.3 Determination of secondary
structures 104
6.5 Tertiary and Quaternary Structures 106
6.6 Structural Motif and Loop 108
6.6.1 Supersecondary Structures: Motifs 108
viii Contents
Appendix 207
Solutions 211
Index 219
Preface
Haruo Suzuki
Sagamihara, Japan
January 2015
Chapter 1
Introduction
d ln k E
= a2 (1.1)
dT RT
where
d ln k E and R are the activation energy and the gas constant
= a 2 –1
(8.314RT
dT J K ), respectively. This equation explains our experience
that the reaction rate increases with increasing temperature.
–E
k = A exp a (1.2)
RT
–Ea
ln k = + ln A (1.3)
RT
Thus, the ln k vs. 1/T plot will give a linear line (Fig. 1.2). The
activation energy of a reaction could be estimated from a slope of
the plot. A most popular theory to explain the kinetics of reaction
is the transition state theory. When a reaction proceeds, a substrate
(ground state) passes over the unstable transition state (Fig. 1.1).
The energy required passing over the barrier is called activation
energy. The enzyme reduces the activation energy and thus
increases the rate of reaction. See Chapter 4 for detail.
Figure 1.2 Arrhenius plot. From the slope of the plot, the activation
energy can be determined.
Figure 1.4 The mechanism of formation of gastric juice. HK, H+, K+-
ATPase; CA, carbonic anhydrase; KCC4, K+, Cl– cotransporter;
Mt, mitochondria.
site of the E1P(H+)2 form is faced to lumen, and the E1P(H+)2 form
changes its conformation to the E2P form to release 2H+. The E2P
form binds with 2K+, which binding induces the dephosphorylation
of the E2P form to release Pi. Finally ATP and 2H+ bind to the
E2(K+)2 form with concomitant release of 2K+ to the cytoplasm to
form E1(H+)2ATP. As four steps are reversible processes, the step,
E1P(H+)2 to E2P, must be reversed under high H+ concentration
of lumen. If this is the case, the gastric H+ gradients must not be
formed. Abe et al. cleared the problem by the structural studies on
the pig H+, K+-ATPase by the Electron Crystallography [7, 9]. The
enzyme is a heterodimer protein composed of α and β subunits.
The α subunit contains 3 domains and 10 transmembrane α
helix, and 3 domains are in the cytoplasmic side. The β subunit is
composed of one transmembrane α helix. The N-terminal tail of
β subunit is interacting with the phosphorylation domain of α
subunit to stabilize the E2P form, thus preventing the reverse
reaction of E2P to E1P(H+)2. As for the stoichiometry of the mole
proton transported per mole ATP hydrolyzed, two protons can
be released in exchange for 2K+ without violating the amount
of energy available from ATP hydrolysis at pH > 3, but only a
single proton can be transported per ATP hydrolyzed at pH < 3
[7, 8, 10].
Figure 1.5 Action mechanism of H+, K+-ATPase. Notice that the proton
release to lumen is irreversible. Adapted with permission from
Abe, K., Seikagaku, 84, 115–119, 2012 [7].
Examples of Enzyme
Box 1.1
Electron Crystallography and Cryoelectron Microscopy
The X-ray crystallography uses an X-ray beam to illuminate sample,
and electron microscope (EM) uses an electron beam while light
microscope uses visible light. The difference between light and
electron microscopes is in the wavelength difference. The wavelength
of electrons in EM is about 105 times shorter than visible light.
This means, theoretically, the resolution of EM to be of atomic
levels. However, severe radiation damage caused by electron beam
irradiation has limited structural analysis of biological specimen.
Prof. Fujiyoshi and colleagues contributed greatly to the development
of the method to observe the biological samples by EM. They invented
EM to overcome various problems incurred upon applying EM to
the biological materials. One problem was the damage to samples
caused by the illumination of electron beams, and the second was
the vaporization of water in samples under vacuum in the EM. They
invented EM, which is able to be used under Cryo temperature (very low
temperature, such as liquid N2 or liquid He temperatures) to lower the
damage of samples (Cryo-electron microscopy), and they also invented
the method of sample preparation to prevent the vaporization. When
we use the two-dimensionally-crystalline samples (2D crystals)
such as sheet or helical tubular crystals, electron diffraction and/or
Fourier transformation of their micrographs allow us to determine
three-dimensional structure of biological macromolecules (Electron
crystallography). The ability to obtain structural information from 2D-
ordered arrays makes this approach particularly useful for studies of
membrane proteins in liquid bilayer. In addition to the H+,K+-ATPase
structure, structures of bacteriorhodopsin, water channel aquaporin
1, and acetylcholine receptor were reported.
Reference: Fujiyoshi, Y. and Unwin, N. (2006) Electron crystallography
of proteins in membranes. Curr. Opin. Struct. Biol., 18, 587–592.
The mutation occurs in the exon 12 of the ALDH gene. There are
three combinations of normal ALDH2 (N) and mutant ALDH2 allele
(M): NN, NM, and MM. People with NN gene possess high ALD activity
(normal activity), people with NM gene possess about 10% of the
normal ALD activity, and people with MM gene possess almost 0%
of the normal ALD activity. People who possess NM or MM gene are
highly sensitive to alcohol.
Genetic testing of the ALDH2 gene can be performed by
polymerase chain reaction (PCR) and the agarose gel electrophoresis
of the PCR products. Mullis invented the PCR method [12, 13] and
was awarded the Nobel Prize in Chemistry in 1993 for the invention.
Polymerase chain reaction is the method to amplify the region
of DNA interested. Figure 1.6 shows how the PCR method works.
First, we must design primers with about 20 nucleotides in length,
one is complementary to the 3¢-region of anti-sense sequence
(sense primer), and the other is complementary to the 3¢-region
of sense sequence (antisense primer). Template DNA, sense and
antisense primers, and dNTPs are mixed with thermostable DNA
polymerase, and are heated to about 90°C, leading to separate DNA
strands. Then the whole mixture was cooled to about 60°C, leading
to bind each primer with the corresponding sequence of DNA
chains. By heating to about 70°C, DNA polymerase catalyzes the
synthesis of complementary DNA, starting from each primer.
Thus, DNA chain is amplified twice by one cycle of these reactions.
Examples of Enzyme 11
References
1. Dixon, M., and Webb, E. C. (1958). Enzymes. Longmans, Green and Co.
London, New York, Toronto.
2. Suzuki, H. (1994). Recent advances in abzyme studies. J. Biochem., 115,
623–628 (review).
3. Quinn, D. M. (1987). Acetylcholinesterase: Enzyme structure, reaction
dynamics, and virtual transition states. Chem. Rev., 87, 955–979.
4. Silman, I., and Sussman, J. L. (2008). Acetylcholinesterase: How
is structure related to function? Chem. Biol. Interact., 175, 3–10
(Review).
5. Lindskog, S. (1997). Structure and mechanism of carbonic anhydrase.
Pharmacol. Ther., 74, l–20.
6. Hilvo, M., Baranauskiene, L., Salzano, A. M., Scaloni, A., Matulis, D.,
Innocenti, A., Scozzafava, A., Monti, S. M., Di Fiore, A., De Simone, G.,
Lindfors, M., Jänis, J., Valjakka, J., Pastorekova, S., Pastorek, J.,
Kulomaa, M. S., Nordlund, H. R., Supuran, C. T., and Seppo Parkkila, S.
(2008). Biochemical characterization of CAIX, one of the most active
carbonic anhydrase isozymes. J. Biol. Chem., 283, 27799–27809.
7. Abe, K. (2012). Unique properties of gastric H+,K+-ATPase and
conserved conformational changes among P-type ATPases.
Seikagaku, 84, 115–119. (mini-review in Japanese).
8. Morii, M., Yamauchi, M., Ichikawa, T., Fujii, T., Takahashi, Y., Asano,
S., Takeguchi, N., and Sakai, H. (2008). Involvement of the H3O+-Lys-
164–Gln-161–Glu-345 charge transfer pathway in proton transport
of gastric H+,K+-ATPase. J. Biol. Chem., 283, 16876–16884.
9. Abe, K., Tani, K., Nishizawa, T., and Fujiyoshi, Y. (2009). Inter-subunit
interaction of gastric H+,K+-ATPase prevents reverse reaction of the
transport cycles. EMBO J., 28, 1637–1643.
10. Abe, K., Tani, K., Friedrich, T., and Fujiyoshi, Y. (2012). Cryo-EM
structure of gastric H+,K+-ATPase with a single occupied cation-
binding site. Proc. Natl. Acad. Sci. U S A., 109, 18401–18406.
11. Yoshida, A., Rzhetsky, A., Hsu, L. C., and Chang, C. (1998). Human
aldehyde dehydrogenase gene family. Eur. J. Biochem., 251, 549–557.
12. Saiki, R. K., Scharf, S., Faloona, F., Mullis, K. B., Horn, G. T., Erlich, H.
A., and Arnheim, N. (1985). Enzymatic amplification of beta-globin
genomic sequences and restriction site analysis for diagnosis of
sickle cell anemia. Science, 230, 1350–1354.
References 15
13. Saiki, R. K., Gelfand, D. H., Stoffel, S., Scharf, S. J., Higuchi, R., Horn, G. T.,
Mullis, K. B., and Erlich, H. A. (1988). Primer-directed enzymatic
amplification of DNA with a thermostable DNA polymerase. Science,
239, 487–491.
14. Braun, T., Bober, E., Singh, S., Agarwal, D. P., and Goedde, H. W. (1987).
Isolation and sequence analysis of a full length cDNA clone coding for
human mitochondrial aldehyde dehydrogenase. Nucl. Acids Res., 15,
3179.
15. Cass, A. E. G. (1990). Biosensors. A Practical Approach. The Practical
Approach Series (IRL Press at Oxford University Press).
16. Clark, Jr., L. C., and Lyons, C. (1962). Electrode systems for continuous
monitoring in cardiovascular surgery. Ann. N. Y. Acad. Sci., 102,
29–45.
Chapter 2
dx
= k( a – x ) (2.1)
dt
where a and x represent the initial concentration of sucrose and
the sucrose hydrolyzed at time t, respectively. By integrating
Eq. 2.1 and by introducing the initial conditions, t = 0, and x = 0,
a
kt = ln (2.2)
a– x
Applying Eq. 2.2 to their data, the first-order rate constant was
determined. Extending the acid-catalyzed hydrolysis of sucrose,
O’Sullivan and Tompson (1890) studied the invertase-catalyzed
hydrolysis of sucrose [3]. They stopped the reaction by adding
alkaline solution to the reaction mixture, allowing mutarotation to
completion. They found that the catalytic activity is proportional to
the concentration of invertase, and that sucrose prevents the heat
denaturation of invertase. These suggest the complex formation of
invertase with sucrose. Wurts (1880) had found that papain forms
insoluble compound with fibrin. Fischer (1894) proposed a key
and lock hypothesis to explain the specificity of glycosidases. These
observations led to the concept of enzyme–substrate complex in
the current form.
Road to the Steady State Kinetics 19
Scheme 1: E + S
ES (2.3)
k
E + S E + P (2.4)
Scheme 2: E + S
ES
k
ES E + P (2.5)
E + P
EP (2.6)
Applying the mass action law to Eqs. 2.3 and 2.6, we get
e
[E]= 1 + m(a –0 x ) + nx
me (a – x )
[ES]= 1 + m(0a – x ) + nx
dx ke0(a – x )
In scheme 1, v = = k[E][S]= (2.9)
dt 1 + m(a – x ) + nx
dx kme0(a – x )
In scheme 2 v = = k[ES]= (2.10)
dt 1 + m(a – x ) + nx
Equations 2.9 and 2.10 have the different coefficient but are
homomorphic. Then these equations can be expressed as Eq. 2.11
dx a
when the initial velocity (v0 )=was C 1 + ma
dt =measured:
dx a
v0 = dt = C 1 + ma (2.11)
where C is the constant. This equation is the same form as the well-
known Michaelis–Menten equation.
The above results are very important. That is, the ES complex
is the dead-end and abortive complex in scheme 1, but the
compulsory or obligatory complex in scheme 2. However, the rate
equation is essentially the same form. This means that, only by
measuring the rate of overall reaction, one could not determine
which scheme is correct. To clarify this, kinetic and structural
studies as described in Chapters 5 and 6 are required.
pH = –log [H+]
+1 k k+2
E+S ES E+ P (2.12)
k
–1
k e s _______
v = _______ = Vs
+2 0
(2.13)
K s + s Ks + s
V = k+2e0 (2.14)
[E][S]
k–1 _______
Ks = ____ =
(2.15)
k+1 [ES]
where e0, s, V, and Ks, are the total concentration of enzyme, the
initial concentration of substrate, the maximum rate, and the
dissociation constant of ES complex, respectively.
To determine V and Ks, Michaelis and Menten determined v at
various concentration of substrate, and plotted against log s.
22 Overall Reaction Kinetics
__ s
v = _______ (2.16)
V Ks + s
From Eq. 2.16, a plot between v/V and log s will show a sigmoidal
curve as shown in Fig. 2.2. At the inflection point, log s = log Ks,
and the slope of the curve,
d(v /V ) 2.303
v= = = 0.576
d(log s ) 4
Using the property, they plotted v vs. log s, and normalized the
scale of v to give the slope of 0.576, where v/V = 0.5. Thus, V and
Ks were obtained. The dissociation constant Ks obtained was
0.0167 M. The reciprocal of Ks is the association constant; this
means that they determined the affinity of the enzyme with
substrate for the first time.
Road to the Steady State Kinetics 23
k+1 k+2
E+S ES E+ P (2.17)
1 1
= +
k+1 s k+2
k e :s
Then, v can be expressed for the enzyme concentration
v = +2 0
k+2
+s
k es k+1
v = +2 0
k+2 (2.18)
+s
k+1
24 Overall Reaction Kinetics
d[ES] (2.19)
dt = k+1[E][S]– k–1[ES]– k+2[ES]= 0
k–1 + k+2
Km = (2.21)
k+1
As Michaelis and Menten established the basis of the kinetic
treatment of the enzymatic reaction, and introduced the rate
equation. Therefore, in memory of their work, Eq. 2.20 is called the
Michaelis–Menten equation, and the parameter in Eq. 2.21 is named
as the Michaelis constant. The suffix was initially “M” [8], but “m”
is now preferably being used.
Eox + S
EoxS
Meaning of Steady State 27
EoxS + NADPH + H+
EredS + NADP+
EredS + O2
Eox + P + H2O
The mechanism suggests that the enzyme–substrate complex (EoxS)+ NADPH + H+ EredS
Eoxdoes + H+
not convert
S + NADPH to NADP+ added NADPH. They utilized this
EredS +without
+
property of the enzyme and crystallized the EoxS +complex.
NADPH + HThe EredS + NADP+
solution of the crystal was stoichiometrically reduced by
the concomitant addition of NADPH solution and produced
protocatechuate by the addition of oxygen. The findings clearly
showed that the crystal obtained corresponds to the catalytic
intermediate, and demonstrates, as a crystalline form, the presence
of the ES complex proposed nearly 50 years ago.
dx
= a – kx (2.22)
dt
The differential equation can be solved, and we get Eq. 2.23 by
introducing the initial condition (at time 0, x = 0).
a
x (1– e – kt ) (2.23)
k
28 Overall Reaction Kinetics
dp
= kx (2.24)
dt
After substituting “x” in Eq. 2.23 into 2.24, the integration of the
derived equation under the conditions (p = 0 at time 0, and p = p at
time t) yields
a (2.25)
p at – (1– e – kt )
k
In the steady state,
a (2.26)
p at –
k
Thus, the lag period (t in Fig. 2.4) is determined by introducing
p = 0 to Eq. 2.26:
1
t t
k
(a) (b)
Figure 2.4 Tab model of steady state. (a) Water flow via pool (tab).
(b) In (a), the time-dependent change of x is simulated
assuming a = 50 mL/min and k = 2 min–1. At 2.3 min, x is
99% of the steady state level, and at 4.5 min, x becomes the
steady state level. p is the time-dependent accumulation of
water from the tab, and increases linearly after the lag period
(~0.5 min). See text in detail.
Meaning of Steady State 29
dx
k+1 (e0 – x )( s0 – x – p)–(k–1 + k+2 )x (2.27)
dt
dx dx
k+1Usually, sk –»(xe–;–pthen
(e0 – x )( )–(
x )( sk0–1–+x k–+2p))–(
x k–1 + k+2 )x
dt dt 0+1 0
dx
= k+1(e0 – x )s0 –(k–1 + k+2 )x (2.28)
dt
= k+1e0 s0 –( k+1 s0 + k–1 + k+2 )x
a = k+1e0 s0
a a
0.95× = (1– e – kt0.95 )
k k
Then,
30 Overall Reaction Kinetics
e – kt0.95 = 0.05
3.0 3.0
t 0.95 (2.30)
k k+1 s0 + k–1 + k+2
3.0
t 0.95 <
k+2
2.4.2 kcat/Km
According to the Michaelis–Menten mechanism of the enzymatic
reaction, the rate (v) of the reaction is expressed under [S] « Km:
E + S1 ES1
E + P1 (2.32)
E + S2 ES2
E + P2 (2.33)
Then, the rates of the reactions are
k
v1 = cat [E][S1 ] (2.34)
K m 1
k
v2 = cat [E][S2] (2.35)
K m 2
v1 (kcat /K m )1[S1 ]
=
v2 (kcat /K m )2[S2 ]
k e [S] k
v = cat 0 = cat [E][S]
k e [S]The k /K m +value
[S] of
K menzyme is sometimes used as the efficiency
v = cat 0 = cat [E][S]
Kofm +enzyme,
[S] K m since the value is proportional to the frequency of
association of enzyme with the substrate (see Eq. 2.31). The upper
k e [S] and
limit of the value is diffusion-controlled k in the range of 108
v = cat 0 = cat [E][S]
to 10 M s [12]. The
10 –1 –1
[S] k /K m +values
k e high [S] Kare
m observed with, for
v = cat 0 = cat [E][S]
example, acetylcholine esterase
K m + [S] K m(1.6 × 10 8
M s
–1 –1
), triosephosphate
isomerase (2.4 × 10 M s ), and superoxide dismutase
8 –1 –1
Problems
(1) Concerning a plot in Fig. 2.2, introduce and confirm that the
slope at the inflection point is 0.576.
(2) Derive Eq. 2.23.
(3) In Fig. 2.4b, the tag period was shown to be 0.5 min. Deduce
this value.
(4) In Fig. 2.4b, calculate the level of water in the tab (% of the
steady state level) after 2 min of the initiation of the water
flow.
References
k–1 + k+2
Km
k+1
k+2e0 s (3.3)
v=
Km
38 Factors That Affect Enzyme Activity
and the rate linearly increases with the increase of the substrate
concentration.k+2e0 s
v=
When s » K m , the rate becomes independent of the substrate
concentration:
v = k+2 e0 = V
k es
v = +2 0
kV e s
and K m are the important parameters of enzyme, since V and
v = +2 0
K m determine the efficiency of enzyme and kan eapparent
s affinity of
v = +2 0
enzyme with substrate, respectively. Strictly K m is not equal to K s,
because K s = k–1/k+1. However, the step of ES to P usually includes
the transformation of covalent bond. Therefore, the substrate
binding and release with enzyme must be rapidly achieved k e s as
v = +2 0
compared with the step of ES to P. Thus the assumption of K m = K s
k es
is reasonable as the first approximation.
v = +2 0
Determination of V and K m is rather hard practically from the
saturation curve (Fig. 3.2). For example, in the case of the Michaelis–
Menten type enzymatic reaction, the ksubstrate
es concentration to
v = +2 0
give the rate of 0.1V is calculated to be kK+2me/9
0 s from Eq. 3.2, and the
v=
substrate concentration to give 0.9V is 9 K m . Therefore, to increase
the rate from 0.1V to 0.9V (9 times enlargement), the concentration
of substrate must be increased to 81 times of the concentration
of substrate to give the rate of 0.1V. This indicates that, by these
large changes of the substrate concentration, we only get the rate
of 0.9V. This is derived from the fact that the v vs. [S] line kis+2ea 0 s
v=
part of an equilateral hyperbola with the asymptotes of [S] = – K m
and v = V (see Fig. 3.2). To obtain the rate of reaction, the rate of
formation of product or the decrease of substrate is measured.
It is usually assumed that the error in the static measurements is
negligible as compared with the dynamic measurements. In
Fig. 3.2, the error in the substrate concentration is assumed to be
negligible, but the error in the rate measurements is not. Here, it is
worth mentioning our own static error in the measurements. For
example, when we prepare the substrate solution, pipette is usually
used. The handling of pipette is rather simple work. However,
it is recommended to check our own handling of pipette before
experiments. For example, take 10 μL of water by a pipette, and
measure its weight. Repeat these 10 times. Then we will find our
precision in our handling of the pipette. In Figs. 3.2 and 3.3, error
Substrate Concentration 39
bars are shown. A simple error is that the error region is constant
irrespective of the magnitude of v value. A relative error is that the
error region is dependent on the magnitude of v. That is, the error
region is larger with the larger v [1].
(a) (b)
(c)
Figure 3.3 Linear plots for the hypothetical enzyme in Fig. 3.2. (a) 1/v vs.
1/[S]. (b) [S]/v vs. [S], and (c) v vs. v/[S]. Error bar: upward,
simple error of 5% of V; downward, relative error of 10%
of v. In C, leftward bar, simple error of 5% of V, and rightward
bar, relative error of 10% of v. Each error bar should be
both sides, but only one side is shown for simplicity.
To overcome this problem caused from the v vs. [S] plot for
the determination of the kinetic parameters, several linear plots
40 Factors That Affect Enzyme Activity
1 1 Km 1
(A) +
v V V [S]
v
(C) v = V – K m
[S]
These are shown in Fig. 3.3 and have been named such as
Lineweaver–Burk plot (A), Hanes plot (B), and Eadie plot (C). However,
these namings are not correct historically k e[5];
s therefore, they are
v = +2 0
not used hereafter. From the plot, V and K m are easily determined.
However, the problem in using the plot of 1/v vs. 1/[S] is that
v value with relatively large error at low concentration of substrate
(high value of 1/[S]) affects the slope of the plot, leading to the error
in the determination of the kinetic parameters. Although the plot
has these problems, the 1/v vs. 1/[S] plot is widely used. Among
the three plots, the [S]/v vs. [S] plot is recommended. The statistical
method to estimate the kinetic parameters is written by Cornish-
Bowden [1].
1 1 K 1 1 1
= 1+ 2 + K 1 + K 2K 3 (3.4)
v V [S2 ] V [S2 ] [S1 ]
1 1 K K 1
= 1+ 2 + 1 (3.5)
v V [S2 ] V [S1 ]
1 1 K 11 K 2 1 1 1
1 1 1
= 1+ 2= +1+ K 1 + K+2K 3 K1 +K 2K 3
K 1 1 11 V: Kthe maximum
where 11 v1 V Kvelocityv12 ]
2[S 1V V
1obtained
+[SK2 ]K V1 [S2 ]1[S1 ], [S2 ] [S
with 1 ]∞;
1+ 2 + K 1 + K 2K 3 = 1+ 2 + = K +
1+K K + K
[S2 ] V K
v
[S :
] V
[S ] to
[S give
] vVV/2V 1 2 3
under
[S ][S 1 V
]
[S
1 1
∞;
] K
2 3
: [S ]
1 to
[S give
] V/2 1 under
1
1 1 K 121 1 2 1 1 2 2 1
= 1+ 2 2 1
K 1 + K 2K 3
+complex.
= 1+ 2 + [S1]K +∞.K K : dissociation
constant of the ES
v V [S2 ] 1 V [S2 ] [S1 ]
v V [S2 ] V 1 2 3
[S2 ] [S1 ]
The difference between the sequential and Ping-Pong
mechanisms is clear as shown in Fig. 3.4. Then, how can we
discriminate between the ordered and random bi-bi mechanisms?
These mechanisms are distinguishable by their initial-rate behavior
toward inhibitors [10].
Inhibitor 43
(a) (b)
Figure 3.4 Reciprocal plots of bi-bi mechanisms. [S2]1 < [S2]2 < [S2]3.
(a) Sequential mechanism. (b) Ping-Pong bi-bi mechanism.
3.3 Inhibitor
Substances that inhibit the enzyme-catalyzed reaction are called
the inhibitor and that enhance the reaction rate are called the
activator. Studies on the effects of these substances reveal the
action mechanism of the enzyme, and will help to develop novel
drugs to cure patients. Here, a simple reversible inhibition will be
described. Irreversible inhibition will be described in Chapter 7.
3.3.1 Reversibility
For the study of a reversible inhibition, first, the reversibility of
inhibition should be tested. Figure 3.5 shows a simple way to test
the reversibility. At first, the effect of concentration of inhibitor
on the activity of enzyme must be determined (line a in Fig. 3.5).
Then the enzyme was incubated with various concentrations of
inhibitor for a given time (for example, 5 min), and a portion of the
mixture was transferred into the assay mixture containing substrate
to determine the enzyme activity. This resulted in diluting the
concentrations of inhibitor. Figure 3.5 shows the enzyme activities
obtained by 10 (b) and 50 times (c) dilution, assuming that the
inhibitor reversibly binds with the enzyme. When an inhibitor binds
with enzyme irreversibly, the enzyme will show a lower activity
44 Factors That Affect Enzyme Activity
k +1 k
E+S
ES
+2
E+ P
k –1
Ki
EI
E+ I
(3.6)
Inhibitor 45
As V = k+2e0,
v=
1+(1+[I]/ K i )(K +2 /[S])
V
v= (3.8)
1 +(1 +[I]/ K i )(K m /[S])
k+1 k
E + S +2
ES
k
E+ P
–1
Ki
EI
E+ I
K
i
ES + I ESI (3.9)
K
S
EI +S ESI
(3.10)
V (3.11)
v=
(1+[I]/K i ) (1+ K s/[S])
V
v=
where
(1+[I]/K means the dissociation constant of the ES complex in
i ) (1+ K s/[S])
Eq. 3.1.
46 Factors That Affect Enzyme Activity
V
v= (3.12)
1+[I]/K i + K m/[S]
where Ki is the dissociation constant of ESI.
k +1 k
E+S
+2
ES E+ P
k –1
Ki
EI
E + I
K s¢ K¢
i
ESI ES + I
EI +S ESI
Notice that the dissociation constants of the ESI complex are different
from those in the non-competitive inhibition (Eqs. 3.9 and 3.10).
Applying the rapid equilibrium assumption, the rate of reaction is
V
v= (3.13)
1 + [I]/K ¢i + (1+ [I]/ K i )(K s /[S])
Competitive inhibition:
1 1 K m [I] 1
= + 1 + (3.14)
v V V K i [S]
Non-competitive inhibition:
1 1 [I] Ks [I] 1 .
= 1+ + 1+ (3.15)
v V K i V K i [S]
Uncompetitive inhibition:
1 1 [I] K 1
= 1+ + m (3.16)
v V K i V [S]
Mixed-type inhibition:
1 1 [I] K s [I] 1
= 1+ + 1+ (3.17)
v V
K ¢i V K i [S]
The reciprocal plot between 1/v and 1/[S] clearly discriminates the
1 1of
type inhibition
[I] K s (Figs. 1
[I]3.6a–3.9a). 1 [I] K s of the
1 determination
For the [I] 1
= 1+ + 1+ =
1+ + 1+
dissociation
v V K i constant,
¢
V K i, the[S] following Equations
v V are
K i derived;
¢ V K i [S]
can be determined, using Eqs. 3.18–3.22, from the plots shown in
Figs. 3.6b–3.9b,c which were known as the Dixon plot [13].
Competitive inhibition:
1 1 K m K m
= 1+ + [I] (3.18)
v V [S] VK i [S]
Non-competitive inhibition:
1 1 K s 1 K s 1 (3.19)
1+ + 1+ [I]
v V [S] V [S] K i
Uncompetitive inhibition:
[S] 1 [S]
= ([S]+ K m )+ [I] (3.20)
v V VK i
48 Factors That Affect Enzyme Activity
(a) (b)
Figure 3.6 Competitive inhibition. (a) Reciprocal plot, 1/v vs. 1/[S]. At
the constant concentration of inhibitor, v was determined at
various concentrations of substrate. The plot gives a linear
line. The slope of the line increases with increase of the
inhibitor concentration, but the lines cross at the same point
of the ordinate. (b) 1/v vs. [I] plot. The linear line obtained
with [S]1 crosses with the line obtained with [S]2. The [I]
value at the intersection is equal to –Ki.
(a) (b)
(a) (b)
Figure 3.8 Uncompetitive inhibition. (a) Reciprocal plot, 1/v vs. 1/[S].
The plot gives a linear line. The slope of the line is constant
at various concentrations of inhibitor, producing parallel
lines. (b) The [S]/v vs. [I] plot gives a linear line with the
constant [S]. The line obtained with [S]1 crosses with that
obtained with [S]2. The [I] value at the intersection is –Ki.
(a) (b)
(c)
Figure 3.9 Mixed type inhibition. (a) Reciprocal plot, 1/v vs. 1/[S]. The
plot gives a linear line. The slope of the line increases with the
increase of the inhibitor concentration, and the lines intersect
on one point. The 1/v value of the point is higher than 0 when
Ki < K i¢ (the case shown in this figure), and minus when Ki >
K i¢ . (b) The 1/v vs. [I] plot gives a linear line with the constant
[S]. The line obtained with [S]1 crosses with that obtained with
[S]2. The [I] value at the intersection is –Ki. (c) Vap is obtained
as in (a), and V/Vap is plotted against [I].
50 Factors That Affect Enzyme Activity
Mixed-type inhibition:
1 1 K s 1 1 K (3.21)
1+ + + s [I]
v V [S] V K ¢i K i [S]
V [I]
= 1+ (3.22)
Vap K ¢i
where Vap is the rate obtained at [S] ∞.
Box 3.1
Methanol Poisoning and Liquor
ADH ALDH
C2H5OH → CH3CHO → CH3COOH
CH3OH → HCHO → HCOOH
Problems
(1) Using the Michaelis–Menten equation, confirm that K m is equal
to the concentration of substrate to give the rate of V/2.
(2) For the Ping-Pong bi-bi mechanism, derive Eq. 3.5 and express
K 1 and K 2 by the rate constants.
(3) For the competitive inhibition, derive Eq. 3.8.
(4) For the uncompetitive inhibition, derive Eq. 3.12.
References 51
References
4.1 Effect of pH
4.1.1 A Basic Model
Chapter 2 described the importance of pH on the enzyme activity.
The activity changes with changes in pH, and most enzymes show
the bell-shaped pattern of the activity-pH profile. The profile can be
simply explained by assuming that the enzyme has two ionizable
groups responsible for its activity. Increasing pH, the enzyme (EH2)
having two protons loses one proton to form the active enzyme
(EH), then finally loses another proton to form the inactive enzyme
(E): EH2 EH E. Each enzyme species binds with substrate (S),
but only EHS is able to form its product (P). In addition to the
Michaelis–Menten mechanism, we consider the effect of pH on
enzymes, and introduce the following scheme (Eq. 4.1). In Eq. 4.1,
K denotes dissociation constant of each complex. In Eq. 4.2, H
(4.1)
EHH
K e1 = , K e2 = E H , K es1 = EHS H , K es2 = ES H
EH2 EH EH2S EHS
[EH2 ][S]
K ¢s = , K s = [EH][S] , K ¢¢s = [E][S] (4.2)
[EH2S] [EHS] [ES]
The total concentration of enzyme, e0, is
v = k+2[EHS] (4.4)
k+2e0
v= . (4.5)
1+ H/K es1 + K es2/H +(K s /[S]) (1+ H/Ke1 + K e2/H )
V[S]
v = __________
(4.6)
[S] + Km
Comparing Eq. 4.6 with Eq. 4.5, these equations are isomorphic;
then
Effect of pH 55
V
V= (4.7)
1+ H/K es1 + K es2/H
V V / Ks
= (4.9)
K m 1+ H/K e1 + K e2/H
V 1
=
k
where V = 1++2H0/,Kthe e es1 +pH-independent
K es2/H . maximum rate, and V, the
v=
1+ H/K es1maximum
+ K es2/H +(rate at various
K s /[S]) (1+ H/KpH. + KFrom /H )the pH-dependent changes of
K (1+ H/Ke1 K+s (1+
K e2/HH/K)e1e1 + Ke2e2/H )
V, K m, =ands V/K m, =the dissociation constants can be determined. It is
1+ H/K +1+ K es2
H/contains
H
K es1 + K es2the
/H proton dissociation constants
interesting that es1 Eq. 4.7
of the enzyme-substrate complex and Eq. 4.9 those of the free
K s (1+ HK/K(1+
enzyme. e1 +H K/e2K/e1H+) K e2/H )
Km = Km = s
1+ H/K1+ and
es1 +HK/K /H
es2es1are the
+ K es2 /Hproton dissociation constants of the enzyme
and of the enzyme-substrate complex, respectively. When the
K (1+ H/Ke1of
deprotonation + Kthe /H K) (1+site
active H/Kresidue
e1 + K e2/is H )affected by binding with
Km = s Ke2m = s
substrate,
1+ H/K es1is+ not K /equalK (1+
H HH//KKes1
1+ to . ++
e1 KKK s (1+
However,//HH)H/when
Ke1 + Kite2/isH )not affected
K es2= s K = e2es2
with the substratem binding, 1+ H/K es1ism+equal K es21+/HtoH/K es1. +
InKaddition
es2/H to these,
functional groups in the active site of enzyme would be speculated
from the proton dissociation constant.
V 1
= (4.10)
V 1+ H/K es1 + K es2/H
(V/K m ) 1
(4.11)
(V/K s ) 1 + H/K e1 K e2/H
Both Eqs. 4.10 and 4.11 are isomorphic.
V 1
Therefore, Eq. 4.10 is used
=
to explain the Dixon plot. Log (V/V ) is1+
plotted
H/K es1against
+ K es2/HpH (Fig. 4.1).
The following explanation can be applied for the corresponding plot
56 Effect of pH, Temperature, and High Pressure on Enzymatic Activity
for Eq. 4.11. Here, the acidic and alkaline pK are represented as pK1
and pK2, respectively. Increasing pH, the crossing point between
horizontal and vertical guidelines with a slope of 1 gives an acidic
pK1 (Fig. 4.1; pKes1, pKe1 of Eqs. 4.10 and 4.11, respectively). Similarly,
V 1
=
Figure 4.1 Dixon plot. Log (V/ V ) values
1+ H/Kare plotted against pH. The
es1 + K es2/H
theoretical values obtained with the constant pK1 = 6 and
various pK2 = 7 (line), 8 (dashed line), and 9 (short dashed
line) are shown. Guidelines are shown by thin dashed line.
Crossing points are the pK values to be determined.
side are deviated from the assumed pK2 values, especially for
the combination of pK1 = 6 and pK2 = 7 and 8. These analyses
recommend to use the method when the difference of pK
(=pK2 – pK1) is assumed to be greater than 3.
The third method is to determine pK values applicable for
the cases that the difference in the pK values is smaller than 3.
Based on the plot of Fig. 4.2, determine pHop, pH1, and pH2. Then,
the proton concentration at these pHs are calculated to be [H+o p ] ,
[H 1+ ], and [H +2] , respectively. These concentrations are represented
as Hop, H1, and H2, respectively. Then from Eq. 4.7, we have
H1 + H2 = 4Hop + K1 (4.13)
Hop, H1, and H2 can be determined from the plot (Fig. 4.2); then it
is easy to calculate pK1 and pK2. For example, let us determine pK
values from the plot in Fig. 4.2. Try with the smallest bell-shaped
line that was obtained by assuming pK1 = 6 and pK2 = 7. By enlarging
Fig. 4.2, the pHop, pH1, and pH2 were estimated to be 6.50, 5.64,
and 7.32. Then, we get the values: Hop = 3.16 × 10–7 M, H1 = 2.9 ×
1+ H/K es1 + K es2/H
V 1
=
Figure 4.2 V/ V vs.1+pH
H/Kplot for the hypothetical enzymatic reaction
es1 + K es2/H
V in Fig. 4.1.
shown 1 Horizontal dashed lines show half of the
=
V/ V values
1+ H/atK es1
each+ Koptimum
es2/H
V pH. This method
=
1 indicates that
the crossing point with V/ V value
1+ Hgives
/K es1 the
+ K es2 /H (pK1) and
acidic
alkaline pK (pK2).
58 Effect of pH, Temperature, and High Pressure on Enzymatic Activity
Figure 4.3 Dixon plot for the yeast l-lactate dehydrogenase (cytochrome
b2) reaction. Reproduced from Suzuki and Ogura [5].
E+S ES
E+ P (4.14)
[ES]e
K = _________
(4.15)
[E]e[S]e
DG = –RT ln K (4.16)
where T is an absolute temperature and R the gas constant.
The equilibrium constant K is related to the standard enthalpy
change (DH°) for a given reaction, known as van’t Hoff equation:
d ln K DH (4.17)
=
dT RT 2
By the determination of K values at various temperatures, the
slope of a linear plot of ln K vs. 1/T will give the DH° value.
The second law of thermodynamics gives Eq. 4.18:
DG = DH – TDS (4.18)
S = kB ln W (4.19)
–1
where kB is the Boltzmann constant 1.3807 × 10–23 JK ; obtained
by dividing gas constant by Avogadro constant), and W is the
number of microstate of a system. The concept of W is difficult to
explain. It may not be strict, but a generally accepted meaning of
entropy is a measure of randomness or uncertainty of a system.
From Eq. 4.20, DS° can be determined. Thus, we have three
thermodynamic parameters, DG°, DH°, and DS°.
D H – DG
DS (4.20)
T
Box 4.1
Standard State, Unit of Pressure, Gas Constant
S S P
(4.21)
The transition state
S (S)
isinP equilibrium with the initial state.
Then,
[S ] (4.22)
K =
[S]
DG =where
–RT ln K and DG =are–RTthe equilibrium
ln K
constants in Eq. 4.21 and
the free energy of activation to reach the transition state, respectively.
The concentration of substrate in a transition state is
–DG
[S ]=[S] exp (4.24)
RT
kBT (4.25)
v= [S ]
h
kBT –DG
v= [S] exp (4.26)
h RT
DG = DH – T DS
d ln kf DH + RT
= (4.28)
dT RT 2
From the Arrhenius Eq. 1.1 and Eq. 4.28,
DH≠ = Ea – RT (4.29)
kBT
The activation free energy, DG is
= –from
RT ln kf 4.27,
Eq. – ln
h
kBT (4.30)
DG = –RT ln kf – ln
h
d DH
(ln K m ) = – (4.33)
dT RT 2
K s (1+ H/Ke1 + K e2/H )
The enthalpy change can be determined by measuring K m at
= various
1+ H/K + K es2/H
temperatures. That is, the thermodynamic parameters of the es1
equilibrium: E+S
ES can
beE+
determined.
P
Temperature Dependence of the Enzymatic Reaction 65
(a) (b)
d ln K DV (4.35)
=–
dp RT
d lnwhere
K DV is the activation volume, and defined to be the difference
=–
dpbetweenRTthe volume of the transition state and that of the reactant
state. Substitution of Eq. 4.23 gives
d( DG )
= DV (4.36)
dp
d ln k d kBT DV DV
= ln – =– (4.37)
dp dp h RT RT
Figure 4.8 The entropy change from the initial state to the transition state
(TS) in the deacylation reaction of the acylated α-CHT. The
data in Table 4.2 are used. It is assumed in the figure that the
entropy of TS is the same for these acyl-enzymes.
The Effect of Temperature and Pressure on α-Chymotrypsin-Catalyzed Reaction 71
Using Eq. 4.38, the slope of the linear plot gives the activation
volume of the acylation reaction. The volume is calculated to be
d ln k d kBT DV = –23.7
DV cm3/mol using the gas constant of 0.0831 L bar
= ln – = –
dp dp h K–1mol–1
RT . The rate-determining step of acylation reaction for the
RT
k1
p-nitrophenyl ester substrate is known to be the step: ES ET.
kBT DV = –23.7
ln k d volume
Therefore, the dactivation DV cm3/mol must be
= ln – =–
explained by the dp
interactions
dp hin theRT
transition
RT state (Fig. 4.11). The
interactions are, the formation of the covalent bond between the
O atom of Ser195 and the carbonyl C of substrate, the charge
concentration at the carboxy O atom of substrate and at the N
atom of the imidazole ring of His-57, and the formation of two
hydrogen bonds between the O atomof Ser195 and the N atom
of the imidazole ring, and between the N atom of the imidazole
and the carboxy O atom of Asp102. These interactions are
considered to be formed simultaneously [14]. From the model
system [see 14 for references], the volume changes are known.
That is, –10 cm3/mol for the formation of covalent bond, –5 cm3/
mol for the hydrogen bonding, and –5.5 cm3/mol for the charge
concentration. The sum of these values (–25.5 cm3/mol) agrees
with the activation volume (–23.7 cm3/mol). Therefore, these
interactions are in the transition state from ES to ET.
Problems
(1) Derive Eqs. 4.12 and 4.13.
(2) Bender et al. studied the deacylation reaction of N-acetyl-l-
tyrosyl-α-chymotrypsin. They obtained k+3 = 193 s–1, and the
References 73
References
1. Dixon, M., and Webb, E. C. (1958). Enzymes. Longmans, Green and Co.
London, New York, Toronto.
2. Nakamura, T. (1993). Enzyme Kinetics. Japan Scientific Societies Press
(in Japanese).
3. Harris, T. K., and Turner, G. J. (2002). Structural basis of perturbed
pKa values of catalytic groups in enzyme active sites. IUBMB Life, 53,
85–98 (review).
4. Isom, D. G., Castañeda, C. A., Cannon, B. R., Velu, P. D., and Garcis-
Moreno, E. (2010). Charges in the hydrophobic interior of proteins.
Proc. Natl. Acad. Sci. USA, 107, 16096–16100.
5. Suzuki H., and Ogura, Y. (1970). Effect of pH on the kinetic parameters
of yeast l(+)-lactate dehydrogenase (cytochrome b2) J. Biochem.,
67, 291–295.
6. Xia, Z.-X., and Mathews, F. S. (1990). Molecular structure of
flavocytoshrome b2 at 2.4 Å resolution, J. Mol. Biol., 212, 837–863.
7. Jencks, W. P. (1969). Catalysis in Chemistry and Enzymology. McGraw-
Hill, New York.
8. Laidler, K. J., and King M. C. (1983). The development of transition-
state theory. J. Phys. Chem., 87, 2657–2664 (review).
9. Pauling, L. (1948). Chemical achievement and hope for the future.
Am. Scientist, 36, 51–58.
10. Morild, E. (1981). The theory of pressure effects on enzymes.
Adv. Protein Chem. 34, 93–166 (review).
11. Boonyaratanakornkit, B. B., Park, C, B., and Clark, (2002). Pressure
effects on intra-and intermolecular interactions within proteins.
Biochim. Biophys. Acta, 1595, 235––249 (review).
12. Blow, B. M., Birktof, J. J., and Hartley, B. S. (1969). Role of a buried
acid group in the mechanism of action of chymotrypsin. Nature, 221,
337–340.
13. Bender, M. L., Kezdy, F. J., and Gunter, C. R. (1964). The anatomy
of an enzymatic catalysis a-chymotrypsin. J. Am. Chem. Soc., 86,
3714–3721.
74 Effect of pH, Temperature, and High Pressure on Enzymatic Activity
14. Makimoto, S., Suzuki, K., and Taniguchi, Y. (1986). Effect of pressure
on the pre-steady state kinetics of the hydrolysis of p-nitrophenyl
pivalate catalyzed by a-chymotrypsin. Bull. Chem. Soc. Jpn., 59,
243–247.
Chapter 5
E+S
ES E + P
The overall reaction kinetics tells that the maximum rate is
equal to k+2e0. Thus, we can easily determine the rate constant k+2
dividing the maximum rate by the total enzyme concentration.
However, it is not certain whether the rate constant is correct
without observing directly the step: ES to E + P. As described in
Chapter 2 (Section 2.3.2), the time scale of the step is usually below
1 sec. Therefore, the special apparatus is required to observe the
step. The readers may recall one of the stopped-flow methods in
Chapter 2. This chapter describes the method in detail and focuses
on the analysis of the first-order reaction.
(a) (b)
Figure 5.2 (a) The schematic view of the rapid-freezing apparatus. The
enzyme (E) and substrate (S) are mixed by the chamber (M)
from where the reaction mixture is sent through the length-
changeable tube to the isopentane cooled with liquid nitrogen.
The fine particles of the mixture were pushed down to the
bottom of the EPR quartz tube. (b) The FMN semiquinone level
during the reduction of the FMN cofactor of yeast cytochrome
b2. Reproduced from Suzuki and Ogura [4].
+1k
E + Tyr + ATP ETyr AMP + Pyrophosphate
+2k
ETyr AMP + tRNA E + Tyr-tRNA + AMP
(a) (b)
d[S] (5.2)
v =– =k
dt
Integration of Eq. 5.2 from time 0 to t gives
where[S]t=
[S] –and
t=
kt +[S]
– kt +[S]represent the concentration of S at time t and
0 0
time 0, respectively. The substrate concentration decreases linearly
with time (Fig. 5.4). The zero-order reaction is observed in the
enzyme reaction with sufficiently high substrate concentration.
Figure 5.4 The zero-order reaction. The plot of Eq. 5.3 is shown.
d[S]
– = k[S] (5.4)
dt
Integration of Eq. 5.4 from time 0 to t gives
– kt1/2
[S]0/2 = [S]0e (5.7)
Then,
ln 2 = kt1/2
0.693 (5.8)
t1/2 =
k
0.693
Thus, the half-life (t1/2)= is determined from the rate constant,
k
and inversely the rate constant is determined from the half-life.
Figure 5.5 shows the example of the first-order reaction: the
disintegration of radioisotope, P32. P32 disintegrates to S32 with the
concomitant emission of b ray (particle). The half-life of P32 is 14.3
days, and the rate constant of the decay is 0.04846 day–1.
(a) (b)
Figure 5.5 The first-order reaction. The plots of Eqs. 5.6 (a) and 5.5 (b)
are shown. The amount of P32 is an arbitrary unit. The half-life
can be determined by the dashed line as shown in (a).
dx
= k[S1][S2] = k([S1 ]0 – x )([S2 ]0 – x ) (5.10)
dt
dx
= k[S1][S 2] = k([S1 ]0 –
where and
x )([S2 ]0 –are
x ) the concentrations at time 0, and x is the
dt
product concentration at time t. Integration of Eq. 5.10 from time 0
to t gives
1 [S2 ]0 ([S1 ]0 – x )
ln = kt (5.11)
[S1 ]0 –[S2 ]0 [S1 ]0 ([S2 ]0 – x )
[S2 ]0 ([S1 ]0 – x )
The plot of ln against t will give a linear line with a
[S1 ]0 ([S2 ]0 – x )
dx dx
= k[S
= k][S
[S
slope
][S
] = kof
] ([S
=kk1([S
(]0 –1 ]x0 )([S
– x )([S
2 ]0),–2 ]thus
x0 )– x )leading to obtain the second-order rate
dt dt 1 12 2
constant k.
dx dx
= k[S
=Ink][S
[S
the][S
] case
= k] ([S
= ofk1([S
]0 –1 ]x0 )([S
–= x )([S2 ]0,–
2Eq.
]x0 )–5.11
x ) does not apply; then Eq. 5.10 is
dt dt 1 12 2
dx
k([S1 ]0 – x )2 (5.12)
dt
Integration of Eq. 5.12 gives
x
= kt (5.13)
[S1 ]0 ([S1 ]0 – x )
The plot of Eq. 5.13 yields the second order rate constant, k.
The pseudo-first-order treatment of the second-order reaction
is convenient and simple to obtain the second-order rate constant,
and applicable in various cases. In the reaction of Eq. 5.9, the
reaction rate is expressed as Eq. 5.14:
d[S1] d[S ]
– = – 2 = k[S1][S2 ] (5.14)
dt dt
dx
When the experiments were performed= under k[S1][Sthe k([S1 ]0 – x )([S2 ]0»– x )
2] = conditions,
dx dt
= k[S1][S2] = k([S1 ].0 Then,
– x )([Sthe
2 ]0 –concentration
x) of S2 is assumed to be constant during
dt
the reaction,
dx
= k[S1][S2] = k([S
1 ]0 C– =x )([S
k 2 ] 0 – x ) (5.15)
dt
which then yields
Analysis of the First-Order Reaction 83
d[S1]
– = C [S1] (5.16)
dt
This equation means the first-order reaction; so we can
determine the rate constant, C, at a given concentration of S2.
Therefore, a set of C can be obtained at various concentrations of S2.
A plot of Eq. 5.15 yields the second-order rate constant k (Fig. 5.6).
More complex reactions are given in reference [6].
0.693
t1/2 =
k
Thus, it seems easy to determine the rate constant from the half-life.
However, it is not so simple as expected. As for the reaction,
k
S P
Figure 5.7 The determination of the first-order rate constant from the
half-life (t1/2). The absorbance follows a first-order fashion.
The final absorbances are assumed to be two cases, a and b.
l1, l2, l3, … and l1, l2, l3, …, respectively, where D is an increase of
the constant time. Then we have
Problems
1. In the Michaelis–Menten mechanism, the rate of reaction
is zero-order and first-order reactions at high and low
concentrations of substrate, respectively. Confirm these.
2. Derive Eq. 5.17.
References
Structure of Protein
Figure 6.1 Amino acid. Four groups are bound to the central carbon
atom. R represents the side chain.
Figure 6.2 (A) Stereo-isomer. Four groups (a, b, d, and e) are bound to the
tetrahedral carbon atom. The right configuration is a mirror
image of the left. (B) Fisher projection. From the reader, the
carboxyl group is on the top, and the side chain on the bottom,
these groups on the vertical line are pointing back of the plane
of page; The hydrogen and amino group on the horizontal line
are pointing toward the reader. As the amino group is on the
left side in the figure, the amino acid is named l-isomer.
Note: Amino acids are shown, full name, three-letter code, one-letter code. The pKa
values from Dawson et al., Data for Biochemical Research, 3rd ed., Clarendon Press,
Oxford [5], and those of carboxyl and amino groups, and of side chains are shown.
aOne carbon of the side chain is bound to a-carbon, and the other carbon is bound to
the amino nitrogen.
bThe 21st amino acid.
cThe 22nd amino acid.
92 Structure of Protein
(a)
(b)
MMLTECPNCGPRNEFKYGGEAHVAYPEDPNALS
Analysis of Primary Structure 95
6.7). In Fig. 6.8a, two A bases are included in the DNA strand;
thus two new strands are observed by stopping at each of the
T bases. Figure 6.8b shows the strands to be formed in the
presence of ddATP, ddGTP, or ddCTP. When [a-32P]-labeled dATP was
used, and the polyacrylamide gel electrophoresis was performed
for the reaction mixture, all possible newly formed 11 strands
were observed as the labeled bands. Experiments with isotope-
labeled compounds need the restricted room. Therefore, nowadays,
fluorescent ddNTPs with different colors are used to label the
newly polymerized strands. A sequence of the original strand is
complementary to that determined experimentally.
5
3 2
5
3 2
Figure 6.7 Structures of deoxynucleotide triphosphate (dNTP) and
dideoxynucleotide triphosphate (ddNTP). A DNA strand
of polymerase reaction elongate from the 5-end to the 3-
end, and the 3-OH group of ribose ring is essential for the
elongation of the strand. Thus the elongation stops at the point
where the ddNTP linked to the elongating 3-end.
(a)
(b)
(c)
X – HY
where the three dots denote the hydrogen bond. X–H represents
the hydrogen bond donor, Y the acceptor. The X – HY hydrogen
bond angle tends toward 180° and should preferably be above
110° [10]. Water dimer in vapor is hydrogen bonded each other,
and the O–H bond angle deviates 6 ± 20° from the O…O axis [11].
In proteins, the angle (X–H angle against X…Y axis) is usually not
0° due to the steric hindrance.
weaker when they are apart each other. On the other hand, the
repulsive force works when they approach too close because
electrons surrounding the nucleus repulse. The distance between
the nucleuses inducing the highest van der Waals force is named van
der Waals radius, and determined for atoms. For example, hydrogen,
oxygen, nitrogen, and carbon are 0.12, 0.14, 0.15, and 0.17 nm,
respectively. The van der Waals force is defined by IUPAC [16].
O O-
..
C䃐䠉C䠉N䠉C䃐
C䃐䠉C䠉N+䠉C䃐 (6.3)
H H
angles are in the range of certain values along the certain length
of polypeptide. The structure is named the secondary structure.
Figure 6.10 shows typical structures, a helix, anti-parallel b pleated
sheet structures, and b turn.
Figure 6.10 Secondary structures. Dark ribbons show the main chain
conformation of bovine pancreatic trypsin (pdb code: 2qcp).
Left: a helix, residues from Y234 to S244. Center: Completely
stretched main chains are positioned anti-parallel each other
(anti-parallel b pleated sheet). The residues from Q135 to
G140 and from K156 to P161. Right: b turn, a polypeptide
changes the direction 180°. The central amide plane (dotted
square) has two conformations, I and II. The conformation of II
is that of I rotated 180°. In each case, the main chain O atom is
hydrogen-bonded to the H atom of the N-H, thus stabilizing the
structures.
6.4.2.1 a helix
The a helix is usually a right-handed helix of polypeptide composed
of l-amino acid residues. A left-handed a helix must be rarely
observed with polypeptides with l-amino acid residues if any
because of the steric hindrance. The main chain carbonyl oxygen
atom is hydrogen-bonded with the main chain imino hydrogen
atom. The hydrogen bond forms a loop between n amino acid
residues. The number of atoms forming the hydrogen bond is 3n + 4.
For one round of a helix, 3.6 amino acid residues are included,
thus 13 atoms forms one hydrogen bond. Therefore, a helix is also
called 3.613 helix. As shown in Fig. 6.10, the side chains are on the
outside of the helix. The amino acid residues, Glu, Met, Ala, and
104 Structure of Protein
where eL and eR are the absorption coefficients of the left and right
circularly polarized light. The dimension of q is deg cm2 dmol–1.
The protein must contain various amounts of a helix, b sheet, and
random coil. For the determination of each content, the spectrum
obtained by the CD apparatus is fitted by summation of fractional
multiples of reference spectrum (like Fig. 6.12) for a helix,
b sheet, and random coil. The multiples that give the best fit for
the spectrum are the contents of each secondary structure. The
CD apparatus is usually equipped with the computer-assisted
determination of the secondary structures. CD is easy and excellent
method to estimate secondary structures, but does not give the
region of the structures along the sequence of a protein. This
weak point must be overcome by using the secondary structure
prediction.
Chou and Fasman proposed the method of prediction of the
secondary structure from the primary structure [18]. This is
based on the experiments of RNAse A by C. B. Anfinsen. RNAase A
consists of 124 amino acid residues and contains 4 disulfide groups.
When these disulfide groups were reduced by 2-mercaptoethanol
in the presence of 8 M urea, the 3D structure of the enzyme
was broken. Therefore, the enzyme completely lost its activity.
However, when 2-mercaptoethanol and urea were removed from
the mixture, the denatured enzyme recovered its 100% of the
original activity. These observations mean that the information
of 3D structure of the enzyme is involved in the primary structure.
The fact leads to the idea that 3D structure of protein must
be predicted from the primary structure. Chou and Fassman
106 Structure of Protein
(a)
(b)
Figure 6.14 Structural motifs. A, helix loop helix. B, coiled coil. C, zinc
finger. D, hairpin b. E, Greek key. F, bab. Nt, Ct represent the N
and C terminal sides of polypeptide, respectively. In C, C and H
represent Cys and His residues, respectively.
110 Structure of Protein
Figure 6.16 Examples of a coiled coil, zinc finger, hairpin b, and Greek
key. Structures are shown by ribbon. The coiled coil and zinc
finger motifs are bound to groove of a DNA double helix. Pdb
code:1ysa (coiled coil), 1zaa (zinc finger), 1k6u (hairpin b),
and 4gcr (Greek key). A double Greek key is shown.
3-phosphate (GAP). The kcat/Km value of TIM is 3.7 × 108 M–1s–1 for
GAP and >107 M–1s–1 for DHAP as substrate. These values are very
close to the diffusion limit, thus TIM is “almost perfectly evolved”
enzyme. A loop has an important role for the enzyme function.
The structure of TIM is consisting of the bab motif (Fig. 6.17B,C).
The residues Trp168 to Thr177 are composing a flexible loop,
which is covering substrate in the active site. Knowles’ group
showed that the removal of 4 residues (from residue 170: Ile-Gly-
Thr-Gly) gave approximately 105 times lower activity of the wild-
type enzyme. Probably, the loop must prevent a cis-endiol
intermediate from decomposing to methyglyoxal and phosphate.
Figure 6.17 A, bab motif. A carbonyl group of A66 in l-Phe oxidase (pdb
code: 3ay1) interacts with the phosphate group of FAD (only
ADP region is shown). B, C. Triosephosphate isomerase
(TIM) barrel (pdb code:7tim). A substrate analogue,
phosphoglycohydroxamate (cyan spheres), is covered with
loop (pink). Red spheres are the active site residues. Eight
a helices and eight b strands form a barrel-like structure,
thus called TIM barrel.
Problems
References
1. IUPAC. Organic chemistry division commission on nomenclature of
organic chemistry. Rules for the nomenclature of organic chemistry.
Section E: Stereochemistry (Recommendations 1974). Collator: Cross
L. C. and Klyne, W. Pure Appl. Chem., 45, pp. 11–30, 1976.
2. Bijvoet, J. M., Peerdeman, A. F., and Bommel, A. J. V. (1951). Deter-
mination of the absolute configuration of optically active compounds
by means of x-rays. Nature, 168, 271–272.
3. Bock, A. K., Heider, F. J., Leinfelder, W., Sawers, G., Veprek, B., and Zinoni,
F. (1991). Selenocysteine: The 21st amino acid. Mol. Microbiol., 5,
515–520.
4. Gaston, M. A., Jiang, R., and Krzyckil, J. A. (2011). Functional context,
biosynthesis, and genetic encoding of pyrrolysine. Curr. Opin. Microbiol.,
14, 342–349. (Review).
5. Dawson, R. M. C., Elliott, D. C., Elliott, W. H., and Jones, K. M. (1986).
Data for Biochemical Research (3rd ed., Clarendon Press, Oxford).
6. Sanger, F. (1959). Chemistry of insulin. Science, 129, 1340–1344.
7. Edman P. (1950). Method for determining of the amino acid sequence
in peptides. Acta Chem. Scand., 4, 283–293.
8. Sanger, F. (1988). Sequences, sequences, and sequences. Annu. Rev.
Biochem., 57, 1–29 (review).
114 Structure of Protein
CH3CH(OH)COO– + NAD+
CH3COCOO– + NADH + H+ (7.1)
The structural and mechanistic studies revealed that hydride ion
is removed from a hydrogen atom of lactate to form NADH. As
Eq. 7.1 shows, NAD+ (NADH) acts like substrate in various enzymatic
reactions.
7.2.4 Heme
Heme is a compound that has a structure shown in Fig. 7.4. Four
pyrrole rings are linked by methine to form porphyrin ring. The
center of the ring contains iron, and the difference in the side chains
composes different hemes, such as cytochrome a, b, c, and so on. The
structure minus iron in Fig. 7.4 is named protoporphyrin IX (also
called heme b). Heme is the red component in oxygen transport
proteins, hemoglobin and myoglobin. The central ferrous iron of
these proteins binds with oxygen. Heme is a prosthetic group of the
oxidation-reduction enzymes, such as peroxidases, cyclooxygenase,
cytochrome b2 (l-lactate dehydrogenase), nitric oxide synthase,
and cytochrome P450. In addition, cytochromes have a role of one
electron transfer in mitochondrial electron transfer system.
Figure 7.4 The structure of heme. A region of the dashed circle indicates
porphyrin ring with iron in the center.
Figure 7.6 PLP forms a Schiff base with the side chain of Lys residue of
enzyme. Amino group of substrate amino acid is exchanged
with the e amino group of the Lys residue.
Cofactor, Coenzyme, Prosthetic Group 123
7.2.6 Folate
Folate is composed of pterin, p-amino benzoate, and glutamate
residue (Fig. 7.7). 5,6,7,8-tetrahydrofolate (THF) works as a cofactor
of the C1 transfer reactions, such as formylation of Met-tRNA,
syntheses of Gly, Ser, Met, and pyrimidine and purine nucleotides
[6]. The Glu residue of THF presents as tri- to hexamer, and has a
role to bind with enzyme protein. THF is synthesized by two steps
reduction of folate by way of 7,8-dihydrofolate. The C1 donors are
synthesized enzymatically from THF. 5,6,7,8-Tetrahydrobiopterin
is a cofactor of monooxygenase, such as Phe hydroxylase and Tyr
hydroxylase.
(a) (c)
(b) (d)
+ H+
Figure 7.8 The activation of TPP. (a) Structure of TPP. (b) The hydrogen
atom (dashed circle in a) bound to the thiazolium C2 is released
as H+, and the C2 carbon becomes negatively charged. (c) The
active site structure of pyruvate decarboxylase (pdb: 1pyd).
The distance (2.4 Å) between the carboxy O atom of Glu51 and
N1¢ atom of TPP, and the internal distance (3.0 Å) from N4¢ to
C2 of TPP are sufficient for H+ transfer. (d) The C2 carbanion
attacks the carbonyl carbon of substrate, forming a common
intermediate in TPP-dependent enzymes.
Cofactor, Coenzyme, Prosthetic Group 125
7.2.8 Biotin
Biotin is a cofactor of enzymes that catalyze carboxylation reactions.
Biotin is covalently bound to the enzyme through an amide bond
between the carboxyl group of biotin and the e amino group
of Lys residue of enzyme (Fig. 7.9). Pyruvate carboxylase is a
representative of carboxylating enzymes [8]. The first step is an
ATP-dependent formation of the carboxybiotin, and then it reacts
with enolpyruvate to produce oxaloacetate (Fig. 7.9). Here
enolpyruvate is a tautomer of pyruvate.
(a)
(b)
Figure 7.9 (a) Biotin bound to the e-amino group of the side chain of Lys
residue of enzyme. The dashed circle indicates the reaction
site of the cofactor. (b) A scheme of formation of oxaloacetate
from enolpyruvate and carbonic ion.
126 Active Site Structure
7.2.9 Lipoamide
Lipoamide is a cofactor that catalyzes the acyl group transfer
reaction in pyruvate dehydrogenase complex and 2-oxoglutarate
dehydrogenase complex. The cofactor covalently binds to enzyme
protein by the amide bond with the e-amino group of Lys residue
(Fig. 7.10a). In the pyruvate dehydrogenase complex, lipoamide
receives acetyl group from hydroxyethylthiamine pyrophosphate to
form acetyl-lipoamide Fig. 7.10b), which transfers the acetyl group
to CoA-SH to form acetyl-S-CoA.
(a)
(b)
Figure 7.10 Lipoamide cofactor and its function. (a) Structure of lipoamide
cofactor. (b) In pyruvate dehydrogenase complex, lipoamide
receive methyl group from hydroxyethylthiaminepyrophos-
phate to produce acetyldihydrolipoamide, which transfer
acetyl group to Coenzyme A.
(7.5)
128 Active Site Structure
(7.6)
(7.8)
(7.9)
(7.10)
(7.11)
(7.12)
7.3.1.5 Guanidino group
Phenylglyoxal(PGO): The guanidino group of an Arg side chain has
critical role for the binding of the negatively charged substrate.
PG reacts with guanidino group of the Arg side chain under mild
conditions (Fig. 7.11). Takahashi (1968) invented the method,
Figure 7.11 Reaction scheme of PGO with a guanidino group of Arg residue.
Binding of one and two molecules of PGO is shown [13–15].
Search of Active Site 131
showed that the active site Arg residues in RNAase A are modified,
and that two moles of PGO react with one mole of Arg residue
[13]. However, several cases showed that one mole of PGO reacts
with one mole of Arg residue [14, 15]. Glyoxal, methylglyoxal, and
p-hydroxylphenylglyoxal also reacts with guanidino group.
(7.13)
(7.14)
A plot of ln(activity) vs. time gave a linear line as shown in Fig. 7.13a
(Eq. 7.19), supporting that the inactivation follows the first-
order reaction. The plot of the first-order rate constant (kobs ) of
inactivation vs. [PGO] was linear, indicating that one PGO molecule
binds with one enzyme-unit (Fig. 7.13b). To confirm this conclusion,
log kobs vs. log [PGO] was plotted (Fig. 7.13c). From Eq. 7.18,
(a) (b)
(c)
Thus, the slope of the plot gives the number of PGO molecule
reacted with the enzyme-unit. Figure 7.13C shows a linear plot with
the slope of 1.03, confirming that one PGO molecule binds with one
enzyme-unit.
Search of Active Site 135
(a)
(b)
(a) (b)
(c)
interacts with FBP, resulting in the activation of LDH. The idea has
been supported by the 3D structure of the enzyme-FBP complex
(pdb: 3vph), showing that FBP is bound the amino acid residues
including H188 at the interface of two subunits.
Problems
1. Explain the difference between hydrogen atom, proton, and
hydride ion.
2. As for the TPP action, the importance of tautomerization of
the pyrimidine ring is mentioned. Explain tautomerization
(see Fig. 7.8c).
References
1. Fischer, J. D., Holliday, G. L., Rahman, S., Thornton, J. M., and Janet, M.
(2010). The Structures and physicochemical properties of organic
cofactors in biocatalysis. J. Mol. Biol., 403, 803–824.
138 Active Site Structure
Enzymes are involved in our lives in various ways and are essential
to maintain our body. Cellular components are kept in almost
constant concentrations, and pH of our body fluid and our body
temperature are also maintained at almost constant values. The
phenomena are called homeostasis. Enzymes maintain homeostasis,
since they catalyze and regulate reactions in cells. Enzyme activities
change various conditions: pH, temperature, ligand-binding, and
covalent modifications. The amount of enzyme also regulates the
reactions in cells. This chapter focuses on the control of enzymatic
activities by non-covalent ligand binding and the covalent
modification of enzyme.
k k
E + nS
1
ESn E + nP (8.1)
k 1
144 Control of Enzyme Activity
where V and K are the maximum rate of reaction and the
concentration of substrate at the half maximum rate, respectively.
Equation 8.2 is called the Hill equation, named after A. V. Hill
(1910), who introduced this equation to explain the sigmoidal
curve of oxygen-binding to hemoglobin [5]. From Eq. 8.2,
v [S]n
= n (8.3)
V –v K
v [S] n
=
V – vof K n [5]. An alternative
In Eq. 8.3, K was originally used in place
expression of Eq. 8.3 is
v
log = n log[S]– n log K (8.4)
V – v
(A) (B)
Figure 8.3 (A) Enzyme activity vs. [Substrate] curve observed with a
non-allosteric enzyme (a), and allosteric enzymes (b, c). In the
ATCase-catalyzed reaction, a plot of activity vs. [Asp] shows
curve b, and the same plot in the presence of CTP shows
curve c. (B) Hill plot.
The plot between log {v/(V – v)} vs. log [S] gives a linear line
(Hill plot, Fig. 8.3B). The slope of the plot gives “n,” which is called
Regulation by Non-Covalent Interaction 145
(a)
(b)
Figure 8.4 Two models for the binding of ligands to allosteric protein.
Tetrameric protein is modeled. S, ligand. In sequential
model, when a ligand binds to a subunit, model assumes
conformational changes of the subunit and the near-by
subunits. The conformational change of the near-by subunits
is represented by dots.
(a)
(b)
(a) (b)
Box 8.1
Catalytic Triad and Oxyanion Hole
Catalytic mechanism of serine protease is the same as that described
in Eq. 4.39 (Chapter 4). Formation of ES complex, which leads to a
tetrahedral reaction intermediate, and breakage of the peptide
bond to form a product and an acylated enzyme intermediate. The
acyl-enzyme intermediate is attacked by water to form another
tetrahedral intermediate, which is transformed to another product
and the original enzyme. During these reactions, the catalytic
triad is formed with Asp, His, and Ser residues, and oxyanion hole
formed with two main chain imino groups of S200 and G198
(dashed circles in the figure). Hydrogen bonding between D107
and H63 makes H63 imidazole more basic to abstract proton from
the hydroxymethyl group of S200. Thus, the negatively charged
oxygen atom of S200 attacks nucleophilically the carbonyl carbon
of peptide bond, leading to the formation of a tetrahedral intermediate
containing oxyanion. The oxyanion is stabilized by an oxyanion hole in
the enzyme-transition state (ET).
(8.6)
domains, A and B (Figs. 8.15 and 8.16). cAMP binds B domain first,
then A domain. This is because the binding-site of the A domain is
covered by the catalytic subunit (Fig. 8.16, upper part). Figure 8.16
shows the structural change of the R subunit by binding with
cAMP. The large conformational changes of the CRIa complex are
apparent by binding with cAMP. The notable changes are observed
in the helical linkage between A and B domains, and the distance
between Arg366 and Glu261. As for the former, the linkage is
almost linear in the CR complex, but bending in the R-(cAMP)2
complex. As for the latter, the side chains of these residues are
forming the ionic bond in the CR complex, but far apart in the
cAMP-bound R subunit. Moreover, the ionic bonds tether two
adenine-capping residues, Y371 and W260, in the apo-R subunit,
but by binding with cAMP the ionic bonds are broken, leading
these residues to cap the adenine ring of cAMP.
Figure 8.16 Mechanism of the PKA activation. The CaRIa dimeric complex
(pdb code: 2qcs) receives two molecules of cAMP, and
dissociated into the Ca and RIa · cAMP2 (pdb code: 1rgs).
Helical linker (HL) is linking two domains, and colored orange,
A domain, magenta, and B domain, pale blue, cAMP, green.
Pseudo-substrate motif (PSM) is colored gray cube.
RIa GRRRRGAISAE
RIb ARRRRGGVSAE
RIIa RFVRRVSVCAE
RIIb RFTRRASVCAE
The amino acid residue of the site in RII isoforms is Ser, but Ala
or Gly in RI isoforms. In the RC complex, the pseudo-phosphorylation
site occupies the active site of the C subunit like the trypsin-trypsin
inhibitor complex (Figs. 8.9 and 8.16), leading to the strong binding
of a C subunit with an R subunit.
(a)
(b)
Figure 8.18 Crystal structure of the catalytic subunit of PKA. (a) Apoform
(open form. pdb code: 1j3h). (b) Inhibitor peptide (IP)-bound
form (closed form. pdb code:3fjq). In the C-tail, the residues
from 319 to 328 is missing in the open form (a), but clearly
seen in the closed form (b). The inhibitory peptide (IP) is
shown in orange cartoon, and the RRNAI sequence in red sticks.
The phosphorylated T197 and S338, F318, and D329 are blue
spheres, and ATP green sticks. F327 and Y330, red sticks; N-
tail, green; N-lobe, magenta; C-lobe, cyan; C-tail, red.
The C-tail wraps around both lobes, and the residues from
319 to 328 must be movable, since these residues are not observed
by the X ray crystallography in the apo C subunit (Fig. 8.18a). On
the other hand, by binding with ligands, ATP and inhibitory peptide
(IP in Fig. 8.18b), these residues become structurally visible, and
F327 and Y330 in the region trap ATP cofactor. The N-tail contains
helical structure (aA), which interacts with the PKA interacting
protein 1(AKIP1) in the nucleus. The C subunit contains two
Regulation by Covalent Modification 161
Figure 8.19 Amino acid sequences of substrates and its analog for PKA. The
sequences of SP20 and IP (inhibitor peptide) are numbered
according to the sequence number of the inhibitor for PKA.
Box 8.2
Initial Burst and Active Site Titration
In the enzymatic reaction to form two products, when one product
(P1) is rapidly formed, followed by a slow formation of the second
product (P2), the rapid formation of P1 is called “initial burst.” The
phenomena had been observed for the protease-catalyzed hydrolysis
of esters.
k+2 s
= k+3 + (B8.5)
(K + s )
where e0, s, K, and Km represent the initial concentration of enzyme,
the concentration of substrate, the dissociation constant of the ES
complex, and Michaelis constant, respectively, and s » e0. The intercept
__
on the ordinate of the plot of 1/√p vs. 1/s gives e0 when k+2 » k+3. The
value obtained is the active site concentration of enzyme, leading to
the good method for the determination of the concentration of active
enzyme.
Regulation by Covalent Modification 163
The kinetic behavior like this has been known as “Initial Burst”
in protease-catalyzed ester hydrolysis and in myosin ATPase
reaction [21, 22]. Thus, the phosphoryl transfer reaction of
PKA can be explained similarly. The C-subunit-ATP complex
forms the Michaelis complex with Kemptide (S), which rapidly
changes to the C-subunit-ADP-P complex. The C subunit-ADP-P
complex releases ADP and P to reform the C-subunit. According
to Grant and Adams, the rate of the phosphoryl transfer is 500 s–1,
and that of the release of products is 21 s–1,
–1 –1
500 s 21s
C ATP + S C ATPS
C ADPP C + ADP + P (8.5)
the binding to the Mg1 site is weak. From the structural and kinetic
studies, a catalytic cycle of PKA is proposed (Fig. 8.21) [23]. Release
of Mg ion from the Mg1 site is prerequisite for the release of ADP-
Mg. A catalytic cycle similar to that presented Fig. 8.21 has been
proposed for cyclin-dependent kinase [24].
(a)
(b)
Figure 8.23 Stereo views of the active site of the C-subunit of PKA. (a) The
crystal structure of the C-subunit in complex with AMP-PNP
(thin stick), AMP-PN (thick stick), Mg, and SP20 (pdb: 4hpu).
(b) The transition state mimic of the C-subunit in complex with
ADP, AlF3, and SP20 (pdb: 1l3r).
References 167
Problems
1. Demonstrate that K is the substrate concentration at the
half-maximum rate in the Hill equation.
2. Figure 8.21 shows the catalytic cycle of C-subunit-catalyzed
protein kinase reaction. Two magnesium ions bind and
release from the enzyme. Based on the mechanism, draw the
scheme by the Cleland-type expression, including magnesium
ions, though magnesium ions are neither substrate nor
product.
3. From the scheme in Eq. B8.1 in Box 8.2, derive Eq. B8.2 by
assuming rapid equilibrium (see Chapter 2).
__
4. In the Box 8.2, how does a plot between 1/√p and 1/s lead
to give the active concentration of enzyme?
References
4. del Vale, P., de Arriaga, D., Busto, F., and Soler, J. (1986). A study of the
allosteric kinetics of Phycomyces pyruvate kinase as judged by the
effect of l-alanine and fructose 1,6-bisphosphate. Biochim. Biophys.
Acta., 874, 193–204.
5. Hill, A. V. (1910). The possible effects of the aggregation of molecules
of hemoglobin on its dissociation curves. J. Physiol., 40, 4–7.
6. Allosteric interactions and biological regulation (part I and II) (2013).
J. Mol. Biol., 425, 1391–1592, and pp. 2277–2392, edited by Kalodimos,
C., and Edelstein, S. (reviews).
7. Koshland D. E. Jr., Némethy, G., and Filmer, D. (1966). Comparison
of experimental binding data and theoretical models in proteins
containing subunits. Biochemistry, 5, 365–385.
8. Cornish-Bowden, A., and Cárdenas, M. L. (1987). Co-operativity in
monomeric enzymes. J. Theor. Biol., 124, 1–23 (review).
9. Denisov, I. G. and Sligar, S. G. (2012). A novel type of allosteric
regulation: Functional cooperativity in monomeric proteins. Arch.
Biochem. Biophys., 519, 91–102.
10. Jurica, M. S., Mesecar, A., Heath, P. J., Shi, W., Nowak, T., and Stoddard, B.
L. (1998). The allosteric regulation of pyruvate kinase by fructose-1,6-
bisphosphate. Structure, 6, 195–210.
11. Mattevi, A., Valentini, G., Rizzi, M., Speranza, M. L., Bolognesi, M.,
and Alessandro Coda, A. (1995). Crystal structure of Escherichia coli
pyruvate kinase type I: Molecular basis of the allosteric transition.
Structure, 3, 729–741.
12. Pettersen, E. F., Goddard, T. D., Huang, C. C., Couch, G. S., Greenblatt,
D. M., Meng, E. C., Ferrin, T. E. (2004). UCSF Chimera: A visualization
system for exploratory research and analysis. J. Comput. Chem., 25,
1605–1612.
13. Walsh, K. A., and Wilcox, P. E. (1970). Serine proteases. In Methods in
Enzymology (ed. Colowick, S. P., and Kaplan, N. O.) 19, 31–63 (review).
14. Stroud, R. M., Kossiakoff, A. A., and Chambers, J. L. (1977). Mechanism of
zymogen activation. Ann. Rev. Biophys. Bioeng., 6, 177–193 (review).
15. Taylor, S. S., Ilouz, R., Zhang, P., and Kornev, A. P. (2012). Assembly of
allosteric macromolecular switches: Lessons from PKA. Nat. Rev. Mol.
Cell Biol., 13, 640–658 (review).
16. Ubersax, J. A., and Ferrell, J. E. (2007). Mechanism of specificity in
protein phosphorylation. Nat. Rev. Mol. Cell Biol., 8, 530–541.
17. De Vries, L., Zheng, B., Fischer, T. Elenko, E., and Farquhar M. G. (2000).
The regulator of G protein signaling family. Annu. Rev. Pharmacol.
Toxicol., 40, 235–271 (review).
References 169
Preparation of Enzyme
9.2.1.1 Salting-out
Most proteins are soluble in water under low ionic strength,
but insoluble at high ionic strength. This precipitation is called
salting out. Its principle is briefly as follows. Proteins in water
Purification of Enzyme 173
20 29 59 78 91 123 155 189 225 262 300 340 382 424 520 619
25 30 49 61 93 125 158 193 230 267 307 348 390 485 583
30 19 30 62 94 127 162 198 235 273 314 356 449 546
33 12 43 74 107 142 177 214 252 292 333 426 522
35 31 63 94 129 164 200 238 278 319 411 506
% saturation
Thus, the DEAE group is positively charged (pKa 11.5) under neutral
conditions and binds with the negatively charged ion in the buffer
such as Cl–. When proteins are applied on the top of the column, Cl¯
exchanges with the negatively charged portion of the proteins. The
strength of the binding depends on the negative charges of proteins;
thus, the column can separate proteins.
Cation exchangers: A carboxymethyl (CM) group is a cation
exchanger. Hydroxyl group of carbohydrate-based supports forms a
linkage with CM group,
Solid support–O–CH2COO–
Thus, CM group is negatively charged (pKa 4.7) under neutral
conditions, and interacts with positively charged proteins.
side, the extract obtained from the expressed cells are applied onto
the affinity column that specifically binds with the tag, but the
other proteins in the extracts cannot bind with the column; thus,
we can purify the enzyme of interest. For the purification of the
recombinant enzymes, immobilized metal affinity chromatography
is commonly used [5]. The column uses the fact that transition
metal ions such as Zn2+, Cu2+, Ni2+, and Co2+ bind to His and Cys in
aqueous solutions. Ni2+ ion binds to the iminodiacetic acid bound
covalently with the polysaccharide-based beads such as agarose
or dextran (Fig. 9.3). When the 6His-tagged recombinant enzyme is
applied onto the column, the enzyme binds the column specifically,
but other proteins without 6His tag do not bind with the column.
After washing the column with buffer, the enzyme is eluted by
buffer containing imidazole, leading to one-step purification of
enzymes (proteins).
9.3.1 Electrophoresis
Electrophoresis is the motion of charged particles under the
electric field. The positively charged particles moves toward the
cathode, and the negatively charged particles to the anode. Proteins
(enzymes) are composed of amino acid residues, so different
proteins are charged differently. Using the properties, various types
of electrophoresis apparatus are invented. Figure 9.4 shows an
example of slab gel electrophoresis apparatus.
(a) (b)
Problems
1. A DEAE-cellulose equilibrated with a buffer (pH 7.0) was
packed in a glass column. A solution containing bovine
serum albumin (pI = 4.7), human hemoglobin (pI 6.5), and
bovine cytochrome c (pI = 10) in the buffer (pH 7.0) was
applied on the top of the column. Then, the column was washed
with the same buffer. A protein is eluted from the column.
After complete elution of the protein, the column was washed
step-wise with the buffer containing increasing concentrations
of NaCl. Answer the order of the elution of these three
proteins.
2. In question 1, the concentration of NaCl was increased to wash
the column. Why?
References 183
References
10.1 Introduction
l-Phe oxidase (deaminating and decarboxylating) was purified
from Pseudomonas sp. P-501 by H. Koyama of Noda Institute for
Scientific Research (Japan) in 1983 [1]. Dr. Koyama and we started
to collaborate on the kinetic study of the enzyme. We have studied
on the enzyme kinetically and structurally since then. So it is worth
to look back at the works here.
MW 140,000
Subunit composition single
Subunit MW 68,000
Isoelectric point 4.8
FAD content 2
Optimum pH 6~9
Heat stability ~70°C
β-2-thienylalanine
(b) [O2] mM [O2], mM
(a) 0.53 (c) (d)
0.008 0.008 0.18
1.13
0.004 0.004
0.025 0.025
1.02
[ßTA] ĺ
[O2] ĺ [Met] ĺ [O2] ĺ
0 0
0 1 2 0 10 20 0 0
0 2 5 0 2 2 3
1/[O2], mM-1 1 [ßTA], mM-1 1/[O2], mM-1
1/[Met], mM-1
Figure 10.1 shows the results obtained with βTA and Met [5]. The
data clearly show a typical Ping-Pong Bi–Bi mechanism as described
in Chapter 3:
1 k
k2 slow
Eox +S E S Ered Im Ered + P1 (10.3)
k ox –1
k3 k
Ered ImO2
Ered Im+O2 (+H2O)
4
Eox + P1 + H2O2 + NH+4
k–3
(10.4)
3 k
k4
Ered Im+O2 Ered ImO2
Eox +P2 +CO2 +H2O (10.5)
k–3
k
1 k2 1 slowk2 k slow
Eox +S E ES
where and
+S Ek red
Im
represent
Eox
S EE
the +PIm
oxidized
1 and Ereduced
red + P1 forms of
k–1 ox ox
–1
red
red
the enzyme-bound FAD cofactor, respectively. Im represents the
imino acid corresponding to the amino acid substrate. Equation
10.4 composes the oxidative deamination reaction (Met), and
Eq. 10.5 the oxygenative decarboxylation reaction (Phe, Tyr, βTA).
k1 k2 slow
EThe
ox +S imino
acid
E Sin the Ered·Im
Im Ered + Pwas
intermediate identified by a
k–1 ox 1
resonance Raman study of the purple intermediate formed with Phe
[6]. The substrate used follows either Eq. 10.4 or 10.5, therefore,
rate constants were assumed to be identical in each steps in
Eqs. 10.4 and 10.5 for simplicity. From the mechanism, the rate
of overall reaction (v) can be expressed as
e0 e Ks e KO 2
= 0 1 + m + 0 m (10.6)
v V [S] V [O2 ]
190 A Case Study
V kk k4 (k–1 + k2 ) k (k + k )
s
= 2 4 = kcat , K m = , K mO2 = 2 –3 4
e0 k2 + k4 k1 (k2 + k4 ) k3 (k2 + k4 )
where e0 represents the total concentration of enzyme. The
enzyme concentration is expressed as that of the FAD content. V
represents the maximum rate at a given concentration of enzyme
and at the infinite concentrations of both substrate and oxygen,
k (k + kk2 2)(k–3 + k4 )
and K ms =and4 K–1mO2 =the ,
concentration of substrate and oxygen to give
k (k2 + k4k)3 (k2 + k4 )
the rate of1 V/2e 0, respectively. The kinetic parameters obtained
are shown in Table 10.2. The parameters show that though the
k2 (k–3 + k4 )
kcat values of PAO are very high, K mO2 = is very large as compared with
k ( k + k ) k3 (k2 + k4 )
K ms . =This
4 –1 ,
fact 2explains the relatively low activity under standard
k1 (k2 + k4 )
conditions (25°C and 1 atm), where the oxygen concentration is
0.25 mM.
was complete during the dead time of the stopped flow apparatus
(2.3 ms) under anaerobic conditions. Therefore Met was used as
substrate for the stopped flow studies, since kcat value of Met is
lower than that of Phe (Table 10.2).
0.3 0.06
A B
a a
Absorbance
0.2 0.04
0.1 b 0.02
b
0 0
340 430 520 610 700 340 430 520 610 700
Wavelength, nm Wavelength, nm
Figure 10.2 The spectral change of the oxidized form of enzyme (Eox, a)
to the purple intermediate (Ered·Im, b) by the addition of
13 mM Phe (A) and 8 mM Met (B) under aerobic conditions.
PAO concentration was 20 μM (A) and 4.4 μM (B). As Kom 2 is
high, it is practically anaerobic with sufficient concentrations
of the amino acid. Reproduced from Ohta et al. [7].
k2
kobs =
K (10.8)
1+ s
[S]
(a) (b)
where kH/kT and kD/kT are the H/T and D/T kinetic isotope effects,
respectively. Here, subscript obs and cal represent observed and
194 A Case Study
–Ea (10.11)
lnk = + ln A
RT
In Fig. 10.4 [9, 14], the region I follows the Arrhenius rate law,
showing large DH≠, and AH/AD ≈ 1. Here A is an Arrhenius pre-
exponential factor. In the region II, inflated value of kinetic isotope
effect and AH/AD < 1 will be given, and the behavior reflects a greater
tunneling. In the region III, extensive tunneling occurs, but AH/AD
is hard to predict. In the region IV, nearly activationless tunneling
and KIE ≈ AH/AD.
(a) (b)
Figure 10.4 A general diagram of the rate (k) of hydrogen transfer reaction
with temperature. The region I, classical behavior of the over
the barrier, the regions II and III, quantum tunneling, and the
region IV, ground-state quantum tunneling. For Arrhenius plot,
read the ordinate in (b) as ln k [14] (See text). Reproduced
with permission from Scrutton, N. S., Basran, J., and Sutcliffe,
M. J. (1999). New insights into enzyme catalysis. Ground
state tunneling driven by protein dynamics. Eur. J. Biochem.,
264, 666–671, copyright (1999) John Wiley & Sons. (b)
Adapted with permission from Jonsson, T., Glickman, M. H.,
Sun, S., and Klinman, J. P. (1996) Experimental evidence for
extensive tunneling of hydrogen in the lipoxygenase reaction:
Implications for enzyme catalysis. J. Am. Chem. Soc., 118,
10319–10320, copyright (1996), American Chemical Society.
divide both sides by T, then logarithm of both sides gives the Eyring
plot:
k T DS DH
ln(k f /T )= ln B + – (10.13)
h R RT
(a)
(b)
(c)
Figure 10.6 Amino acid sequences of proPAO (a), PAOpt (b), and the
native PAO (c). Though proPAO is a homodimeric protein,
only monomer is shown. Only partial sequences are shown.
Numbers above the sequence represent the residue number
according to the prosequence. The cleavage positions shown
by arrow heads are different between recombinant PAOpt and
the native enzyme. The LEH6 sequence of proPAO represents
the histidine tag added in the construction of the expression
plasmid in E. coli.
(a) (b)
Figure 10.7 Overall structure of PAO. A view of proPAO (a) and PAOpt
monomers (b). The prosequence, FAD-binding domain,
and substrate-binding domain are colored, magenta, blue,
and orange (proPAO) or cyan (PAOpt), respectively. (a) and
(b) are shown in the same orientation. This research was
originally published in Journal of Biological Chemistry. Ida, K.,
Kurabayashi, M., Suguro, M., Hiruma, Y., Hikima, T., Yamamoto,
M., and Suzuki, H. Structural basis of proteolytic activation of
l-phenylalanine oxidase from Pseudomonas sp. P-501. Journal of
Biological Chemistry. 2008. 283:16584–16590. © the American
Society for Biochemistry and Molecular Biology [16].
(a) (b)
with respect to the side chains of the amino acids, while roLAO is
non-specific [16, 17].
Figure 10.11 Crystal of PAOpt. (a) The oxidized form. (b) The crystal
of the oxidized form (a) was soaked in the crystallization
buffer containing Phe. Thus, the crystal changed to purple.
Reproduced from Ida et al. [17].
(a)
(b)
Figure 10.12 Stereo view of the active site of PAO. (a), the PAO-Phe
complex (black) superimposed to that of roLAO (white). (b),
the PAO-Phe complex (black) superimposed to that of the
PAO-Met complex (white). The cage residues of PAO are
W660 and F617, and those of LAO are W467ro and W426ro.
Reproduced from Ida et al. [17].
202 A Case Study
Figure 10.13 Subunit of a and b chains of PAOpt (PAO: green) was matched
with that of human monoamine oxidase B (MAO: magenta).
FAD, cubic. The main chains are shown. PAO, pdb 3ayj; MAO,
pdb 1gos.
Problems
1. In the reaction scheme of Eqs. 10.4 and 10.5, write down the
molecular structures of the products P1 and P2 when Phe is
used as substrate.
2. Using a steady state assumption, derive Eq. 10.6.
3. In Section 10.3.4.1, using the difference in the zero point
energy (4.8 kJ/mol) between the C–H and C–D bonds, the
primary KIE is calculated to be ~7. Confirm this calculation.
4. Section 10.3.4.1 describes that the kinetic isotope effect
(kH/kD) is equal to the pre-exponential factor ratio (AH/AD)
under the region IV. Prove this.
References
1. Koyama, H. (1982). Purification and characterization of a novel
l-phenylalanine oxidase (deaminating and decarboxylating) from
Pseudomonas sp. P-501. J. Biochem., 92, 1235–1240.
2. Koyama, H. (1983). Further characterization of a novel l-phenylalanine
oxidase (deaminating and decarboxylating) from Pseudomonas sp.
P-501. J. Biochem., 93, 1313–1319.
3. Koyama, H. (1984). Oxidation and oxygenation of l-amino acids cata-
lyzed by a l-phenylalanine oxidase (deaminating and decarboxylating)
from Pseudomonas sp. P-501. J. Biochem., 96, 421–427.
4. Mukouyama, E. B., Suzuki, H., and Koyama, H. (1994). New subunit
in l-phenylalanine oxidase from Pseudomonas sp. P-501. Arch.
Biochem. Biophys., 308, 400–406.
5. Koyama, H., and Suzuki, H. (1986). Spectral and Kinetic studies
on Pseudomonas l-phenylalanine oxidase (deaminating and
decarboxylating). J. Biochem., 100, 859–866.
6. Suzuki, H., Koyama, H., Nishina, Y., Sato, K., and Shiga, K. (1991). A
resonance Raman study on a reaction intermediate of Pseudomonas l-
phenylalanine oxidase (deaminating and decarboxylating). J. Biochem.,
110, 169–172.
7. Ohta, Y., Mukouyama, E. B., and Suzuki, H. (2006). Kinetic isotope
effect of the l-phenylalanine oxidase from Pseudomonas sp. P-501.
J. Biochem., 139, 551–555.
206 A Case Study
k k k
+1
E + S
+2
ES
+3
EP
E+P (A.1)
k k
–1
–2
k –3
Draw the polygon having one enzyme species on each top (basic
pattern). Therefore, at least three enzyme species are required for
this mechanism.
%DVLF3DWWHUQ &DOFXODWLRQ3DWWHUQ
(6
(6 (6 (6
N>6@ N N
N
N>3@
( (3 ( (3 ( (3 ( (3
N
(1) Write an arrow on each side and the rate constant for the
respective reaction near the arrow. When a ligand is involved
in the reaction, write the rate constant multiplied with the
concentration of the ligand.
(2) Write all possible polygons without one side as above
(calculation pattern).
208 Appendix
Similarly,
References
Answers have been given for important and hard problems. Readers
are strongly recommended to solve problems independently and
then read the answer.
Chapter 2
1. Figure 2.2 is a plot v/V vs. log s. Therefore, Eq. 2.16 must be
changed to a function of log s:
10x
v/V =
10x + K s
d(v/V ) d 10x
= x
dx dx 10 + K s
d(v/V ) 2.303Ks s
=
d(log s ) ( s + K s )2
Chapter 3
2. Apply the steady state for [ES1-EP1], [F], and [FS2-FP2],
respectively, and derive the rate (v) of the enzymatic reaction
using
212 Solutions
Chapter 4
1. Differentiation of Eq. 4.7 leads to
dV –V H 2 – K 1K 2
=
dH (1+ H K1 + K 2 H )2 H 2K 1
V 1+2 K 2 K1
=
Vop (1+ H K1 + K 2 H )
From this equation, H1 and H2 are calculated by introducing
V/Vop = 1/2; then
H 2 –(4 K 1K 2 + K 1 )H + K 1K 2 = 0
Assuming that a solution to the equation is H1 and H2,
(H – H1)(H – H2) = 0
Then,
H1 + H2 = 4 K 1K 2 + K 1 = K 1 + 4Hop
Solutions 213
d(2.303log k )
DV = – RT
dp
d(log k )
= –2.303RT
dp
= –2.3030.0831103(ml bar K –1mol–1 )298(K)0.415× 10–3(bar–1 )
= –23.7ml
Chapter 5
Chapter 6
1. Let’s start with simple examples. One disulfide bond is
possible for two SH groups. For four groups, C(4,2)/2! (i.e.,
3) combinations of disulfide bond location is possible, where
C(a,b) = a!/(a–b)!b!. For six groups, C(6,2) x C(4,2)/3! (i.e.,
15) combinations. Thus, for eight SH groups, C(8,2) x C(6,2) x
C(4,2)/4! (i.e., 105) combinations. In the RNAase A, the native
enzyme has only one in 105 combinations. Consider how cells
select one combination?
2. The indole ring of Trp residue is stimulated by absorbing a
light energy to the activated state. Then the activated indole
releases an energy to return the initial low energy state.
Usually the energy is released as fluorescence. By binding with
214 Solutions
Chapter 7
Chapter 8
2. Magnesium ions are treated as substrate and product. Mg1,
Mg2, and Mg1,2 represent that Mg ions are binding at the
Mg1, Mg2 sites, and both sites, respectively. S and P represent
the substrate peptide and the phosphorylated product,
respectively. C represents the catalytic subunit of PKA.
Solutions 215
es (e0 – x – y )s k–1
= = = K (SM8.1)
x x k+1
Then,
s
x= (e – y ) (SM8.2)
K +s 0
From the scheme given,
dy
= k+2 x – k+3 y (SM8.3)
dt
Substituting Eq. SM8.2 into Eq. SM8.3,
dy s k se k s
= k+2 (e – y ) – k+3 y = +2 0 – +2 + k+3 y (SM8.4)
dt K + s 0 K + s K + s
k+2 se0
y= (1– e – lt ) (SM8.5)
l(K + s )
where,
k+2 s
l = k+3 +
(K + s )
By applying Eq. SM8.2, the rate of formation of P1 is
dp1 s
= k+2 x = k+2 (e – y ) (SM8.6)
dt K +s 0
Substituting Eq. SM8.5 into Eq. SM8.6, and the resulting
equation is integrated from time 0 to t,
216 Solutions
2
k+2k+3 s k2 e s
p1 = e0t + +22 0 (1– e – lt )
k kl K s+ s 2l K + s 2
k e s – lt
p1 = +2 +3 e t + +22 0 (1– e )
l K +s 0 l K + s
2
2 2
k k e s/(k+2 + k+3 ) k+2 s e (1– e – lt )
+2 +3 0 t + 2
k+3kK + k )
k+2ks+3+e0 s/( k+2k+ k+3 k+3Ks 0
+2 +3 +2 + s e (1– e – lt )
(k+2k +Kk+3 ) t + k + k (k+2k+3+Kk+3 ) 0
s+ +3 +2 +3
+s
(SM8.7)
(k+2 + k+3 ) (k+2 + k+3 )
where
2 2
k+2k+3e0 s/(k+2 + k+3 ) k+2 s (SM8.9)
v0 = ; = e0
s + Km k+2 + k+3 K m + s
k+3K .
Here, K m =
(k+2 + k+3 )
In the second equation of Eq. SM8.9, the reciprocal of square
root of both side,
1 k+3 K m 1
=1+ 1+
k+2 s e0
References
Chapter 9
1. The DEAE group is positively charged at pH 7.0. Therefore,
the negatively charged group is able to bind with the DEAE
group. The binding strength is dependent on the total charge
of proteins.
Proteins having lower pI than the pH of the buffer; thus,
bovine serum albumin and human hemoglobin have
negative charges at pH 7.0 and bind with the cellulose. The
binding is stronger with bovine serum albumin than human
hemoglobin. On the other hand, cytochrome c is positively
charged, then does not bind with the cellulose. Order is
cytochrome c, human hemoglobin, and bovine serum
albumin.
2. NaCl dissociates into Na+ and Cl¯. These ions neutralize the
charged portions of proteins; thus, interactions with the DEAE
cellulose decrease to dissociate proteins from the cellulose.
Chapter 10
2. The steady state concentrations of the enzyme species, Eox-S,
Ered-Im, Ered-Im-O2 are constant, and the total concentration
of enzyme is
e0 = [Eox ] + [Eox-S] + [Ered-Im] + [Ered-Im-O2]
v = d[P]/dt = k4[[Ered-Im-O2]
ln kH = –EaH/RT + ln AH (SM10.4)
ln kD = –EaD/RT + ln AD (SM10.5)
ln kH – ln kD = (–EaH + EaD)/RT + ln AH – ln AD
For a long time, enzymes have been studied by measuring their activity, which has
led to the advancement of “enzyme kinetics.” In recent years, the mechanism of
enzyme reaction has been explained in detail on the basis of the 3D structure. Genetic
engineering and the 3D structural analysis of enzymes contribute to these advancements
in enzymology. This book starts with an introduction to various enzymes to show how
interesting enzymes are, which is followed by historical kinetic studies on enzymes and
the overall and rapid-reaction kinetics. The subsequent topics describe the basics of
protein structure, the control of enzyme activity, and the purification of enzymes. A case
on the kinetic and structural studies of l-phenylalanine oxidase is also presented. There
are many good books on enzyme kinetics, but few describe their kinetic and structural
aspects. This book deals with both and contains many references that can be good
sources for further reading. It is handy and is especially helpful for beginners. A number
of figures, including some with stereo expression, facilitate observing the 3D structure
of enzymes.
V424
ISBN 978-981-4463-92-8