Tomorrow's

Artificial
Intelligence
A Futurist's Guide to
Understanding and Harnessing
AI Technology That Is Shaping
Our World

Kris Ball
Copyright © 2023 by Kris Ball

All rights reserved.

No portion of this book may be reproduced in any form without written permission from the
publisher or author, except as permitted by U.S. copyright law.

Under no circumstances will any blame or legal responsibility be held against the publisher,
or author, for any damages, reparation, or monetary loss due to the information contained
within this book, either directly or indirectly.

Legal Notice:

This book is copyright protected.  It is only for personal use.  You cannot amend, distribute,
sell, use, quote, or paraphrase any part of this book's content without the author's or pub-
lisher's consent.

Disclaimer Notice:

Please note that the information contained within this document is for educational and
entertainment purposes only.  All eRort has been executed to present accurate, up-to-date,
reliable, and complete information.  No warranties of any kind are declared or implied. 
eaders acknowledge that the author is not engaged in rendering legal, nancial, medical,
or professional advice.  The content within this book has been derived from various sources. 
Please consult a licensed professional before attempting any techniques outlined in this book.

By reading this document, the reader agrees that under no circumstances is the author re-
sponsible for any direct or indirect losses incurred as a result of the use of the information
contained within this document, including, but not limited to, errors, omissions, or inaccu-
racies.
 This book is dedicated to my uncle, Steven Ball, whose love of sci-r
was instilled in me ea.ly on I
z can .emembe. dogens of conve.sations about the futu.e and how the
science rction autho.s f.om lonM aMo we.e so .iMht o. so w.onM I pay z
one day be counted amonM them, makinM my own '.edictions of what
tomo..owFs technoloMy may b.inM to humanity I
o. bette. o. wo.se I
Introduction

In a world where machines reign supreme and human labor becomes

obsolete, the dawn of artikcial intelligence has sparved a wa.e of
apprehension T Nhe looming threat of lost li.elihoods and a global
taveo.er sends shi.ers down our spines, echoing our deepest fears T
Ae.ertheless, as the relentless march of yI continues, is doomsda?
trul? upon usS
Imagine a future where industries seamlessl? embrace the power of
yI, where excienc? reaches unprecedented heights, and tasvs once
performed b? human hands are now accomplished in a blinv of an
e?e T Nhe landscape of labor undergoes a profound transformation T
Rocial issues and natural disasters are mitigated to the point of being
noneHistent T Uather than a doomsda? as 'oll?wood might suggest,
the future in this bra.e new world is bright 
jndoubtedl?, yIOs recent and unprecedented growth has left man?
worried T Reeing this unrestrained progress is precisel? what instills in
us the fear that yI will tave o.er our Mobs and means of li.elihood T It is
reasonable to ha.e these fears, primaril? since man? of us ha.e fought
so hard to mave a li.ing after the pandemic T jnemplo?ment is still
a signikcant issue, and inWation has left man? struggling to balance
their knances T Nhen there is the issue of understaxng in companies
 NFCFUUFLOR yUNIEIGIy- IANB--IzBAGB .

where the eHisting emplo?ees are o.erworved in return for little eHtra
compensation 
Nhis struggle dri.es people awa? from embracing futuristic techq
nolog?, e.en if that technolog? could mave li.es easier 
ylthough yI has eHisted for decades, it was onl? in recent ?ears that
machine learning, and more recentl?, deep learning, became feasible T
Aow, yI is spreading live wildkre, and it is hard to veep up with the
progress 
Dut is it inherentl? as e.il as some deem it to beST Is yI something
we should a.oidST Is it a threat to us allS
It is the .er? idea of doomsda?, as we often see depicted in klms and
boovs, that maves us thinv the worst of yI T Lhether yI brings about
helpful change or unvnown chaos depends on how we utiliKe it T If
applied appropriatel?, it could open the door to man? possibilities T
It could mave Mobs safer and pro.ide opportunities for entirel? new
occupations 
y lot of the anHiet? comes from inade"uate information and a lacv
of education among the population T In simple words, we fear what
we donOt vnow T Nhe fear of the unvnown is often the most prominent
vind of fear, closing us o( to the brighter side of things 
Nrue, yI does ha.e its risvs T 'owe.er, much of the technolog?
alread? using this remarvable power has benekted people and made
Mobs easier and safer T It could potentiall? mave things a lot better,
maving it a risv worth taving T
)espite what an? single one of us thinvs, artikcial intelligence is
an ine.itable change T Nhe abilit? of small startup companies to mave
their own yI software is all around us T It is not Must the big companies
live zoogle, ymaKon, Cicrosoft, Ceta, and ypple that are in.esting
in yI T ynd itOs not Must in the jRy T Gountries live India and Ghina
.i :UIR Dy--

ha.e been worving on yI for ?ears T Ro, there is no stopping it T ItOs here
to sta? TT
Nhe vnowledge gleaned from this boov can pro.ide ?ou with newq
found conkdence and put ?our doubts to rest T Nhe information will
help ?ou mave vnowledgeable decisions T Nhis boov will also guide
?ou in determining what Mobs are safe and which ones might not be T
Lhat this boov is AFN is a comprehensi.e di.e into how yI
worvs T Lhile it is discussed brieW?, there are hundreds of other boovs
out there that co.er that topic in depth T It is also AFN a compreq
hensi.e list of all the hundreds and soon thousands of yI software,
apps, and plugins T Nhere is Must too much out there to list and co.er T
Instead, this boov is about how yI is being used now and what that
means for the future 
In the past, I worved in Glinical Informatics, teaching healthcare
professionals live nurses and doctors how to incorporate technolog?
live Blectronic 'ealth Uecords B'U and dictation applications into
their e.er?da? practice T In that Mob, I noticed a hesitanc? to embrace
technolog? T Nhis seemed counterqintuiti.e T yfter all, I was among
intelligent people in a keld where inno.ation and technolog? are paraq
mount T In order to do m? Mob, I had to dig deep into the cause of their
fears T Nhen I had to address those fears T Fnl? b? anticipating and
o.ercoming the t?pical barriers to change could I get those healthcare
professionals to adopt and e.en embrace the new technolog? TT
I see the same hesitanc? now with artikcial intelligence T ynd live
before, I want people to adopt and incorporate this technolog? into
e.er?da? use T In order to do that, I need to do what I did before
address the fears headqon T
yll the vnowledge I ha.e gained through inqdepth research is preq
sented in this boov for e.er?one to read in order to understand the
world of yI T Dased on current trends, news articles, social media posts,
 NFCFUUFLOR yUNIEIGIy- IANB--IzBAGB .ii

and statements from eHperts in the keld, I ha.e gathered a uni"ue

collection of information that helps paint a picture of what yI is doing
now and what it could potentiall? be in the future 
Ro thatOs what I hope this boov does T It empowers the reader with
vnowledge about this tool that we call artikcial intelligence T -ive an?
tool, it can be used for good, or it can be used as a weapon T Lhich
direction it goes depends on what we choose as a societ? T
Contents

Section 1 1

1. AI: Already Everywhere 3

2. New Generation AI—Breaking the Boundaries 7

3. Breakthroughs in Modern Day Healthcare 12

4. AI in the Military 21
5. AI's Impact in Coding 25

6. Writing with AI 28

7. AI Assistants 33

8. AI in Politics and the Economy 36

9. Neural Fields for LiDAR 40

Section 2 43

10. Avatars 44

11. AI Music 47

12. Art vs. AI 51

13. Script and Video Generation 56

14. The Future of AI in the Job Market 60

15. The COVID E-ect 65

16. AI's Impact in Di-erent Sectors 67

Section 3 72

17. Robotics 73

18. Preparing for the Future 76

19. Improved Search Engines 79

20. Education Overhaul 82

21. Cybernetics 86

22. DezAging with AI 89

23. Optimi&ed Logistics 91

24. Love and AI 94

25. Solving Health Concerns " Disparities 96

26. Wild res 102

27. Flooding 105

28. Addressing Other Societal Concerns 107

Section 4 110

29. The Darkside of ChatGPT 111

30. Culturally Inclusive AI Avatars " Bias 116

31. Cheating 119

32. Deepfakes 121

33. Voice Cloning 125

34. The Cost of Training AI 128

35. Sports Betting 131

36. Data Leaks " Privacy 133

37. The Danger of SelfzDriving Cars 136

38. The Prospect of Sentient AI 139

39. Singularity 142

40. Conclusion 146

Afterword 149

Comment on the Cover Art 150

Glossary 152

References 157
Section 1

AI is Here, Now
1

AI: Already
Everywhere

T he Inception of AI

Alan Turing is known as the “father of modern computer science,”

and for good reason.
During the Second World War, the Allies needed to crack Ger-
many's communication codes, also known as "Enigma."  Enter Alan
Turing, a brilliant pioneer, mathematician, and cryptanalyst who did
the impossible and cracked the code, which paved the way for modern
computing.
In 1935, Alan theorized a computing machine with a limitless
memory, consisting of a scanner moving back and forth, reading, and
studying symbols.  This is Turing's stored-program concept, where
the machine can learn, modify, and improve upon its own program. 
This is also known as the Turing Machine.  Today's computers are
based on this concept.  Turing often spoke of computers learning
4 KRIS BALL

from experience and solving new problems using guiding principles,

also known as heuristic problem-solving (Copeland, 2019).
Years later, Alan Turning came up with something called the "im-
itation game," which was a test of a machine's ability to be so hu-
man-like that it is perceived as human.  Today we refer to this game
as the Turing Test. 
Imagine in 1950 believing so much in the future of machine learn-
ing that you suspect one day a robot could pass for a human.  What
may have been science Pction in Alan Turing's day is becoming more
like reality today.
Everyday AI in Our Homes

Today AI can be found all around us.  qerhaps the most commonly
used modern examples of AI are "Digital Assistants," including Cor-
tana, Siri, Alexa, and Google Assistant.  These tech aides are computer
programs designed to 'listen' and respond to user commands.  This in-
cludes answers to Vuestions, sending emails, making calls, controlling
home appliances, etc.  They are activated by a speciPc phrase spoken
by the user, which is then analyzed, and results are provided.  Hoice
recognition has seen signiPcant development over the years, and there
has been tough competition between the digital assistants we know
and use.
Digital assistants are not restricted to smartphones, stand-alone
devices, and computers.  Smart home technologies such as smart THs,
speakers, and headphones often feature voice recognition.  Amazon
Echo and Google Fome are some of the most notable of these devices. 
Amazon also created the —ire Stick, a TH remote with Alexa's voice
capabilities.
All of these are designed to do the same thingOfollow commands
and perform tasksObut the constant change in Vuality and the ad-
 TNMNRRNW'S ARTI—ICIAL I–TELLIGE–CE 5

vancement of voice recognition continually progresses.  Aside from

the aforementioned popular AI assistants, other similar assistants ex-
ist, such as ELSA Speak, —yle, Found, and —irejies, to name a few.  It is
a tight race, but the competition works in the consumer's favor.  Each
company is constantly pushing the limits of what their tech can do
to surpass the others and take over a larger market share.  This theme
appears again and again with AI. 
When digital assistant technology popped up on the scene a few
years ago, many people were hesitant to use it.  They did not see its
need or usefulness.  Nr they found it too confusing.  –ow almost every
home in America has Siri, Google, or Alexa, even if it is only on our
smartphones.  Without realizing it, we have already stepped into the
AI universe 6 all of us.
It is fascinating to think that ust a few decades ago, many people
expected phones to do little else other than make calls and send texts. 
–ow, they are portable, e cient AI devices in the palm of our hands,
moving along with us in a fast-paced world.
Nf course, this does not come without implications and criticism. 
Nne of the ma or concerns surrounding the use of digital assistants is
privacy.  They record and analyze your voice, so it's not uncommon to
Vuestion where that data is stored and how it is used.
Another criticism is the impact these assistants have on society and
children.  More than ever before, kids today are super tech-savvy. 
They can use digital assistants in all sorts of creative ways parents have
yet to consider.  As a result, children do things di erently.  They do
not look up information like their mom and dad or grandparents did. 
They rely on technology like a crutch.  Many are also less social than
generations before.  While this is not exclusively the fault of advancing
technology, it is still a criticism of the trend toward using more and
more tech in our daily lives.  
KRIS BALL
2

New Generation
AI—Breaking the
Boundaries

D igital assistants are only the tip of the iceberg.  Many com-
panies have been embedding AI technology in products for
years.  Smart thermostats will adapt to your settings and anticipate
your needs.  Bank computers learn from your spending habits and
locations in order to Eag strange purchases.  Safety systems in cars
adapt to changes in driving and road conditions.  Tmail companies use
AI to learn which mail you consider spam and ,lter it for you.  Khe
technology behind AI has been slowly creeping up on usR and until
recentlyR we barely noticed or cared. 
Khen the long AI winter endedR and chatbots emergedR forever
changing technology. 

Rise of ChatGPT and Chatbots

“ L8IS BAOO

A wave of generator AIR also known as chatbotsR has recently taken the
world by storm.  According to —racleR a chatbot is ”a computer pro-
gram that simulates human conversationCwritten or spokenCand
allows humans to interact with digital devices as if they were commu-
nicating with a real person.(  Nhatbots use a combination of arti,cial
intelligence and natural language processing P)OG2 to understand
conversations and provide relevant responses.
Tnter Nhat0GKR an ambitious piece of arti,cial intelligence de-
signed by —penAI.  8eleased in late U1UUR it has already surpassed the
record number of users that KikKok achieved in a short time.  qBS
Analytics conducted a study and found that Nhat0GK had gained
over "11 million users within two months of its launch.  Khat is a
remarkable number.
It is spooky how good this tech is.  Nhat0GK poses like a human
when it answers 3uestions.  —nceR when asked if it was an appR it
denied that and claimed itself as a j0GK-W language model.j  It is
a surprisingly competent tool capable of generating tweetsR writing
poetryR ZokesR songsR and even translating languages.  Nhat0GK has
been ,ne-tuned and backed up by supervised and reinforced learning
techni3ues thatR in turnR generate impressive content.
Hith these vast capabilitiesR using it for cheating and plagiarism
has emergedR especially in schools and workplaces.  Nhat0GK and
other chatbots like it have sometimes been known to put out o'ensive
words and biased opinions and generate misleading information.  In
an article by the )F 9eraldR early on in Nhat0GK4s riseR two students
from Nambridge and Gukekohe 9igh Schools were accused of cheat-
ing using Nhat0GKR although the students deny the allegations.  In
another instanceR a college professor threatened to fail his entire class
for cheating using Nhat0GK.
 K—M—88—H4S A8KIxINIAO I)KTOOI0T)NT ?

Khe trend is Zust getting worse.  In an article by the Daily MailR a

poll found that half of college and high school students already use
AI for cheating.  MoreoverR in a survey done by study.com of U1W
L-"U teachersR it was found that " in ’ teachers had caught a student
cheating using Nhat0GK.
It is because of this that the app is banned in many schools.  Italy
became the ,rst country to ban Nhat0GK outright due to concerns
about privacy and misleading information.  TventuallyR they over-
turned their banR but the point was made.  Despite all thisR certain
schools welcome it.  Khese schools feel that embracing new technology
and moving forward with the world is better.
Grogrammers have used Nhat0GK to solve complez coding prob-
lems and found that the AI has advanced capabilities to write code
or ,z bugs.  Khe chatbot has also passed academic ezams with Eying
colors.  It is safe to say that generative AI could be an essential resource
in various ,eldsR and at the momentR it is only scratching the surface.
Natural Language Processing—What Is It?
Nhatbots like Nhat0GK use something called )atural Oanguage
Grocessing P)OG2.  But what is itY  As promisedR I won:t dive too deep
into the technical.  In a nutshellR )OG is an area of computer scienceR
speci,cally AIR that ezplores how computers can understand written
and spoken tezt and manipulate it the way a human can.
)OG uses a combination of rule-based human language modeling
and statisticalR machineR and deep learning models.  Khese help com-
puters process and understand written and spoken human language
PIBMR U1UW2.
)OG drives tezt translation programsR responds to spoken com-
mandsR and 3uickly summari…es large volumes of tezt in real time. 
)OG begins by breaking down the tezt into smaller units to processR
known as tokeni…ation.  Khat is followed by sentence-level struc-
"1 L8IS BAOO

tureCunderstanding the order of wordsR grammarR and sentence

meaning.  After thatR the )OG moves on to analy…e contezt.  A single
word can have di'erent meanings in di'erent contezts.  After thisR an
algorithm is created to process the data.
ou may have seen the term 0GK in earlier sections of this book. 
0GKR or ”0enerative Gre-Krained KransformerR( is the latest iteration
in )OG systems.
0GK is a learning model designed by —pen AI that can perform
what is called jfew-shotRj jone-shotRj or j…ero-shotj learningR which
means it needs only a few ezamplesR or …ero ezamplesR in order to learn
complez tasks.  It can learn new things from a small amount of data. 
It can be ,ne-tuned using instructions. 
I like to think of it as the most impressive version of the social media
game Oet predictive tezt ,nish this sentence   It can be something
simple likeR jI love to eat j and the player is supposed to tap the
middle word that their smartphone predicts the nezt word should be. 
Tveryone gets di'erent answers because the words they use most are
di'erent.  My phone generated this when promptedR jI love to eat
lunch and drink co'ee.  OolR you know I can do that with my cat.j 
It almost makes sense.  Nhat0GK goes a step further by sometimes
selecting a word that is )—K the most common.  Oike picking the
word option to the right or the left instead of the middle.  Its ability
to sometimes select a better word to make more sense is what makes it
so ama…ing.  —ften referred to as the temperature, the randomi…ation
of selecting a less fre3uent word helps to make the chatbot seem more
human. 
Hhile —penAI4s Nhat0GK is the most used and most famous ar-
ti,cial intelligence right nowR there are several other big players in the
)OG ,eld.  9oweverR they all work in a similar fashion.
 K—M—88—H4S A8KIxINIAO I)KTOOI0T)NT ""

Khis is where people need to remember what AI actually is.  It is not

humanR no matter how life-like its responses are.  It does not feel or
care.  It does not want.  It is simply a toolCcode and mathR statistics
and probabilitiesR ones and …eros.
3

Breakthroughs
in Modern Day
Healthcare

S o now that we know what AI is… Let us explore how it is chang-

ing the world.
AI has been the catalyst for signivcant breakthroughs in ,arious
veldsm including healthcarem software engineeringm the econo ym and
the  ilitary.T Bhe technology has helped sol,e proble s that ha,e been
asked for years.T It has also helped gain a strategic ad,antage in di"erent
velds.

Healthcare

Eacteria  utate and e,ol,e in order to be resistant to antibiotics.T

Bhese are known as OsuperbugsO or Osuperger s.OT Bwo of these
high-risk pathogens are Mnterobacteriaceae and Acinetobacter bau-
 anniim against which ,arious antibiotics ha,e been tested to see if they
 BRWR''RFCS A'BINIGIAL I1BMLLI3M1GM —D

can destroy the bacteria.T So farm  any antibiotics ha,e not been strong
enough to vght these superbugs (until now.
According to the Genters for 2isease Gontrol 0G2Gm 9)—85m su-
perbugs infect nearly 9.P  illion people nationwide and kill Dqm))).
Jresent-day techni’ues to screen antibiotics re’uire signivcant in-
,est ent and take up ,aluable ti e.T Rne of the signivcant issues
surrounding superbugs is that  ore ,ariants keep co ingm and there
are not enough antibiotics to battle the  in the current biotech and
phar aceutical industries.
Bhat is where artivcial intelligence co es in.T It cuts down on the
ti e it takes to screen for antibiotics.
Halicin
za es Gollinsm a professor of Wedical Mngineering and Science at
WIB6s Institute for Wedical Mngineering and Science and 2epart ent
of Eiological Mngineeringm along with other researchersm for ed an AI
co puter  odel that analyHes  olecular structures to vnd out what
 akes the  e"ecti,e in killing M. coli.T Bo train the AIm they used data
on 9mq))  olecules and co pounds 0Braftonm 9)9)5.
Fhen they tested the  odelm it picked out a  olecule after analyH-
ing o,er 4m))) co pounds.T Bhis  olecule had a strong antibacterial
’ualitym and its che ical structure di"ered fro  the existing antibi-
otics.
Bhis  olecule was na ed Kalicinm inspired by the fa ous vctional
AI fro  2001: A Space Odyssey.T Kalicin was tested against ,arious
bacterial strains that were culti,ated in a lab.T It destroyed  any of the
superbug strainsm including Acinetobacter bau annii.T It was able to
eradicate the bacteria in infected  ice within 97 hours.
WIBCs co puter  odel can screen o,er a hundred  illion che ical
co pounds and select antibiotics capable of killing bacteria  ore
e"ecti,ely than existing drugs.T Bhe researchers at WIB ai  to utiliHe
—7 j'IS EALL

the power of AI in order to disco,er  ore re,olutionary drugs that

could sa,e li,es.
Bhe incredible disco,ery does not end there.T Bhe research tea 
went for a —.q billion-co pound library and trained the  odel on —)”
 illion co pounds.T It took Vust three days for the algorith  to dis-
co,er 9D di"erent potential antibioticsm of which two are particularly
e"ecti,e.
Abaucin
Like Kalicinm Abaucin was created by another co pany using AI to
kill the superbug Acinetobacter baumannii.
According to EEG 1ewsm OAI helped narrow thousands of po-
tential che icals to a handful that could be tested in the laboratory.T
Bhe result was a potentm experi ental antibiotic called abaucin.OT After
training the AI to look at the che ical structure of thousands of
drugsm they were tested on the superbug.T Specivcallym OBhe AI was
then unleashed on a list of 4m4P) co pounds whose e"ecti,eness was
unknown.T Bhe results showed the AI took an hour and a half to pro-
duce a shortlist.OT Bhe researchers tested co pounds fro  the shortlist
and de,ised an e,en s aller list of potential antibiotics.T ORne of the 
was the incredibly potent antibiotic abaucin.T Laboratory experi ents
showed it could treat infected wounds in  ice and kill A. baumannii
sa ples fro  patients% 03allagherm 9)9D5.
Kalicin and Abaucin are only the beginning of a new AI-led  ed-
ical era.T I agine a world where all kinds of deadly bacteria are erad-
icated with few side e"ects.T Fith AI-dri,en technology and drug
designm sepsis could potentially be eli inated and no longer pro,e
fatal.
Wodern-day antibiotics tend to kill the good bacteria in hu an
bodies along with the har ful bacteria.T 'esearchers want to disco,er
 BRWR''RFCS A'BINIGIAL I1BMLLI3M1GM —q

 ore antibiotics through AI that specivcally kill har ful bacteria and

lea,e the good ones intact.
And itCs not Vust bacteria.T ?iral diseasesm which lack an actual
curem could also be eradicated with the help of co pounds de,eloped
with the help of AI.T Bhis could  ean wiping out AI2Sm in–uenHam
GR?I2m and other deadly diseases entirely fro  existencem pro,iding
a future where children  ay not need ,accines against these diseases.
jids without ,accinations are so eti es banned fro  public
schools and are not always allowed to play sports.T AI could be a ga e
changer for parents who fear inoculation and do not want to get their
children ,accinated.
Revela
AI has also pro,en itself in the cos etic side of the  edical veld.T
'e,elam a beauty and wellness brandm brought the power of AI into
hair and skin care.T Ey using AI to help tackle the age-old hair loss issuem
they ca e up with a new co pound.T Bhe co pany then launched
JroGelinylm a re,olutionary product to battle hair loss and aid hair
growth.T According to the co panym 'e,elaCs product pro,ed aston-
ishingly e"ecti,e a ong 8”/ of participants.T If so ething as diUcult
to treat as hair loss can be sol,ed with the help of artivcial intelligencem
how  any other challenging proble s can we vnd a solution to using
AI;TT
Brain/Body Interface
Another tough nut to crack has been the disability caused by a se,-
ered spinal cord.T Brau a can lea,e people without the ability to walkm
a ong other issues.T Woreo,erm while bionics and robotics ha,e co e
a long way in helping restore  o,e entm there is still a barrier when
there is no  o,e ent due to a lack of ner,e conduction.T Wost robotic
assistance needs so e  o,e ent to trigger the de,ice to  o,e.T Nor
exa plem if an ar  is se,eredm a robotic prosthesis can be attached and
—4 j'IS EALL

connected to  uscles and ner,es further up fro  where the li b was
cut.T Fhen the patient uses their brain to co  and what is left of the
ar m the bionic appendage senses the electrical conduction or twitch
in  uscles and  akes the desired  o,e ent or action.T Eut in patients
with no conduction at all X as in those cases when the spinal cord is
se,ered and sends no conduction to the legs at allm that technology does
not work.T
Mnter the AI-assisted brain body interface.T
In an article by 1ature written by Kenri Lorachm Andrea 3al,eHm
and othersm AI was able to help a  an walk again after a co plete
spinal cord inVury.T According to the articlem Swiss neuroscientists
use brain and spinal i plants on 3ert-zan Rska m a forty-year-old
2utch an paralyHed for twel,e years.T Bhe two brain i plants and
one spinal i plant co  unicatem bridging the gap between his in-
Vured ner,es.T A portable co puter then interprets the neural signals
and relays the  to a pulse generator that the body uses to create  uscle
 o,e ent.T Fith this technology and therapym 3ert-zan has been able
to walk and e,en cli b stairs 0Lorachm 9)9D5.
Bhe idea of being able to scan brains and interpret what electrical
signals  ean regarding ideasm thoughtsm etc.m is not new.T Kowe,erm it
usually in,ol,es largem expensi,e  achines like W'Is and JMB scan-
ners.T Ka,ing so ething i planted directly into the brain and then
ha,ing AI technology interpret those electrical and che ical signals in
real-ti e speaks ,olu es about where the technology is going.T
Its potential use in healthcare is Vust the vrst step.T In the futurem this
technology can be used in ,arious waysm fro  tailored  arketing and
ad,ertising research to the cri inal Vustice syste .T zust i agine a new
lie detector test that cannot be beaten or fooled by the cri inal.T Bhe
potential applications with brain interfaces are endless.
Custom Chemo
 BRWR''RFCS A'BINIGIAL I1BMLLI3M1GM —”

Mxscientiam a j-basedm AI-dri,en co panym de,eloped an AI-guid-

ed technology that ai ed to treat indi,idual patients with aggressi,e
blood cancers by pairing the  with specivc and e"ecti,e drugs.T Bhis
was initially tested on an P9-year-old  an with di"use large E-cell
ly pho a that was not responding to traditional che otherapy.T Ke
had undergone che o six ti es.T Bhere see ed to be no i pro,e-
 ent.T M,entuallym the patient was enrolled in a trial set up by the
Wedical ni,ersity of ?ienna.
A s all tu or tissue sa ple was collected fro  the patient and
using their AIm a  atch to a drugm not traditionally used for large
E-cell ly pho am was  ade. Ex vivo-based drug screening was used to
 onitor the progressm and two years laterm the  an was in co plete re-
 ission.T Bhe study was called Mxalt-—.T OBhis study seeks to test drugs
directly against the tu or tissues of each patient to disco,er specivc
drugs for their treat ent.T Bhis allows the treat ent of ad,anced-stage
he atologic cancers.T Bhe i pact of i age-based drug screening with
a deep learning algorith  exceeded expectationsO 0Mxscientiam 9)995.
As  entioned in its press releasem the co pany ai s to spread out its
research to other therapeutic areas.T Bhe AI-powered studies opened
the door to new possibilities in aggressi,e cancer treat ents with pos-
iti,e results and  ay also open the door to solutions for other diseases.
Fith AI testing indi,idual cancer cells to vnd the best treat ent for
the patients 0thus increasing their sur,i,al rates5m it is not i possible to
see a future where the nu ber of che o rounds for cancer patients is
signivcantly reduced.T Bhis is a future where patients would get  ore
ti e with their lo,ed ones where they could attend graduations and
weddings that they would otherwise not ha,e.T
It6s undeniable that AI can pro,ide a brighter future for cancer
patients and so eday pa,e the way for a world co pletely de,oid of
cancer so eday.
—P j'IS EALL

Detecting Genetic Variations That Cause Disease

AI in 3enetic research has been a focal point of 3oogleCs e"orts.T
As a result of their collaboration with JacEiom the research tea  is
utiliHing 3oogleCs ad,anced deep-learning  odelm 2eepGonsensusm to
accurately identify genetic ,ariants associated with ,arious diseases ac-
curately.T Bhis breakthrough aids in the identivcation of se,ere genetic
conditions.
Braditionallym genetic conditions ha,e pro,en diUcult to treat.T
'are genetic conditions cost  illions of dollars to research and treat.
2e,eloping drugs for these conditions are often not cost-e"ecti,e.
Bhe benevt to Vust a few rare indi,iduals does not Vustify the expense.
Kowe,erm with AIm the vnancial burden of researching and curing
these diseases  ay be signivcantly reduced.T Woreo,erm the ability of
AI to strea line and treat or alter these abnor alities  ay  ake ge-
netic diseases a thing of the past.T
AI and the EHR
AI is now entering the Mlectronic Kealth 'ecords 0MK'5 real .T
Garbon Kealth Bechnologies uses AI to generate patient healthcare
records in real ti e.T It records and transcribes the pro,iderCs inter-
action with the patient.T Bhe AI technology then incorporates lab
resultsm radiology notesm and other clinical data like ,ital signs.T Bhen
it adds the doctorCs su  ary to generate a co plete chart for the
,isit.T Ninallym it uses AI for diagnosis codes and billing 0'a,indranathm
9)9D5.
Bhe strea lined process sa,es ti e and cuts costs.T Labor in the
for  of scribesm codersm billersm etc.m can be eli inated.T Bhis technolo-
gy allows patient charts to be co pleted i  ediatelym speeding up the
billing and pay ent process.T
Bhinking aheadm AI incorporated into the doctor-patient relation-
ship can be benevcial.T AI can be progra  ed to look for connections
 BRWR''RFCS A'BINIGIAL I1BMLLI3M1GM —8

in lab results and sy pto sm aiding in order reco  endations and

diagnoses.T AI could e,en be progra  ed to reco  end tailored
treat ents for the patientm considering a wide ,ariety of details.T Sup-
pose a patientCs responses during the healthcare ,isit indicate that the
patient is not likely to take pills or follow a strict healthcare plan.T In
that casem the AI  ight reco  end ad ission to the hospital for in-
patient treat ent.T If the patientCs dietary and lifestyle choices suggest
they can do better with a low dose of  edicationm then the AI could
reco  end that.T Gookie-cutter  edicine  ight beco e a thing of
the past.T TT
AI in Radiology
It is not Vust the  ore signivcantm fatal diseases that AI could help
with.T AI can help with  inor inVuries and fractures.T A delayed or
 issed diagnosis is one of the  any proble s in radiology.T An AI
trained to detect fractures could sa,e a radiologist  uch ti e and
patients a lot of  oney.T A tea  of researchers in Mngland re,iewed 79
studies and co pared the perfor ance of AI and clinicians in fracture
detection and diagnosis.T Rf the 79 studiesm D” identived fractures
using -raysm and v,e used GB 0juom 9)995.
AI pro,ed Vust as eUcient in detecting fractures as cliniciansm if not
better.T Its sensiti,ity for detecting fractures was 8—X89/.T If the tech-
nology is de,elopedm it could process GAB scansm W'Ism and -rays
’uickerm signivcantly reducing ti e.
In 9)9)m breast cancer a"ected  illions of wo enm and o,er
4Pqm))) died.T Wa  ography screening is currently the  ost e"ecti,e
tool for detecting breast cancerm but precise diagnosis still re ains
a proble .T AI-dri,en technology has already been introduced into
healthcarem and AI-assisted  a  ography could yield  ore precise
diagnosesm signivcantly reduce the nu ber of deathsm and increase
positi,e patient outco es.
9) j'IS EALL

Soonm we could ha,e kiosks at drug stores where a person with an

inVured li b could ha,e their extre ity scanned and ha,e an accurate
diagnosis and reco  endations on where to buy an ar  slingm a wrist
splintm or a leg boot.T Alternati,elym they could get their annual  a -
 ography screening by walking into a photo booth and walking out
with a diagnosis.T Bhis could sa,e on expensi,e doctorCs ,isits for  inor
inVuries or annual screenings.T And by  aking radiology exa s fast and
easym  ore people are likely to get the  done ti elym possibly catching
issues that  ight ha,e been  issed or ignored.T Bhe possibilities with
AI-assisted radiology in the future are exciting.T
4

AI in the Military

A I has made its way into the military as well.  AI assistance has
made the military more epcient and shaged how war strateWies
are imglemented.
,eagonsv nauiWationv skrueillancev and auiation haue all ksed AI
to smooth ogerations and mabe them more epcient while redkcinW
hkman reliaqility.  As a conseTkencev the systems miWht need less
maintenance.  Dhis also redkces hkman error and the imgact that skch
errors can haue.
frone ogerations are one o- the more grominent areas -or ksinW
AI.  Instead o- a sinWle dronev swarms o- drones can qe degloyed
with the helg o- AIv which allows them to Wather more in-ormation. 
Dhe drones can also qe ksed in simklations and traininW ogerationsv
hauinW decisionjmabinW aqilities in a myriad o- sitkations.  Dhe drone
swarm can haue a main oqKectiuev qkt each drone acts indegendently
to achieue it.  Dhey commknicate and relay in-ormation to each other
in the swarm.
AI alWorithms can grocess data -rom a glethora o- sokrces to aid
decisionjmabinWv esgecially in sitkations o- hiWh stress.  In many o-
zz RSIB LA22

these circkmstancesv AI systems can gromgtly analyUe a sitkation and

Wiue the qest skWWestions on how to tacble it.  Hnlibe hkmansv it does
not kskally haue greKkdice or qiasv siWnixcantly redkcinW hkman error. 
Foweuerv AI systems still need to deuelog to knderstand hkman ethics
-kllyv and there is a risb that they may learn qias -rom the data eMistinW
in their dataqases.  Bince decisionjmabinW is necessaryv AI and hkmans
can mabe it easier qy worbinW toWether.  "or these reasonsv there will
groqaqly always qe a need -or a hkman to ouersee military decisions.
Data Research
It is timejconskminW to grocess larWe amoknts o- datav qkt AI can
helg qy Tkicbly xlterinW throkWh the data and choosinW the most
releuant in-ormation.  It can also Wrokg toWether in-ormation -rom
diuerse datasets to let military gersonnel identi-y gatterns more eCecj
tiuelyv come kg with more acckrate conclksionsv and create glans o-
action qased on a comglete and clear gictkre o- the sitkation.  AI can
xlter massiue amoknts o- news and social media contentv eliminatinW
regetitiue and inacckrate in-ormation to ogtimiUe the research grocess
and redkce hkman error.
AI can mabe tarWet recoWnition more acckrate in comqat enuironj
ments.  Dhe systems that identi-y tarWets can qe imgroued.  It can grej
dict enemy qehauiorv weatherv and enuironmental conditionsv assess
strateWiesv and recommend glans to saue time and hkman resokrces.
War Simulation
Oilitary traininW simklation so-twarev also bnown as a uirtkal
'warWamev' comqines so-tware enWineerinWv comgkter sciencev and
systems enWineerinW that helgs gregare soldiers -or comqat systems
degloyed dkrinW ogerations.  Dhese simklations grouide realistic misj
sion scenarios and tasbs -or soldiers to ger-orm so that they Wain more
than enokWh eMgerience qe-ore agglyinW their sbills to realjli-e sitkj
ations.  Nomqat simklation is sa-er than realityv allowinW soldiers to
 DEOESSE,GB ASDI"INIA2 I3D(22I0(3N( z)

eMgerience the realities o- war-are withokt endanWerinW themselues. 

AIjqased simklation can gersonaliUe traininW groWrams and mabe -air
assessments -or -ktkre adKkstmentsv sauinW time and money.
Cybersecurity & Threat Monitoring
Nyqerattacbs can render military systems uklneraqlev qkt AI can
grotect groWramsv datav networbsv and comgkters -rom knakthoriUed
access.  It can stkdy and eMamine cyqerattacb gatterns and deuelog
grotectiue strateWies to comqat themv recoWniUinW the tiniest siWns o-
malware attacbs lonW qe-ore they inuade a networb.
AI can qe ksed in threat monitorinW and sitkational awareness to
helg in uarioks military actiuities.  AIjgowered knmanned systems can
monitor qorder areasv sgot any threatv and alert the resgonse teams in
timev thks strenWtheninW the seckrity o- military qases and increasinW
the sa-ety o- soldiers in comqat PBentient fiWital Inc.v z;zz4.
Transportation
AI can glay a role in transgortinW ammknitionv Woodsv and troogsv
redkce transgort costsv and redkce the need -or any hkman interuenj
tion qy skWWestinW the qest rokte to trauel knder the conditions.  It
can also identi-y isskes -or military :eets qe-orehand and increase the
epciency o- their ger-ormance.
"or eMamglev ?alantir is an artixcial intelliWence glat-orm that has
a simklation uideo where their AI can gkll euerythinW toWether in a
realjli-e war scenario.  "rom sgottinW an enemy threat to reuiewinW
gossiqle teams in the area with the loWistical cagaqilities to tabe okt the
enemy tarWet their system can access the health and seckrity leuels o-
each memqer o- the teamv the terrain -or the sa-est and -astest roktesv
etc.
?alantir demonstrates how the military miWht kse its AI in a war. 
Dhe uideo shows the ogerator ksinW a Nhat0?Djstyle qot to order
z RSIB LA22

drones -or reconnaissancev deuise seueral glans o- attacb and Kam enej
my commknications.
,ith so many agglicationsv AIGs -ktkre in the military is aqsolkte. 
Dhe real -ktkristGs Tkestion is Fow mkch aktonomy will hkmans
haue in the military   ,ith aduancements in drones and missilesv what
need will there qe -or qoots on the Wroknd   Fow many soldiers are
needed when AI can do so mkch   Oy Wkess is that AI will euentkally
mabe the military smaller. 
5

AI's Impact in
Coding

P rogramming

Articail nietg isgeagnalengyygetil wnoritgnitynpoenmrpsrl,ydn

,pfi.wnitynpoenmrpsrl,,iesdnlefnsgegrltgnegonapfg Nnulthrl wdntviyn
vlyn,lewnlfIletlsgyn.prnmrpsrl,,gry NnAbnvlynl rglfwnkgshentpn,lOgn
itynolwnietpnyp.tolrgnmrpsrl,,ies 
Cegnp.ntvgn,pytnmpmh lrnapfiesntpp yniynxpfgTdnfgIg pmgfnkwn
CmgeAbdnlnywytg,ntvltntrley ltgynelthrl n leshlsgnietpnapfg Nnbtnalen
ietgrmrgtnap,,lefynorittgenienelthrl n leshlsgnlefnrhentvg,n.prntvgn
mrpsrl,,gr NnHviynl poyntvgnmrpsrl,,grntpnkhi fnhmpenlengTiytiesn
lmm ialtipenoitvnlnelthrl n leshlsgnietgr.lag NnxpfgTnalenkgnhygfn.prn
l ,pytnlewnmrpsrl,,iesntlyO NnDpogIgrdntvgntpp niynyti negonlefnalen
vlIgn i,itltipey 
A mvlxpfgdnfgIg pmgfnkwnMggm5iefdniynleptvgrnmrpsrl,,iesn
tpp n,lOiesnolIgy NnHviyn,pfg nlavigIgfnlnrleOnp.n4%0nienapfiesn
ap,mgtitipeyntvltnapeyiytgfnp.n4d(((nmlrtiaimletynG2pps gnMggm5iefdn
)())K 
)W RSbBnLA66

Pgnl nOeponxvlt2VH Nnbtynalmlki itigynvlIgnkggenmrpIgenti,gnlefn

ti,gnlslie Nnbtdntppdnalenkgnhygfn.prnapfiesntlyOy 
-lriphynapfiesnAbynvlIgnmpmmgfnhmnlarpyyntvgnkissgytntgavnvglIw3
ogisvtyn iOgnCmgeAbdn2pps gdnlefn5iarpyp.tdnl,pesnptvgry Nn2pps gn
vlynfgIg pmgfnlnapeIgryltipel nAbntpp dnLlrfdntvltnalenvg mnyp.tolrgn
fgIg pmgrynoitvnmrpsrl,,iesdnapfiesdnfgkhssiesdnlefnapfgngTm lel3
tipe Nn2pps gnm leynpen lheaviesntvgn.glthrgynienpIgrn)(nmrpsrl,,iesn
leshlsgy NnLlrfnalenfgkhsnapfgn iegnkwn iegdntvhynvg miesnhygryncTngr3
rprynGRprpygadn)()qK NnHvgnapfgnalenl ypnkgntrley ltgfn.rp,npegnapfiesn
leshlsgntpnleptvgr NnDpogIgrdn iOgn,lewnptvgrnegonAbnlmm ialtipeydn
Llrfniynyti nienitynie.leawnlefneggfyni,mrpIg,get Nnbtniynyti nmrpegntpn
sgegrltiesnieaprrgatnprnieap,m gtgnapfgn.prnmrpsrl,,gry NnCrngIgen
apfgntvltnfpgyneptnmrpIifgntvgngTmgatgfnphtmhtngIgeni.nitnoprOy 
Hvgnapeyg"hgeagynp.nrlmif wngIp IiesnAbnienyp.tolrgnfgIg pm,getn
yvph fnkgnapeyifgrgfnovgengIgrwtviesn,pIgyn"hiaO w NnAbntpp ynalen
rgargltgnIh egrlki itigynientvgnapfgntvgwnmhtn.prtvnlynyhssgytipeyntpn
mrpsrl,,grydnoviavnmrpsrl,,gryn,lwnprn,lwneptneptiag NnSg wiesn
tppn,havnpenAbnaph fn,lOgnmrpsrl,,grynap,m laget NnHvgrgnl ypn
ap,gyntvgn"hgytipenp.nlnjtgaveial nfgktdjnovgrgnyp,gti,gnientvgn.h3
thrgdnmrpsrl,,gryn,lwnvlIgntpncTnyp.tolrgntvltnepnvh,lenvlyngIgrn
gTl,iegfna pyg w 
5lewnmrpsrl,,gryn.gg ntvltntvgwnoi nkgap,gnpkyp gtgnovgenAbn
tlOgynpIgrnmrpsrl,,ies NnHvgwnoph fn pygntvgirn?pkydnoviavntvgwnvlfn
mhtnwglrynp.ng'prtnietpn glreiesnlefnmrlatiaies 
LhtnovltnlkphtntvgnUimnyifgF
Hvgnyp.tolrgniefhytrwnvlynkggenhefgrmrpfhaiesnyp.tolrgntpn,ggtn
apeyh,gryEngIgr3srpoiesnfg,lefy Nnbtniynvlrfn.prnapfgryntpn,ggtntvpygn
fg,lefynienti,gdnypntvgrgn,lwnkgnlnolwntpng,m pwnkptvnvh,leynlefn
Abntpn,lOgnitnoprOdn.prnAbntpnvg mnapfgrynfgIg pmnyp.tolrgn.lytgrnlefn
oritgnapfgn.lytgr Nn7 ti,ltg wdnognoi nyti neggfnvh,lenapfgryntpnkgn
 HC5CSSCPEBnASHb1bxbA6nbuH966b29ux9 )8

lrphefnkgalhygntvgnfg,lefn.prnyp.tolrgnoi nl olwynapetiehg NnHvgn
kppytnienmrpfhatiIitwnoitvntvgnvg mnp.nAbnaph fn,lOgnapfgryngIgen
,prgng'gatiIgdnlefnwglryn.rp,nepodntvgwn,lwnkgn,prgnyphsvt3l.tgr 
9Igeni.nAbntlOgynpIgrntvgn,l?pritwnp.ntvgnapfiesdnvh,lenapfgryn
oi nyoitavntpn.pahyiesnpenovltnAbnaleeptnfp NnHviynIgrwnieytieatn.prn
lflmtiesnlefngIp Iiesnoi nyvlmgntvgn.hthrg NnDh,leynlrgnkhi tntpn
gIp Ig NnPgnoi nl olwyncefnlnolw 
6ppOiesnklaOdnAH5ynlrgnpegnp.ntvgn,pytnmrp,iegetngTl,m gynp.n
tgavep pswnEtlOiesEnvh,len?pky NnPvgenAH5yncrytnal,gnpetpntvgn
,lrOgtdnitnolyn.glrgfntvltnkleOntg grynoph fn pygntvgirn?pky Nnbenrgl itwdn
tvgneh,kgrnp.nkleOntg grynsrgonkgtoggen; (nlefn)(;( NnHvgwnkg3
al,gnlfgmtnltnyl gydnfgIg pmiesnlnrlmmprtnoitvnahytp,grydnlefnyg iesn
egonmrpfhatynlefnygrIiagy NnHvgirn?pknfifneptngef nitnkgal,gnfi'grget Nn
bn.prgyggntviynyl,gn.hthrgnoitvnapfgry N
9Igethl wdnpmti,iytynkg igIgntvltn.hthrgnmrpsrl,,gryEn?pkynoi n
.pahyn gyynpenoritiesnapfgnlefn,prgnpenifgeti.wiesnlefnIgri.wiesn.l ygn
prnflesgrphynapfg NnHviynoph fn,lOgnmrpsrl,,grynIl hlk gdngIgen
oitvnAbniengTiytgeag 
6

Writing with AI

F ormal Writing

Gone are the days when we used to scour libraries and the
internet to fnd inmorpation on essay to,icsk tage notesk and write
len.thy ,ara.ra,hs while stru..lin. to reach the word lipit A vll you
haCe to do now is Cisit PhatGTI or sipilar và sitesk ty,e in a ,rop,tk
and et CoilWk you haCe ,a.es and ,a.es om a school essay written in
seconds A và has already chan.ed how ,eo,le write essaysk ,a,ersk
articlesk and boogs  'riter?s blocgjA 'hat?s thatj 'ith vàk ,rop,ts
can hel, .et creatiCe Huices xowin. 
OoweCerk it is not Hust essays A 'hen we reach the neMt leCelk we
reach scientifc writin. and research ,a,ersk which are puch pore
challen.in. A GeneratiCe và has hel,ed researchers and acadepics
write their panuscri,ts and brin. their ideas to lime 
'ritesonic is another và tool that hel,s write articlesk blo.sk and
,a,ers A àt copes at an aRordable subscri,tion ,ricek pagin. it suitable
mor spall businesses and mreelancers 
vdditionallyk Po,y aik at the popentk is another eRectiCe và writer
out there A Po,y ai is also hel,mul mor sales and pargetin. a.enciesk
 ISFSLLS'?N vLIàEàPàv2 à9I-22àG-9P- q—

social pedia pana.ersk businessesk and startu,s A àt ,roCides a ran.e

om o,tions to write anythin. mrop blo. ,osts and ad co,ies to social
pedia content and website co,ies A Ihe adCanta.e om this và is that it
,roCides pulti,le results based on the ,rop,t and inmorpation you
,roCidek so you can .o throu.h the results and ,icg whateCer you lige
the post 
Ferlin is another và tool that?s a PhatGTI eMtension A àt is downz
loadable mrop Phropek enablin. you to use PhatGTI on any website
to write epailsk social pedia ,ostsk blo. ,ostsk and code 
Sther và writers include Lytrk Nip,lifed aik and Npodink apon.
others A Npodin has a meature that allows it to write content that byz
,asses sope và detectors A Ponch và is another allzinzone writin. tool A
àtk took can .o undetected by pany và detectors 
Fany researchers meel the rimt between their writin. ability and the
re:uirepents mor panuscri,tsk which are essential mor subpittin. to
Hournals A Ihis decreases their confdence and increases their anMiety A
-Cen when they do writek they pay not be able to peet the strict
deadlinesk which are essential mor a research career A Io tacgle thisk và
tools page writin.Kes,ecially scientifc writin.Ka lot easier 
và is ca,able om su,,ortin. hupans in daily actiCities and ,roz
Cidin. research su,,ort A àt is .rowin. :uicgly in ,ublishin. in order
to reduce tipe and eRort A vnd costs A àn research and ,ublicationsk
và is used mor translatin. lan.ua.esk suppariBin. teMtk checgin. lanz
.ua.ek ,la.iarispk ipa.e :ualityk and morpattin. content A và assisz
tance pages researchk writin.k and editin. ,rocesses easierk masterk and
pore e3cient 
Ihe amorepentioned tools are usemul mor su,,ortin. research and
writin.k but they should not entirely re,lace hupan eRort and eM,ez
rience A Ihe use om và in writin. raises Carious ethical considerations0
6U (LàN )v22

● A A A Risk of errors and biased results0 vn và tool is trained

usin. data podelsk and its lipits lie within that trainin. A Ihey are
susce,tible to bias and cannot be used to fnish writin. tasgs without
bein. Cetted by a hupan A và can .enerate sgewed results and pisz
re,resent inmorpation im s,ecifc geywords are eMcluded A và tools pay
be inaccurate since they need hel, understandin. the conteMt A 'riters
still re:uire ,roomreadin. to aCoid errors in their worg 
● A Carbon footprints0 2an.ua.ezlearnin. podels re:uire inz
tensiCe trainin. that re:uires a lot om ,ower A v lot om ener.y .oes
into crunchin. lar.e apounts om data A Ihe pore adCanced an vàk the
.reater its carbon moot,rintk thus increasin. carbon epissions A Iherez
morek the deCelo,ers om và pay need to loog mor pore ener.yze3cient
o,tions to reduce their carbon moot,rint and ,rotect the enCironz
pent A vccordin. to Farr 1qUq6"k in a reCiew by FàI Iechnolo.yk
oCer VqVkUUU ,ounds om carbon dioMide are epitted while trainin. a
sin.le và podelk which is alpost fCe tipes the epissions om an aCera.e
car in the DN oCer a limetipe 
● A Over-reliance on AI leads to learning losses0 Ihe oCerzdez
,endence on và causes researchers and students to lose their own sense
om learnin. and gnowled.e in writin. A àt is a headszu, mor eCeryone
usin. và0 paintain your writin. Coice A Ihe eRort to learn and brush
u, on Cocabulary sgills should be continued 
àp,lepented correctlyk the ,ropise om và in morpal writin. and
research can haCe ,romound benefts A àpa.ine data mrop research
studies bein. aCailable to acadepics ippediatelyk hel,in. thep ip,lez
pent best ,ractices master usin. eCidencezbased techni:ues A àpa.ine
researchers who are not stron. writers shru..in. oR their mear and
.ettin. ,a,ers out there that would neCer haCe pade it into a Hournal
without the hel, and confdence và brin.s to the table A
ACreative Writing
 ISFSLLS'?N vLIàEàPàv2 à9I-22àG-9P- 6

àn an article by Tufts Dailyk an inde,endent news,a,er om Iumts

DniCersity in Fedmordk Fassachusettsk PhatGTI was .iCen a series om
,rop,ts A Ihe frst ,rop,t was to write a story containin. dee,er
peanin.  vmter thisk à was asged to reCiew To Kill a Mockingbird A
Ihe initial short story was decentk while the reCiew was shocgin.ly
wellzwritten  Ihis shows the diRerence in PhatGTI?s stren.ths in
writin.  9ew content is di3cult mor the vàk but reCiewin. content
that already eMists is easy 
Ihe .a, occurs when the và chatbot tries to epulate hupan epoz
tions and essence while writin. short stories  -Cen thou.h the ,rose
is elo:uentk it lacgs substance or de,th A PhatGTI also tried to epz
,loy moreshadowin. and sypbolisp but mailed A -Cen nowk scientists
haCe yet to reach the ,oint om creatin. an và that understands the
cop,leMities om hupan epotions  No mark và has its lipitsk which is
encoura.in. A Eor nowk it cannot reach the leCel om hupan creatiCity A
Sne day và pay be Hust as .ood at creatiCe writin. as morpal writz
in. A Ntudents are omten asged to write essays and research ,a,ers needz
in. pore indiCidual uni:ueness at schools and uniCersities A Eor this
reasonk pany om thep haCe started usin. và to hel, with the tedious
worg A )ut in the realp om creatiCe writin.k the use om và dro,s A Sne
dayk it pay be e:ual A -Cen thenk à sus,ect there will still be ,lenty om
,eo,le writin. their own stories without the hel, om any và A Ihere
will moreCer be authentick .enuine stories written by creatiCe ,eo,le
burstin. with the need to .et their stories out there A và will neCer tage
that away A
vlternatiCelyk và could hel, s,eed u, .ettin. creatiCe worg out
there A và pay not write the content but instead hel, with the adCerz
tisin.k co,ywritin.k editin.k and other tedious ,arts om writin. fction A
àpa.ine a world where readers no lon.er haCe to wait ponths and
ponths mor a se:uel to their maCorite series 
6q (LàN )v22

WGA Strike Against AI

vs om qUq6k the 'riters Guild om vperica 1'Gv" has .one on
strige a.ainst the vlliance om Fotion Ticture and IeleCision Troducz
ersk claipin. that the cop,anies haCe ,rofted oR the writers? worg
and are not cop,ensatin. thep enou.h A Ihe 'Gv depands better
,ay and settin. u, .uardrails that ban flp studios mrop usin. vàk lige
PhatGTIk to .enerate scri,ts or story ideas mor I shows and poCies 
Ihe strige s,eags to the broader idea om ,reCentin. và mrop tagin.
Hobs A
oes và write a scri,t better than one written by a hupanjA Trobz
ably not A vt least not yet A
Oistorically when Hobs are threatened by technolo.yk consupers
decide the outcope A àm the technolo.y driCes down costs while ,roz
Cidin. the sape serCicek the technolo.y wins A àm notk the technolo.y
either ip,roCes or dies 
2awsuits and striges are one way om steppin. the tide and morcin.
the technolo.y bacgward A Snly tipe will tell how this ,lays out 
7

AI Assistants

W ork Assistants

Meetings are part of many people's daily work.  Often, for

various reasons, it may take ecort to hathb up on presentations and
take notes, espehially wben many tbings are going on, many points
are made, and many tasks are assigned.  Manually keeping notes han
prove to Ae honfusing and tedious.  Otter Ij was developed to belp
streamline tbis prohess and make it easier for users to take notes of
meetings.
Otter Ij is a meeting assistant tbat belps write notes automatihally,
rehord audio, and hapture presentations.  jt also lets you bigbligbt key
points and automatihally Yoin and rehord meetings.  jt makes tbe entire
prohess easier to manage, and you do not bave to worry aAout missing
anytbing important.
On tbe otber band, Mindgrasp is an Ij tool tbat lets you make sense
of notes you bave already taken during meetings.  zou han summari-e
notes or ask Mindgrasp to hompare points.  zou han ask for suggesK
tions on improvement and even ask it to write a paragrapb on any
spehiRh point.
WT SBjL 3I44

Ij tools like tbese han belp us manage our daily tasks and simplify
our work.  jt all depends on bow etbihally and mindfully we use tbem. 
jmagine a future wbere we han attend meetings or hlasses Aut never
bave to Yot down a tbing.  Ij will Ae tbe personal sehretary, taking
notes and summari-ing tbe details in wbatever metbod is Aest for our
learning style.

Personal Assistants

De know bow e"hient Ij han Ae as personal assistants, from making

lists and presentations to planning vahations.  Ij, suhb as xome, is
bandy for hreating presentations witb AuiltKin features suhb as stohk
videos and W? images and renderings.  Ill it takes is for you to type
in an instruhtion, say, VDrite si— slides on renewaAle energy,V tbe Ij
presents you witb a wellKwritten delivery tbat you han easily edit, reK
arrange, and make Aetter. xbere is also a feature to add video homK
mentaries and use tbe xome app to bandle tbe presentations seamK
lessly and lastKminute hbanges.
xbat is only part of wbat Ij han hurrently do as a personal assistant. 
Dbat aAout tripsF  CahationsF
De sit Aefore homputers and laptops for bours, working out every
last detail of our vahationsNbotels, Audgets, Eigbts, tbe wbole deal. 
De also know bow frustrating it is to shour for tbe hbeapest botels and
tbe Aest foods, not to mention bow honfusing it is wben you go to an
entirely new plahe and are presented witb too many options.
xbis is wby Ij tools like Sayak were hreated.  Sayak belps witb
Aooking Eigbts, botels, and har rentals.  jt also bas tbe feature of hreK
ating an itinerary, wbihb you han sbare witb multiple people using a
single link.
 xOMOBBOD'L IBxjGj5jI4 jPxq44j qP5q W

Of hourse, tbere is always 5bat x up for answering uestions

related to planning trips.  zou han ask 5bat x to plan a detailed
itinerary, saving you tbe host and time of looking for plahes.  qven if
you did not follow 5bat x's suggestions to tbe letter, it would give
you a starting point.
Ditb tbe use of tbis Ij, you han hreate points of interest in a hity
you bave never Aeen to Aefore.  zou han ask tbe Ij to hreate holumns
witb tbe distanhe from tbe botel to tbese points of interest, tbe hosts
of eahb plahe, and tbe bours tbey are open.
Dben used rigbt, Ij han hertainly save us tbe an—iety, time, ecort,
and hosts of navigating tbrougb an entirely new plahe.
8

AI in Politics and
the Economy

R evolutionizing Politics

AI technology has grown so exponentially that it has even

reached the House of Representatives.
OpenAI's revolutionary and controversial AI, ChatGPT, has en-
tered congressional o ces.k The House recently created a new worming
group for the stab to experi4ent with and share AI tools in the o ce,
which led the House of Representatives digital service to o0tain (J
licenses for ChatGPT Plus 23ones, )J)DS.k The licenses ca4e a4id
de0ates over arti$cial intelligence, how the technology should 0e used
in the govern4ent sector, and how it should 0e regulated.k
This is one of the earliest exa4ples of the use of ChatGPT in pol-
icy4aming processes.k According to 3ones 2)J)DS, the zigital Mervices
of the House of Representatives will pay a W)J 4onthly su0scription
plan for an inde$nite period.k Congressional o ces intend to use
ChatGPT to create and su44ariFe the content, create constituent
drafts and press releases, su44ariFe large a4ounts of text in speeches,
 TOLORRON'M ARTIEICIA7 IBT177IG1BC1 DU

draft 0ills and policy papers, graphic design for logos, etc.k The House
is trying to catch up with trends and advance4ents in technology in
order to serve people 0etter.
In the 1xecutive 0ranch, the Nhite House, under the jiden ad-
4inistration, has announced %(J 4illion dollars to esta0lish seven AI
research centers.k
Another exa4ple of AI in politics is when KM Congress4an 3ame
Auchincloss read a speech that ChatGPT wrote 0ecause he wanted to
encourage a de0ate on the use of arti$cial intelligence.k He did so 0y
reading out a speech created 0y AI.
AI will help write laws and re0uttals.k It will also read through
and interpret proposals, which 4ay hide e40edded provisions for
lo00yists, or it can 0e used to incorporate 4ore sneamy sections placed
into 0ills guaranteed to pass.k As 4entioned 0efore, AI is a tool that
can 0e used for positive ebects on politics, or it can 4ame the darmer
side of politics even darmer.k
Economy
As of now, econo4ic predictions are not relia0le.k 1cono4ists need
to do a 0etter 8o0 of predicting the econo4y.k 1ven in the past, they
had failed to predict depressions accurately.k This is in large part due to
the mood swings of consu4ers.k Eor exa4ple, if econo4ists predict (’
in"ation, people would instinctively de4and (’ in wages, increasing
the in"ation rate above (’.
Hu4ans are irrational, unpredicta0le, and constantly change. je-
cause of this, econo4ists 4ainly use theoretical 4odels that do not
consider natural hu4an nature, leading to unpredicta0ility in their
decisions and smewed predictions.k The theoretical 4odels have little
value 0ecause they need to consider the changes in hu4an 0ehavior
and econo4ic perception.
D+ /RIM jA77

Eor exa4ple, tame the story of Ga4eMtop, a 4uch-0eloved

0ricm-and-4ortar ga4e store.k Nall Mtreet tried short-selling the co4-
pany in the hopes it would fail.k They were 0etting that the co4pany9s
share price would fall as a 4eans for hedge funds to 4ame 4oney.
In the case of Ga4eMtop, however, a group of users on Reddit
who had a senti4ental attach4ent to the store went on a coordi-
nated 0uying spree that forced the price up 0y %+JJ’.k This caused
short-sellers to suber losses of 0illions of dollars.k This sudden, un-
predicta0le change in the stocm 4armet showed that hu4ans could
do strange things out of e4otion, leading to a signi$cant econo4ic
i4pact 2zavies, )J)%S.
Ne have a "awed perception of the world through the lens of eco-
no4ics.k Mcientists hold on to the pri4ary goal of seeming the truth and
vow to have an un0iased 8udg4ent to analyFe the world 0est, 0ut this
rarely holds up in practice.k The pro0le4 of econo4ics goes 0eyond
smewed analysis and predictions.k It is often su08ect to politics as well.k
Politics tends to 4anipulate reality in order to attain power.k Nhen
this gets into econo4ics, what you get is an altered perception.
To avoid this, AI gives un0iased econo4ic predictions and evi-
dence-0ased suggestions driven 0y data.k AI could end econo4ic de-
0ates driven 0y politics and provide suggestions on overco4ing the
o0stacles regardless of what they 4ean for one political party or an-
other.
AI-driven predictive analysis can tacmle the challenges present in
econo4ic forecasting.k AI lime danel$n use arti$cial intelligence to
review stocm picms and score the4 on a %-%J rating. According to
their we0site, qMince )J%U, KM-7isted stocms with the highest AI score
2%J:%JS outperfor4ed the 4armet 0y )J.J+’ on average after D
4onths, while stocms with the lowest AI score 2%:%JS underperfor4ed
the 4armet 0y -DJ. )’ on averageq 2zanel$n, )J)DS. 1cono4ists
 TOLORRON'M ARTIEICIA7 IBT177IG1BC1 D

can use AI techni ues to 4onitor 4ore than 8ust the stocm 4armet's
changing trends.k Moon predictive analytics will 0e a0le to co40ine
classic statistical analysis with advanced AI technology.
AI can also analyFe news headlines and how they in"uence hu-
4an senti4ents a0out the econo4y.k 3PLorgan is already using this.k
They used an algorith4 that analyFed the ebects of President Tru4p's
tweets on the $nancial 4armets.k Nhen used on a large scale, AI could
also help predict when recessions hit so that 0anms and authorities
could pro4ptly tacmle the pro0le4.
AI tames into consideration what econo4ists do not changes in
hu4an 0ehavior.k It can also predict changes in the econo4y, includ-
ing supply and de4and, so necessary changes can 0e i4ple4ented
accordingly. The econo4y 0eco4es 4ore sta0le in a world where
data is 0ias-free and accurate, and hu4an reactions can 0e predicted.k
People can plan 0etter for the future when recessions and depressions
happen less and less fre uently.k
9

Neural Fields
for LiDAR

A groundbreaking technique called “neural seld”f Lor DiRA(

NF)Dm ha” everged a” a ”igniscant ad.ancevent in the realv
oL autonovou” dri.ing p F)D covbine” neural seld” and a detailed
vodel oL DiRA( ”en”or” to create reali”tic ”can” Lrov di-erent werT
”wecti.e” 
F)D covbine” the rendering cawabilitie” oL neural seld” yith a
covwrehen”i.e vodel oL the DiRA( ”en”ing wroce”” p ,he re”ult”
o-er the wotential to ob”er.e real ”cene” Lrov wre.iou”lx un”een werT
”wecti.e”z enhancing the accuracx and reliabilitx oL autonovou” driT
.ing ”x”tev” p ,heir u”e yill eItend acro”” .ariou” indu”trie”z ”uch
a” robotic”z .irtual realitxz and gaving p ,he”e awwlication” benest
”igniscantlx Lrov the a.ailabilitx oL reali”ticz highTqualitx ”xnthe”iOed
.iey”z yhich Lacilitate ivwro.ed training and e.aluation oL wercewtion
algorithv” 
Mt ha” been te”ted and wro.en to outwerLorv traditional vethod”
in ”xnthe”iOing ney .iey” p ,he F)D could re.olutioniOe the auT
 ,W'W((WSCE A(,M)MGMAD MF,4DDM14FG4 3H

tonovou” .ehicle indu”trx yith the wro”wect oL ”aLerz vore reliablez

and vore e:cient tran”wortation p )urthervorez incorworating whx”T
icallx voti.ated vodel” oL ”en”ing wroce””e” yithin Fe() and it”
.ariant” yill re”ult in e.en vore reali”tic outwut”z Lurther bridging the
dovain gaw betyeen ”xnthetic and real data 
Feural (adiance )ield” NFe()m ha.e alreadx ”hoyca”ed ivwre””i.e
re”ult” in ”xnthe”iOing no.el .iey” yith eIcewtional .i”ual qualitx Lor
.ariou” awwlication” p A” Fe()” ad.ance and adawt to di.er”e ”en”or
txwe” and en.ironvental condition”z there yill be broader awwlicaT
tion”z vore reali”vz ivwro.ed handling oL dxnavic ”cene”z and inT
crea”ed robu”tne”” 
Shile the F)D technique wrivarilx Locu”e” on owtiviOing DiRA(
”can” Lor autonovou” dri.ing awwlication”z it could al”o be utiliOed
in vawwing crive ”cene” p DiRA( technologx i” covvonlx u”ed in
Loren”ic in.e”tigation” to cawture detailed KR data Lrov crive ”cene” p
,he F)DC” abilitx to ”xnthe”iOe reali”tic DiRA( ”can” Lrov di-erent
.ieywoint” could a””i”t in creating covwrehen”i.e and accurate rewT
re”entation” oL crive ”cene”z aiding in.e”tigator” in their analx”i” and
recon”truction oL e.ent” 
Boye.erz it i” e””ential to note that ”wecisc adawtation” and con”idT
eration” are needed to awwlx the technologx e-ecti.elx in the Loren”ic
area2
Shen con”idering the adawtation oL the F)D technique Lor vawT
wing crive ”cene”z ”e.eral Lactor” and con”ideration” cove into wlax2
● p p p Data Integrity and Maintaining Chain of Custody
● p p p Forensic Standards and Practices
● p p p Compatibility and Integration into Existing Forensic
Software
● p p p Expertise and Training on the Software
3 j(ME ADD

x addre””ing the”e con”ideration” and ad u”ting the F)D techT

niquez it i” wo””ible to vake good u”e oL it” cawabilitie” in vawwing
crive ”cene”z wro.iding in.e”tigator” yith a robu”t Loren”ic analx”i”
and recon”truction tool p Shen u”ed correctlxz thi” technique could
helw catch crivinal” or helw urie” to con.ict thev p
Section 2

AI in Pop Culture
10

Avatars

A rt was once believed to be the fnal ,rontierm ipIossible ,or A.

to crossN gowm art is beinu in ndated with A. aIIsN' A.-s vividy
nessm bea tUm and creativitU in o r IoI c lt re are ipIressiveN' knlije
the qob parjets Irevio slU pentionedm A.-s Iresence in artm p sicm
videom and creative writinu has been riddled with controversUN' And
with uood reasonN' A.-s Iresence in IoI c lt re has  s T estioninum
pore than everm what it peans to be h panN
gowadaUsm c stop avatars o, Uo rsel, can be padeN' Shese alpost
li,eylijem povinu reIlicas o, Uo rsel, can be created and  sed in vario s
waUsN' Shere is even sIeech so,tware that can reIlicate realyli,e voicesN'
Swo o, these A.s are EUnthesia and LlevenCabsN
EUnthesia is a Ilat,orp that creates li,eylije A. reIresentations o,
h pansN' O stop avatars can be  sed to create b siness videos with
EUnthesiaN' A,ter creatinu Uo r avatarm Uo  can  se it in a video bU
sipIlU writinu the scriIt ,or the avatar to sIeaj and then ueneratinu
the videoN
LlevenCabs has sIeech so,tware that creates li,eylije h pan voices
,or creators and I blishers to  se ,or storUtellinuN' .t does not q st
 SMRMWWMF-E AWS.G.O.AC .gSLCC.4LgOL 5;

uenerate Ilain voicesJ it tajes care o, intonations and inxections in

h pan sIeechm pajinu it alpost indistinu ishable ,rop realitUN
zoanna Eternm a col pnist ,or She Fall Etreet zo rnalm eDIeripenty
ed with testinu the nat ralness o, diuital avatars created  sinu ady
vanced uenerative A. aluorithpsN' She res lt was alarpinum as zoanna
co ld create her own diuital clone caIable o, deceivinu her relatives
and tricjinu a banj-s voice recounition sUstepN
ksinu the EUnthesia toolm zoanna created a video avatar based on her
a dio and video recordinusN' Altho uh the avatar loojed convincinum
lonuer eDIos res revealed that it was not a nat ral IersonN' EipilarlUm
a diuital avatar  sed d rinu a 4ooule Reet video call aIIeared  nnaty
 ralN
zoanna then tried creatinu a voice clone  sinu LlevenCabs- ueneray
tive A. aluorithpN' She a dio avatar so nded pore lije a real Iersonm
addinu intonation and a spoother teDt renderinuN' zoanna-s sister and
,ather did not ippediatelU notice theU were copp nicatinu with a
voice clone b t event allU reali"ed it was not an act al IersonN
YesIite the acc racU o, the avatarsm theU are not Uet caIable o,
creatinu Ier,ect clonesN' She  ncannU valleU still eDistsN' .n the , y
t rem A. technolouies will lijelU advancem pajinu it pore challenuinu
to distinu ish between a virt al avatar and a nat ral Ierson d rinu
copp nicationN' Shis brinus  I the worrUinu s bqect o, KdeeI,ajesK
sIreadinu pisin,orpationN
YeeI,ajes are a jind o, sUnthetic pedia that is desiuned to reIlicate
and reIlace a Ierson-s lijeness with another artifciallUN' .t has steadilU
risen over the Iast ,ew Uearsm altho uh it is still Uo nuN
.n an article bU She gew Borj Sipesm deeI,ajes have been  sed
to sIread Iolitical pisin,orpation in news o tlets and vario s other
IlacesN' 4raIhijam a research frp st dUinu disin,orpationm discovered
deeI,aje technolouU beinu  sed to I sh ,alse capIaiunsN' RanU Ieoy
5H 6W.E VACC

Ile in these videos were A.yueneratedm tajen ,rop one o, EUnthesia-s

diuital actorsN' As s chm the coy,o nder and chie, eDec tive o cer o,
EUnthesiam ictor WiIarbellim said that his teap is dedicated to Irey
ventinu their A. ,rop beinu  sed illeuallUN' oweverm o,tentipes it is
hard ,or thep to detect deeI,aje when there is no hate sIeechm eDIlicit
wordsm or ipaues in the videosN
YeeI,ajes have also been  sed to create IornouraIhic videos  sinu
the ,aces o, celebritiesm p ch to their epbarrasspent and shapeN
.t is hard to tell ,aje ,rop realN Lvent allUm deeI,ajes can develoI
to the Ioint that it will be ipIossible to tell realitU ,rop fctionN' She
 se o, s ch technolouU sho ld be scr tini"edN
Avatars have also pade headlines recentlU with their biasN .nyaII
A. flters lije the one on SijSoj can taje a selfe o, Uo  and t rn Uo 
into a cartoonN oweverm the cartoon rendered tajes into acco nt
clothinum bacjuro ndm and ,acial eDIressionN Fhen testedm a white
pale-s cartoon avatar was t rned into a blacj pale sipIlU bU t rninu
his baseball caI bacjwardN She eDapIle ill strates the deeIyseated bias
that lives within the so,twareN
11

AI Music

A I in music made waves recently with the announcement of

a new Beatles record by Paul McCartney using AI (Savage,
2023).  The idea of artiJcial intelligence using old recordings of Lohn
'ennonps voice to clean u5 audio from over D0 years ago to create a new
song is im5ressive.  It blurs the lines between natural and artiJcial.
In fact, AI has made it so easy to com5ose music that you do not
need any musical talent to create it.  -escri5t is a 5latform that allows
you to clone your voice, which you can then use to edit audio or create
music, 5odcasts, or videos.  -escri5t uses an AI called 'yrebird to
achieve ultrakrealistic voices.  It taOes care of the tone of the voice.  The
5latform only allows you to clone your own voice under its 5rivacy
5olicy.  Gther 5rograms allow you to clone the voices of others to
create music.
A 5odcast by the Euardian mentioned how -avid Euetta, a famous
-L, cloned the voice of the famous ra55er, Kminem, to create a tracO
that he then 5layed at an event.   The crowd went wild.  There have
been many instances of musicians having their voices taOen without
their 5ermission and those voices being cloned and used to create new
8Y R4IS BA''

music.  This has led to massive controversy surrounding the involvek

ment of AI in the music industry, from the musickmaOing 5rocess
right down to the vocals. Because as AI grows and becomes more
advanced, the rough edges around cloned voices will be smoothed over
until they become virtually indistinguishable from the real thing.
Gne of the many AI music software 5rograms available out there is
Boomy.  It allows users to create songs by 5roviding 5lenty of o5tions. 
"ou can choose several genres and then clicO on a button that says,
jCreate a song,j and the AI will com5ose a new song for you in less
than thirty seconds.  It selects the tracOps Oey, chords, and melody, and
then you can Jnektune and edit your song.  "ou have 5lenty of choices
for editing, such as adding or removing instruments, ad1usting the
tem5o and volume, adding vocals, etc.
Boomy was launched at the end of 20UY and claimed its users
around the globe had created over Jve million songs.  The website
also allows users to u5load their tracOs onto S5otify and other muk
sic streaming sites, and every time those songs get 5layed, the users
earn money (Belton, 2022).  The songs sound com5uterkgenerated,
but that does not sto5 the develo5ment of AI songwriting software. 
The more of them that come u5, the chea5er songwriting software
becomes.
9sing AI to com5ose music is not a new thing.  In the UHY0s, -avid
Co5e, a classical com5oser, develo5ed a similar software system after
hitting writerps blocO.  xe once set it u5 to com5ose music similar to
that of Lohann Sebastian Bach, and the com5uter had com5osed D,000
5ieces of music ins5ired by Bach, which were later released in an album
called Bach by -esign.
The Euardian eW5ressed concerns about how human musickmaOers
would be jdisenfranchised by AIj in their 5odcast.  They s5oOe in
great lengths about artists with their voices and music cloned and how
 TGMG44GFpS A4TINICIA' I?TK''IEK?CK 8H

they eW5ressed their fears about AI taOing over the music industry. 
The controversy surrounding AI a55lications in music is still intense
(Lose5h, 2023).
A future where the ma1ority of music is AIkcreated isnpt too far
away.  Playlists could be generated based on what style of music we liOe
and what tasOs we are doing.  Eoing to the gymq  AI has a brandknew
5laylist with songs it 1ust created for you.  ?eed soft classical music
while cooOing dinnerq  Thirty seconds later, you have a brandknew
album to last you for the neWt three hours.  Music will become somek
thing custom and unizue to each of us.
Co5yright is a tricOy area when it comes to AIkcom5osed music.
  The famous record label, 9niversal, urged S5otify and A55le Music to
sto5 selling AIkgenerated music and sto5 anyone from stealing original
content to train AI.  It is not 1ust 9niversal.  The entire music industry
is urging streaming 5latforms to 5revent AI from stealing songs.
This is only one of the several arguments regarding intellectual
5ro5erty that could threaten the ra5id growth of generative AI.  Music
generators can create convincing clones of famous artists liOe Ranye
Fest.  G5enAIps LuOeboW has been used to create music in styles similar
to Klvis, Raty Perry, and NranO Sinatra, and it was almost lifekliOe.
Thousands and thousands of hours of recorded material are used
to train AI systems, and most of these are taOen without eW5licit
5ermission from the owners.  AI research labs assume their actions
are covered by the jfair usej eWem5tions under American law because
an AI model is jtransformative worO,j which does not com5ete with
the original material.  But this is a huge, huge gray area.  And original
creators feel di:erently.
4ecently the Erammys announced that while jAI music and conk
tent can be submitted to the Erammys for consideration, the awards
will only go to humans who contributed to the 5iece. Nurthermore, in
D0 R4IS BA''

the songwriting and 5erformance categories, the 5iece has to be mostly

written and 5erformed by a human for the worO to be considered for
a Erammyj (Grti , 2023). The new rules highlight the industryps taOe
on AI music human involvement is 5aramount.
12

Art vs. AI

O ne of the most signicarnt aontvodevsies toyru is the Ase of Iw

to genevrte imrges rny rvtkov,p often kithoAt the levmission
of the oviginr. avertovs S wmrge genevrtovs sAah rs btrD.e MijAsion rny
—iyFoAvneu hrde Deen Aseyxov vrthev misAseyxto averte rvtkov,s
Drsey on yrtr tr,en fvom sto.en rvtp rny the Asevs hrde Deen lrssing it
oj rs theiv okn 
bAah imrge genevrtovs r.so genevrte fr,e imrges thrt .oo, so a.ose
to the ver. thing thrt it is hrvy to yisaevn if theu rve fr,e S Tov e-rml.ep
the divr. imrge of the lole kerving r stu.ish khite lAjev Fra,et krs
avertey Du —iyFoAvneu 
Whese genevrtide rvt Iws hrde vrisey hAge ethiar. aonaevns vegrvying
rvtistia aoluvight rny oknevshilp kith so.iy ediyenae thrt some Iw
lvogvrms rve tvriney on yrtr fvom imrges thrt hrde Deen Asey kithoAt
levmission ov lrument S Whis .ey to a.rss?ration .rksAits 
Phrt e-rat.u arn the Iw yoK
Rvogvrms .i,e —iavosoft Mesignev .et uoA vel.rae lrvts of imrges
kith Iw?genevrtey imrgesp sAah rs vel.raing the Dra,gvoAny Dehiny
YE BLwb 5I22

r levson kith r sAnnu Derah S UoA arn eden evrse leol.e fvom imrges
r.togethev S 2i,e rn e-?Doufvieny 
MI22?q is rnothev imrge genevrtion lvogvrm thrt avertes imrges
fvom lvomlts 
wn the HBp theve rve e-aeltions sAllovting Iw .rDs tvrining moye.s
Drsey on imrges tr,en kithoAt levmission S Whe inte..eatAr. lvolevtu
.rk krs Alyrtey to r..ok .egr..u raGAivey aoluvightey mrtevir. to De
Asey non?aommevair..u fov Iw veservah S Whe veservah arn then De
.egr..u Asey to tvrin moye.s fov aommevair. Ase khi.e sti.. Denecting
fvom aoluvight e-aeltions 
zokedevp too.s hrde Deen yede.oley to lvoteat rvtistia kov,s fvom
Deing sto.en Du Iw S Whe Diggest e-rml.e is ".r'ep r lvogvrm thrt Ases
r a.or,ing teahniGAe to lvedent rn imrge genevrtov fvom raaAvrte.u
vel.iarting rn rvt stu.e 
wndisiD.e krtevmrv,s rve mr,ing rn entvu rs ke.. S Hn.i,e vegA.rv
disiD.e krtevmrv,sp khiah arn De vemodeyp indisiD.e krtevmrv,s rve
hiyyen in the imrges rny rve thAs hrvyev to slot rny vemode S I
Tvenah strvtAl ar..ey CwmrtrgC hrs yedisey r so.Ation to lvoteat imrges
Du emDeyying indisiD.e krtevmrv,s thrt ki.. not yisrllerv eden if the
imrges rve vesi'ey ov avolley S Wheu r.so hrde tvra,ev oltions to tvra,
the imrges on.ine to mr,e sAve theu rve not veAseyp aolieyp ov sto.en S
Is .rks rny vegA.rtions vegrvying Iw rve fovmeyp indisiD.e krtevmrv,s
ki.. Deaome move aommon 
"oog.e is r.so vo..ing oAt r nek fertAve thrt ki.. r..ok Asevs to
vedevse?servah imrges rny yetevmine khethev Iw avertey them S Wheve
ki.. De rn oltion ar..ey "About this image” thrt ki.. tr,e uoA to the
soAvae of the imrge S "oog.eNs Iw?genevrtey imrges ki.. hrde r Made
by AI trgp .etting Asevs yijeventirte Detkeen ver. rny fr,e imrges S
Onae this fertAve is ve.erseyp othev Iw servah engines rny genevrtide
Iw ki.. .i,e.u fo..ok sAit 
 WO—OLLOPNb ILWwTw3wI2 w8Wq22w"q83q Y0

Whe .ine Detkeen Iw rny oviginr. aontent is Deing D.Avveyp rny it is

rn ongoing Drtt.e 
wn fratp blrkning Iw avertey r site ar..ey kkk haveibeentrained
 aomp kheve rvtists arn cny oAt if theiv rvtkov,s hrde Deen Asey to
tvrin Iw genevrtovs S Odev –( mi..ion imrges keve vemodey fvom btrD.e
MijAsion thvoAgh olt?oAt veGAests Du rvtists S qightu mi..ion might
seem .i,e r .rvge nAmDevp DAt it tAvns oAt to on.u De rDoAt thvee
levaent of the totr. yrtrset ) FAst r yvol in the DAa,et S 3Avvent.up odev
tko Di..ion imrges rve in the 2IwO8 yrtrset Asey Du btrD.e MijAsion
1Bemlevp E(E0J 
OlenIw is fo..oking r simi.rv voAte to averte r lvo?aoluvight dev?
sion of 3hrt"RW to ensAve avertovs rve lriy fov theiv kov, if theiv
aontent ov stu.e is Asey 
Getty Images vs. Stability AI
"ettu wmrges hrs tr,en .egr. ration rgrinst the avertovs of btrD.e
MijAsion rny btrDi.itu Iw rs lrvt of theiv esar.rting .egr. Drtt.e S wn
theiv .rksAitp "ettu wmrges raaAsey btrDi.itu Iw of dio.rting theiv in?
te..eatAr. lvolevtu vights S Whe stoa, imrge aomlrnu r..egey thrt btr?
Di.itu Iw i..egr..u sto.e 4E mi..ion imrges fvom theiv yrtrDrse kithoAt
aonsent ov lrument in rn rttemlt to DAi.y r aomleting DAsiness S Whis
infvingement e-tenys to Doth aoluvight rny tvryemrv, lvoteations
he.y Du "ettu wmrges 
Whis .egr. yislAte is the .rtest yede.olment in the ongoing aon;iat
Detkeen Iw rvt genevrtov avertovs rny the vights?ho.yevs S Iw?yviden
rvt too.s veGAive rvtkov,p lhotogvrlhsp rny rnu i..Astvrtion to tvrin
yrtr S Tov thrtp theu often savrle the intevnet to cny aontentp most of
the time kithoAt levmission fvom the oviginr. avertovs 
"ettu rnnoAnaey the .egr. lvoaeeyings it hry initirtey rgrinst btr?
Di.itu Iw in the zigh 3oAvt of 6Astiae in 2onyon S zokedevp it vemrins
to De seen if the a.rim hrs Deen sevdeyp rny "ettu wmrges yiy not slea?
YV BLwb 5I22

ifu rt thrt time khethev theu intenyey to lAvsAe .egr. ration kithin
the Hnitey btrtes S
btrDi.itu Iw is r.so aonfvontey kith rnothev .rksAit in the Hnitey
btrtesp r.ong kith —iyFoAvneu9 these keve c.ey Du rvtists see,ing r
a.rss?ration .rksAit 
Iaaovying to aAstomrvu lvratiae in the HBp "ettu wmrges sent
r .ettev Defove ration to btrDi.itu Iw 2imitey on 6rnArvu 4  S Wheu
veGAestey r veslonse kithin r aAstomrvu time fvrmep khiah btrDi.itu
Iw 2imitey ra,nok.eygey veaeiding S 2egr. e-levts sAggest thrt the
arse lAt fovth Du "ettu wmrges is stvongev thrn the .rksAit c.ey Du the
rvtists S zokedevp theu krvn thrt lveyiating the oAtaome is imlossiD.e
in this Anfrmi.irv .egr. rver 
I aoluvight .rkuevp Irvon —ossp sriy thrt "ettuNs nek aoml.rint
krs frv sAleviov to the odevverahing a.rss ration .rksAit yisaAssey
erv.iev S —oss emlhrsi'ey thrt the foaAs shoA.y De on indestigrting
aoluvightey imrges yAving the inlAt strge fov yrtr tvrining S ze De?
.iedes this Drtt.e odev friv Ase ki.. De intvigAing 
—ossp kho lAD.ishey the fA.. aoml.rint on his D.ogp high.ightey
the aontvrsting foaAs Detkeen the lotentir. a.rss ration .rksAit rny
"ettuNs aoml.rint S Whe a.rss?ration .rksAit foaAsey move on the hrvm
yone to the rvtists Du the dio.rtion arAsey Du the Iw too.sp khi.e
"ettuNs arse foaAsey on the .ra, of aomlensrtion fov imrge Ase S wt is
kovth noting thrt "ettu hrs .iaensey its imrges to othev Iw genevrtovsp
emlhrsi'ing the frat thrt btrDi.itu Iw i..egr..u sto.e its imrges kithoAt
aonsent 
Whe aoluvight infvingement rvgAments high.ightey in the .rksAit
ki.. emlhrsi'e the Hb friv Ase vegA.rtionsp khiah r..ok aoluvightey
aontent to De Asey in sleaica sitArtions S Whe sADFeat of Ctvrnsfov?
mrtide AseC ki.. r.so l.ru r ditr. vo.e S Whe GAestion is khethev btrD.e
MijAsion genevrtes oAtlAt yijevent enoAgh fvom the yrtr Asey to
 WO—OLLOPNb ILWwTw3wI2 w8Wq22w"q83q YY

tvrin it S Iaaovying to veservahp the softkrve oaarsionr..u memovi'es

some imrges rny arn lvoyAae e-rat vel.iars of those imrgesp DAt those
rve vrve 1 inaentp E(E0rJ 
"ettu wmrges hrs ryyitionr..u vrisey r tvryemrv,?ve.rtey rvgA?
mentxbtrD.e MijAsion is ,nokn fov vel.iarting "ettu wmrgesN kr?
tevmrv,p khiah "ettu a.rims veyAaes the GAr.itu of theiv tvryemrv,s
Du ina.Aying the krtevmrv, on the IwNs rDso.Ate.u Di'rvve rny of?
ten hiyeoAs imrges S zokedevp the arse is e-leatey to lvogvess s.ok?
.u S —oss arAtioney thrt sinae it krs c.ey in the Mistviat 3oAvt of
Me.rkrvep the FAyges tuliar..u tr,e ) months to yeaiye rftev sAD?
mission S Whis is khu the "ettu wmrges arse might tr,e sedevr. uervs to
mr,e it thvoAgh yisaodevup FAygment motionsp rnyp edentAr..up tvir. S
—oss r.so emlhrsi'ey thrt friv Ase arses .i,e this veGAive olinions fvom
Doth the FAyges rny FAvies S 6Avies koA.y yetevmine rnu yislAtey fra?
tAr. lvoD.emsp DAt A.timrte.up FAyges koA.y yeaiye the .egr. GAestions 
Othev Iw aomlrniesp krtahing the edents Anfo.yp hrde inaovlovrt?
ey srfegArvys into theiv lvoyAat  bome on.u tvrin Iw on lAvahrsey
imrges  Othevs l.rn to lru rvtists khen theiv rvt is Asey rs inslivrtion 
Othevs l.rn to ojev lvoteation to sADsaviDevs rgrinst fAtAve aoluvight
.rksAits  One sAah aomlrnu is IyoDe  Tive;u is IyoDeNs genevr?
tide Iw rvt avertion too.  Iaaovying to the aomlrnup CPith Tive;up
IyoDe ki.. r.so De ojeving entevlvise aAstomevs rn wR inyemnitup
khiah merns thrt IyoDe koA.y lvoteat aAstomevs fvom thivy?lrvtu
wR a.rims rDoAt Tive;u?genevrtey oAtlAtsC 1—i..evp E(E0J 
Whis merns thrt IwNs fAtAve in rvt rny mAsia is rmDigAoAs S w yonNt
see Iw?genevrtey rvt going rkru S wn fratp w sAsleat thrt Iw ki.. on.u
aontinAe to gvok in the avertide rvts kov.y yeslite r.. the .rksAits 
13

Script and Video

Generation

N owadays, many creators on YouTube and TikTok use AI to

generate video scripts.  One of these examples is Syllaby, which
helps to search for topics in the user's relevant industry and creates
video scripts based on those topics that are most likely to go viral. 
This tool is made for content creators, social media managers, and even
lawyers to save time on creation.
Another tool is Steve.ai, which allows users to create videos and
animations.  This tool makes it easier to create promotional campaigns
for salespeople, marketers, etc.
It takes little to generate new content for your social media accounts
now that many similar tools are popping up.  In a way, it is helpful
when you need to maintain a brand image or promote products and
services.  The goal is to save creators time and energy, allowing them
to focus on other aspects of their content.  The generators do not
just save time; they also provide a kickstart to content ideas that the
creators might have yet to think of.  The AI-generated scripts also help
 TOMORROW'S ARTIFICIAL INTELLIGENCE 57

with search engine optimization or SEO, including keywords that

could help the video rank higher in search results.  Overall the result is
more content, faster content, and a larger audience. 
Of course, there are some downsides to using script generators. 
Critics argue that it can lead to generic or formulaic content lacking
the unique voice and perspective of the creator.  In an article by Em-
pire, a writer for Black Mirror tried to have ChatGPT write an episode,
but it was terrible.  All the AI did was take the generic plots from
some of the other episodes and combine them into one (Williams,
2023).  For a series known for looking at the dark side of advancing
technology, it was a :tting plot twist to have advancing technology fail
epically. 
The failure highlights an important lessonV It is important for cre-
ators to use these tools as a starting point and still infuse their own
creativity and personal touch into the :nal product.
Syllabi and Steve.ai are just two examples of the many AI-powered
tools that are changing how content is created.  While they may not be
for everyone, they are proving to be a valuable resource for TikTok and
YouTube creators looking to streamline their workUow and develop
fresh content ideas.
An AI voice tech making waves is Meta's KoiceBox. According to
Meta's website, KoiceBox is the :rst text-to-speech model to synthesize
speech across several languages and perform tasks like content editing
and background noise removal. Its implications in :elds like audio-
book narration, radio, and, of course, marketing are vast.
Video Generation
8sers can create videos using images and words with the assistance
of çaiber AI, a cutting-edge AI-powered video generator.  It is an
exceptional tool for individuals seeking to produce high-quality videos
eıortlessly.  It oıers speed, simplicity, and enjoyment in its utilization. 
5J çRIS BALL

Technical skills and prior experience are optional for this platform; all
users require is their imagination and creativity.
It is no surprise that çaiber AI has gained signi:cant popularity.  It
caters to musicians by providing tools like Spotify Canvas for creative
expression, inspires artists, supplies materials for producers, and of-
fers a delightful experience for futurists.  Furthermore, the developers
continuously work to incorporate new features that cater to the desires
of their users.  Recently, they introduced a feature that simpli:es video
editing, adding to their existing trend feature for creating video art
from images.
The video generation process entails speci:c time considerations. 
Style previews may take up to 30 seconds to develop, while the :nal
rendering of videos can require several minutes or even hours, de-
pending on their length.  çaiser AI is actively working on reducing
processing time through various means.
çaiser AI eliminates the need for expensive equipment, professional
performers, or elaborate sets, enabling users to create captivating and
realistic :lms.  With the aid of çaiber AI, even individuals with limited
experience can generate professional-grade video content.  Famous
artists such as Linkin Park, çid Cudi, Mike Shinoda, and others have
used AI to create music videos (Elia9Dk, 2023).
The arti:cial intelligence behind çaiber AI empowers users to ef-
fortlessly produce stunning visualizations based on their own pho-
tographs or textual descriptions.  By uploading a song and selecting a
theme and aesthetic, users can witness the creation of a custom music
video that unfolds before their very eyes.  8sers can also direct the
camera's movements to enhance variety and extend the duration of
their :lms.
GliaCloud oıers text-to-video services in English, Chinese, and
apanese.  It has hundreds of templates to make video creation easy. 
 TOMORROW'S ARTIFICIAL INTELLIGENCE 5

Other text-to-video AI apps include Gencrat, InKideo, and KEE

.IO, among many, many others.   Every day new AI apps are released
for users to purchase and utilize.  
Imagine AI reading this book and then generating a book cover to
match without the need for a graphic designer to be hired.  Further-
more, AI can then make a promotional video for this book.  Forget
spending hundreds on an advertising company.  
14

The Future of
AI in the Job
Market

W here does the job market stand in the future, with AI taking
over so rapidly?  What will happen when AI handles content
creation, writing, coding, and many other tasks in a fraction of the
time humans take?
Like how the internet changed how fast information could be de-
livered to us, AI will change how fast that information is created. 
The slow, mundane tasks of basic coding can be eliminated.  Research,
writing, designing, preparing, making charts, graphs, art, outlines,
summaries, notes… AI can automate any part of a job that some con-
sider time-consuming or tedious.  The Cnal project, be it a book, app,
presentation, song, or travel itinerary, will be completed faster.  Thus,
AI speeds up content creation.
According to an outplacement Crm Ghallenger, &ray " Ghristmas
report, 5Around %M of 'ayOs job cuts were directly related to artiC-
 TS'SRRSWOF ARTINIGIAL IET6LLI&6EG6 1(

cial intelligence5 V2edantam, 030)x.  This number is only eqpected to

increase, and AIOs unprecedented growth is rapidly reshaping the job
scene.
A :uick litmus test to see if your job is safe is to ask this :uestion·
Gan artiCcial intelligence do what I do for a living? 
é         If the answer is Oyes,O it is time to dust oY and update your
resumH. 
é         If the answer is Osome,O it is time to learn the AI apps that assist
in the parts of your job it can do and master them.  Ftay ahead of the
curve. 
é         And if the answer is Ono,O then your job is safe.   
'ake no mistake, if a computer application can do a job over time,
businesses will embrace it.  It is simple economics.  ;ou do not have
to pay wages to a software program.  ;ou do not have to pay health
beneCts or deal with –R issues.  As the old eqpression goes, itOs not
personalB itOs business.  Almost all companies are in the business of
making money.  The ones that donOt are the eqception, not the rule. 
And they are vastly outnumbered.                
AI might take over some jobs, but it will also pave the way for new
ones. This is true of just about any advancement in technology. When
computers arrived, many jobs changed 9 some were lost completely.
7ut many, many more jobs were created.
There is this belief that a Cnite number of jobs and work eqists. This
belief is sometimes called the OLump of Labor Nallacy.O The fear is that
when AI takes our jobs, there will be nothing left for humans. The
truth is that technology has always created more jobs. The number of
jobs is not Cnite 9 with technology, it is eqponential.
The World 6conomic Norum states that KD million jobs will emerge
by 030%. Eot surprisingly, many of these new jobs are related to the
development and maintenance of AI.
10 PRIF 7ALL

–ere are the top ten jobs that are increasing in demand·

- Uata analysts and scientists

- AI and machine learning specialists
- 7ig Uata specialists
- Uigital marketing and strategy specialists
- zrocess automation specialists
- 7usiness development professionals
- Uigital transformation specialists
- Information security analysts
- Foftware and application developers
- Internet of Things specialists

Sn the other hand, the jobs that are decreasing in demand are·

- Uata entry clerks

- Administrative and eqecutive secretaries
- Accounting, bookkeeping, and payroll clerks
- Accountants and auditors
- Assembly and factory workers
- 7usiness services and administration managers
- Glient information and customer service agents
- &eneral and operations managers
- Ftock-keeping and material-recording clerks

4nsurprisingly, the jobs on the rise are around AI, and the ones
losing demand are the jobs AI can do. Who needs an auditor when AI
can do that for free? Who needs a secretary when AI can do most of
that work?
 TS'SRRSWOF ARTINIGIAL IET6LLI&6EG6 1)

It has been said that AI will not take jobs. Instead, people who
understand how to use AI will be the ones who take the jobs. I believe
this to be absolutely true. If you want to be employable, learn about
AI. 4se it, read about it, and stay up-to-date on it.
Reassurance
Nor those worried about their jobs in things like coding or ghost-
writing, although AI has advanced rapidly, its scope is still narrow, and
most of it re:uires human oversight and input to work correctly.
The percentage of jobs (33M automated by AI will be incredibly
low. This is due to a variety of factors. Fome of it concerns technology
development regarding implementation, optimi ation, and mainte-
nance costs. Eot to mention the fact that AI is facing many cultural,
legal, and political hurdles at the moment. While things are happening
rapidly with AI, the job market is always several steps behind. If you
are worried about your current job 9 you have time. Time to change
and adapt, learn and grow.
Nor the most part, AI will never entirely replace workers but rather
automate speciCc tasks to help them. The impact of AI that replaces
jobs will also vary from country to country, between industries, and at
diYerent education levels.
Already governments are working to enact policies that enhance
and value human labor and help workers who have been displaced
from their jobs transition into new careers. This will be important
moving forward.
There are still jobs that re:uire human eqpertise, like G6Ss, car-
penters, nurses, lawyers, etc., that re:uire emotional and social in-
telligence, human creativity, and critical thinking, which AI lacks.
AI does work based on training data, so it does not have the same
understanding as a human to handle these jobs - yet.
1 PRIF 7ALL
15

The COVID Effect

C OVID has turned the world upside down since it started, forc-
ing people into quarantine and working in their homes. At
yrst, the transition from phjsical obce work and classroom sessions
to work-at-home SoPs and online classes took a Pit of work.
Echools and workplaces needed to adSust to the changes. veople did
not take long to adapt to the new lifestjle, and work-at-home SoPs
soon Pecame the norm. HTen now, as workplaces open Pack up, there
are still manj work-at-home SoPs.
KoweTer, with AI on the rise, some work-at-home SoPs are at risk
of Peing automated.
Eome SoPs, like farming, housing, or anjthing COVID considered
essential workers, might Pe safe from AI for now. HTen that is unpre-
dictaPle.
Automation was Pound to make manj SoPs oPsolete, and COVID
accelerated that progress. During the pandemic, roPots were deplojed
to clean airports. Companies closed down. Call centers replaced agents
with chatPots. Rhis kind of automation has Peen on the rise for
decades. Rhe onlj diBerence now is that COVID sped up the process
 L6IE MA  

to such a degree that people did not haTe much time to process and
transition into new SoPs. Rhe lockdowns had a signiycant impact on
the liTelihoods of people. oTing forward, AI maj disrupt things once
again.
16

AI's Impact
in Different
Sectors

H ealthcare

One day AI will be able to deliver quicker and more accu-

rate diagnoses, personalized treatments, and better patient outcomes.
By harnessing the power of machine learning, we can analyze massive
amounts of data like genetic information, medical images, and health
records to uncover patterns and develop innovative therapeutic ap-
proaches.
Recent developments in AI have occurred across various areas, such
as robotic-assisted surgery, personalized treatment, drug discovery,
and patient monitoring through virtual assistants. There may be a
possibility for even more incredible breakthroughs in the future of AI,
revolutionizing medicine and providing enhanced care for patients.
68 KRIS BALL

This means that while AI impacts healthcare, it is still a very safe job
xeld to enter. AI will enhance this industry, not replace it.
Education
AI has become an invaluable tool in education, empowering teach-
ers, students, and educational institutions to streamline tasks, enhance
learning eEperiences through visual aids, and improve accessibility.
The future of education will be characterized by personalized learning
and creating interactive and engaging environments.
Cmphasizing the practical application of knowledge will lead to
safer laboratory eEperiments, while readily available facts and infor-
mation will reduce the need for rote memorization.
The overall educational landscape will benext when we witness the
evolution and incorporation of AI in the classroom setting.
Transportation
AI is paving the way for autonomous and self-driving vehicles.
Although fully autonomous vehicles are not yet widely available, there
are ongoing advancements in improving navigation systems and op-
timizing traWc Mow, leading to safer and more convenient transporta-
tion options.
'ompanies like Tesla and Faymo have made progress in au-
tonomous vehicle technology, pushing the boundaries of innovation.
AI oNers increased eWciency and sustainability, addressing conges-
tion, reducing emissions, and minimizing accidents. There are endless
possibilities ahead as AI continues to develop.
It is not just autonomous vehicles but intelligent traWc manage-
ment systems as well. AI has the potential to revolutionize the way we
travel entirely.
Customer Service
AI is delivering personalized and eWcient eEperiences.
 TOGORROF9S ARTIPI'IAL IVTCLLIHCV'C 67

Through AI-powered solutions like chatbots, VL0, and virtual as-

sistants, companies can provide prompt responses and enhance cus-
tomer satisfaction. 'hatbots, available around the clock, will handle
customer inquiries swiftly, resulting in reduced response times and
increased customer happiness.
The future of customer service will simplify query resolution and
improve overall interactions. Yoice-activated assistants and predictive
analytics will reshape how businesses engage with their customers,
making the eEperience seamless and personalized.
This automation means fewer jobs will be available for people
working in this industry. This is one of those 9danger zone9 jobs.
Marketing
AI presents a transformative opportunity in marketing, enabling
precise targeting and tailored strategies. AI allows businesses to reach
their audiences with precision and timeliness by leveraging predictive
models and customer behavior analysis. Yoice search optimization and
augmented reality will play a prominent role, and innovations such
as fraud detection and FhatsApp chatbots will enhance customer
service by reducing the need for human intervention.
The ability to create content tailored to individual consumers will
only increase with AI. Yideos, ads, and clickbait will become faster
with less need to hire artists, writers, voice actors, etc.
To stay ahead of the curve, people in the marketing job xeld must
embrace AI and incorporate it into everyday workMows.
Human Resources
AI can automate daily human resource tasks like screening candi-
dates, onboarding, and evaluating performances. 'hatbots and virtual
assistants could eWciently address employee inquiries, alleviating the
workload for "R professionals. By streamlining hiring and employee
management processes, AI drives eWciency and eNectiveness. It also
#3 KRIS BALL

unlocks opportunities for innovation, promotes improved employee

engagement, and fosters growth within organizations.
"owever, "R will always need a human element. AI will only assist
this job xeld, not replace it.
Banking
In the banking sector, AI delivers automated customer service,
enhanced fraud detection, and risk management. Gachine learning
algorithms can analyze vast datasets so that banks can gain information
about customer behavior, investment opportunities, and risk assess-
ment regarding credit. This advancement in AI technology simplixes
access to products and services. Prom chatbot-powered interactions to
robo-advisors, AI transforms how individuals engage with banks and
xnancial institutions.
Like other industries, those who want to get ahead should learn and
master the AI tools available in this sector. Banking can be cut-throat,
so staying ahead is paramount.
Religion
One area many people might not think AI would encroach upon is
religion.
4et, in a recent tweet by Antonio Yieira Santos, /"undreds attend
1 AI church service in Hermany. The 'hatH0T chatbot led more
than –33 people through (3 minutes of prayer, music, sermons, and
blessings./ In theory, like creative writing, a church service can be
generated by AI. It follows a typical pattern, and a theme can be strung
together using Bible verses, songs, and messages. It could even be a
powerful sermon and eEperience for those in attendance. That being
said, many religious believers think that the message and theme should
be divinely inspired. The pastor2preacher2priest should pray about
what to instruct on and follow Hod9s prompt.
 TOGORROF9S ARTIPI'IAL IVTCLLIHCV'C #)

I am sure thousands of religious leaders have relied on others9 mes-

sages in a pinch when divine inspiration failed to appear to them. Por
those who believe in Hod, "e can use anything to turn hearts and
improve lives D even artixcial intelligence. So, the idea that AI has
entered into the religious realm is not that strange after all.
But it is not about to replace religious leaders. Sheep need a shep-
herd, not a computer program.
Archeology
AI is not just about what is new but what is very, very old.
Vasca lines are gigantic geoglyphs etched into the 0eruvian desert
thousands of years ago. Over the millennia, erosion and time have
made some of these ancient wonders invisible. Fith the help of AI,
three new Vasca lines have been discovered, paving the way for AI9s
role in archeology Loe er, 3 – .
AI can be utilized in various ways to xnd things once lost to the
sands of time. Ancient cities can be detected using Li AR and other
technology. Aided by AI, it can /learn/ what to look for based on com-
binations of topography, predictable weather patterns, and historical
teEts. AI can string together the pieces across time and distance to
uncover what we did not know eEisted.
Additionally, Australian researchers are using AI to analyze cave
paintings and rock art. The programming helps archeologists detect
faded or barely-there paint from rock surfaces. Pinding what once was
hidden so that it can be enhanced and studied, will help shed light on
parts of our history thought lost to time "atxeld, 3 – .
This is one of the most eEciting xelds AI can impact. It will boost
interest which in turn will boost funding. I foresee growth in arche-
ology and look forward to future discoveries.
Section 3

100 Years from Now

17

Robotics

W e all wonder what the world will look like a hundred years
from now.
Will it be a dystopian future like we see in the movies? Will the
future be glled with cyin, AarsI coatin, AitiesI neon li,htsI and T' all
around? -he movies usually portray a world where humans are ruled
by a totalitarian ,overnment and T' robots have taken over almost
everythin,.
TlternativelyI there may be a future where todayMs problemsI like
hun,erI a,in,I diseaseI pollutionI and warI are thin,s of the past.
Robotics and the Future
TrtigAial intelli,enAe Aould lead to an inArease in interaAtions beN
tween humans and robots. Kany industries already have assistant roN
bots workin, alon,side humans and performin, tasks like testin, and
assembly. -hey have brou,ht a new level of eRAienAy in manufaAturN
in, and Austomer serviAe. TdvanAements in T' ,ave robots the ability
to mimiA humansI and robots that behave more like people inte,rate
more eSeAtively into the workforAe. BeverthelessI this teAhnolo,y still
has a lon, way to ,o before beAomin, more humanNlike.
"x L7'4 zTEE

-he T' software that has been proliferatin, now mi,ht help make
better robots in the future.
With T' powerin, the robotsI they better understand their surN
roundin,sI Aan reAo,niHe and identify patterns and Aomprehend data.
-hese enhanAements inArease the robotMs autonomy.
Oven thou,h jrobotiAsj and jT'j are often used interAhan,eablyI
it is essential to note the diSerenAes. 7obotiAs involves AonstruAtin,
and pro,rammin, maAhines Aapable of autonomous task eFeAution
without human intervention. Tt the same timeI T' foAuses on systems
desi,ned to repliAate human Ao,nitive proAessesI enablin, learnin,I
problemNsolvin,I and independent deAisionNmakin,. 't is hardware vs.
software.
-hese teAhnolo,ies Aan si,nigAantly improve our livesI even in areas
of eduAation and household mana,ement.
Cumanoid robots revolutioniHe personaliHed learnin,I while
AloudNAonneAted robots streamline everyday tasks like Aleanin, and
Aookin,. 7obotiAs and T' Aan be AruAial in addressin, Alimate Ahan,eI
ener,y sustainabilityI and AompleF healthAare issues. zy harnessin,
these advanAementsI we Aan eSeAtively taAkle these problems headNon.
-hey promise to automate mundane and repetitive tasks that AurN
rently dominate our daily routines. -his automation liberates valuable
time and ener,yI enablin, us to pursue more Areative and fulgllin,
endeavors.
-hanks to improved sensor teAhnolo,y and maAhine learnin,I roN
bots are no lon,er rote maAhines. Gne hundred years from nowI they
will be Ao,nitive Aollaborators. -he tra5eAtory of robotiAs is movin,
upwardI and the geld will si,nigAantly benegt from these strides. 4oon
enou,hI we Aan eFpeAt more sophistiAated robots to be adopted into
our livesI workin, alon,side humans.
-GKG77GWM4 T7-' ' 'TE 'B-OEE' OB O "
18

Preparing for
the Future

A ccording to ResumeBuilder, there will be a rise in demand for

candidates who know ChatGPT.
In a survey conducted by the job site: 1,187 business leaders, in-
cluding CEOs, executives, owners, and partners, were asked about
their opinions on the AI chatbot. The majority of the respondents
were currently hiring. The study found that 91% of the hiring business
leaders were interested in hiring workers with ChatGPT experience.
Among them, 30% were doing so urgently, and two-thirds believed
that these skills could provide a competitive advantage to their (rms
M2ok, )0)3'.
The respondents believed that OpenAIWs ChatGPT could enhance
productivity, save time and resources, oSer creative and technical sup-
port, and improve the companyWs reputation. They also felt that work-
ers with ChatGPT experience could teach their colleagues, enhancing
the bene(ts of AI.
 TO2ORROFWL ARTINICIAH I$TEHHIGE$CE 77

According to Ltacie 5aller, the chief career advisor at Resume

Builder, candidates with ChatGPT and AI skills will be highly sought
after by progressive companies M2ok, )0)3'. Lome companies will
pay up to q33z,000 annually to hire prompt engineers with no tech-
nical background. As ChatGPT courses are available online, 5aller
encourages workers to take advantage of the tutorials to gain an edge
in hiring. According to instructors, knowing how to use ChatGPT is
considered the skill of the future.
Nor students, the skills necessary for success in todayWs workforce in-
clude analytical and interpersonal abilities and pro(ciency with tech-
nology. Regardless of their chosen (eld, all students should strive to
develop these generalist skills to prepare for an ever-changing future.
Those in declining industries must undergo a signi(cant reskilling
and transition eSort, while those in growing (elds must focus on up-
skilling and continuous learning. Online learning oSers a level playing
(eld for workers of all education levels to acKuire new skills Kuickly.
5owever, it is not solely the responsibility of individuals to navigate
this new terrain. Governments must provide resources and a roadmap
to support workers through safety nets, care systems, and job centers
while investing in skill systems and partnerships to drive change at
scale. Employers must also invest in reskilling and upskilling, prior-
itiée safety and well-being, foster diversity and inclusion, and take a
skills-(rst approach. By taking these actions, employers can close skill
gaps faster and enhance loyalty, productivity, and motivation. Fhile
the future of work may be disruptive, it can also be an opportunity to
prioritiée people in the new global economy.
The most important thing to remember is that AI is a tool. Anyone
who can wield this tool will be incredibly valuable at (rst, just like
the people who (rst developed 2icrosoft Ford or way back when the
typewriter was (rst invented. Adoption is the key to staying a oat in
78 RIL BAHH

the modern world. Rather than fear AI, we could make it a point to
learn about it instead. Practice it, master it, and add it to your resum .
Technology is meant to make work more accessible and meaningful,
not eradicate human laborWs value.
19

Improved Search
Engines

G oogle has been the reigning search engine in the world for more
than two decades now, and it is a go-to for everyone. It has even
become a response to any question when we do not know the answer:
"Just Google it."
Times have changed, and AI has been introduced into many things,
including search engines. Many AI-powered search engines have been
developed, like Neeva AI, Komo AI, and You.com, among others. To
level the playing Beld, Microsoft has developed zing AI, an improved
chat search that aims to provide better results for any questions you
might have without the hassle of browsing through several search
results. The chat is user-friendly and summariSes millions of search
results to get you the best possible answer for your query.
The AI search engine has performed well enough for 3amsung to
consider switching its search engine from Google to zing. That switch
might result in a loss of over R billion dollars for Google.
0O KLI3 zA88

'ut of a "panic," Google has rushed to develop zard, an AI search

engine of its own.
zard is still being worked on, but Google aims to build a search
engine that anticipates customersC needs. They also intend to inte-
grate AI into their services and products, like Dhrome, Google —rive,
Gmail, etc. 3o while its products may be new, with the power and
funding that Google can provide, I see great things in its future.
Google also announced the latest AI language model in the
worksP2a8M 4Pto challenge 'penAICs G2T-j.
2a8M 4 vows to be better at reasoning and mathematics. It can
also generate specialiSed code in various programming languages. This
move came when Microsoft developed zing AI. It was not Eust Mi-
crosoft that spurred the change.
xvery one of GoogleCs rivals had raced to develop AI features in
search engines and productive tools after DhatG2TCs e–ponential suc-
cess.
In the future, Google might develop enough search engines to
anticipate usersC needs and modify searches accordingly. Instead of a
million search results, it might display ten of the most relevant search
results that might be precisely what you need.
AI-assisted search engines will be everywhere ( even space. NA3A
is developing a DhatG2T-like system to help astronauts on the up-
coming 8unar Gateway space station )—ent, 4O4RH. 8etCs Eust hope
they do not name it FA8.
'verall, the race to put out AI applications to keep up with com-
petitors is usually a win for consumers. Fowever, with AI, there is a
risk. 2ushing code into production before it has been thoroughly and
wholly tested can be a mistake. Dapitalism is usually a good thing.
Wor consumers, it usually means more options and cheaper prices. It
drives innovation. zut with artiBcial intelligence, a slower pace might
 T'M'LL'1C3 ALTIWIDIA8 INTx88IGxNDx 0

be safer. 'nly time will tell what impacts this rush with AI will cost
us.
'ne hundred years from now, it might not matter. The bugs
created today will be B–ed. The mistakes will be dealt with. The future
releases of zard, DhatG2T, and others will be corrected for the items
lacking in their Brst few versions.
20

Education
Overhaul

N othing can ever replace the presence of a teacher. For millions

of kids, it is not just about the educational aspect. Teachers
oCer a human connection that is important for development. OVIDy
has taught us that manw kids do not do -ell in a strictlw online enviM
ronment. Aanw kids need that oneMonMone presence. xD -ill never take
a-aw teaching. Dt can, ho-ever, make the jobs of teachers easier and let
them focus on more critical areas.
Collaboration Between Teachers and AI
xrtizcial intelligence alreadw eRists in education through tools that
help develop skills. The hope is that as xD continues to evolve, it
-ill aid in zlling the gaps bet-een learning and teaching and enable
teachers to do much more. Dt can streamline and personaliWe education
for diCerent grade levels -hile teachers provide adaptabilitw and unM
derstanding. Teachers can help students adjust to xD and provide their
eRpertise -here machines fail. This collaboration bet-een teachers
and machines can provide the best outcome for students.
 TVAV''VSLE x'TDFDODxG DNT8GGD38NO8 YK

No-adaws, top jobs -ant to hire candidates -ith xD eRpertise, and

schools should start incorporating xD subjects into their curricula. Dn
a recent Ne- qork Times article, "han Gab Echool has begun incorM
porating xD into its curriculum. Shen students have math Uuestions,
before asking a teacher, thew can use a chatboR on their computer
to ask the Uuestion of "hanmigo, an xD designed as a tutor. ("han
Gab Echool students are among the zrst schoolchildren in the 2nited
Etates to trw out eRperimental conversational chatbots that aim to
simulate oneMonMone human tutoring 0Einger, )1)K%. 2ndoubtedlw,
xD -ill be incorporated into manw online or hwbrid computer eduM
cation teaching models in the neRt fe- wears. Eince OVIDy, manw
schools moved to more computerMaided educational plans. 8ven as the
OVIDy restrictions lifted, the changes to manw of the curriculums
-ere forever altered. Vften it is more costMeBcient, and it can oCer a
cheaper solution in areas -here budgets are tight.
Dn the distant future, onlw the fanciest and most eRpensive schools
-ill oCer 411? inMperson learning. Vne daw -hat -e consider the
norm -ill be luRurw.
Individualized Learning
8verw student reUuires learning based on their needs, -hich has
al-aws been paramount for teachers. xD can provide individualiWed
and diCerentiated learning that teachers -ho manage K1 or more stuM
dents in one classroom -ould znd nearlw impossible to achieve. Aanw
companies, like Oarnegie Gearning, are developing digitiWed platforms
that use xD for learning, testing, and providing student feedback. xs
time passes and xD becomes more sophisticated, it could eventuallw
have the abilitw to read a studentLs eRpression, zgure out if that student
is struggling -ith a subject, and modifw lessons according to their
capacitw.
Y: "'DE 5xGG

Vne daw xD tools can make global classrooms accessible to all, across
diCerent languages, and to those -ith hearing or visual impairments.
This maw also open up opportunities for students -ho cannot attend
classes because of some illness. xlternativelw, it maw be an option
for students -ho learn things at a diCerent rate than others and maw
reUuire special attention. Dt opens up possibilities for students -ho
-ant to learn a particular subject that maw not be available in their
schools.
Echools can also have a facilitw -here students can have Iirtual 'eM
alitw 0I'% headsets and have their lessons taught directlw to them bw xD
avatars thew have designed. 'ecesses, lunch breaks, and assemblies can
still be open to encourage socialiWing, but the majoritw of education
maw not be -ith the teacher.
Administrative Tasks
xnother area -here xD is helping out and making a change is
education administration. xD can assist in student support. Dt can
analwWe student performance data and determine -hich students maw
be struggling in their studies or even in social activities, allo-ing the
administrators and educators to take action and help out the students
in need.
This can improve the studentsL performance, nurture their learning,
and create a more positive environment at school.
x signizcant portion of a teacherLs time is spent grading tests and
home-ork. Shat if xD can intervene and simplifw these tasks -hile
sho-ing ho- close the gaps are in learning/ xt the moment, there are
alreadw machines that can grade multipleMchoice tests, and -ith some
development, thew could also grade -ritten responses.
Echools present manw logistical challenges -ith schedules, cleriM
cal -ork, and budgets. xD might assist -ill all these tasks, leaving
 TVAV''VSLE x'TDFDODxG DNT8GGD38NO8 Y–

educators to be just that educators. Shen administrative tasks are

automated, it frees up time for teachers to spend time -ith students.
Dmagine a school -here students are matched -ith the best teacher
based on teaching learning stwles. Eoon students -ill be partnered
-ith other kids on projects based on the compatibilitw of strengths
and -eaknesses. Olasses and electives can be recommended based on
personalitw twpes and interests guiding students into jobs that -ill
make them happw, not just productive.
21

Cybernetics

H uman-machine hybrids and intelligent robots, also known

as cyborgs, have long been central concepts in pop culture,
appearing in Tlms like Mhe xatriB, Rlade Iunner, and ., IobotU Yntil
recently, the notion that these robots would someday occur only eB-
isted in science TctionU Aet what was once science Tction has rapidly
migrated into real-world applicationsU
" Teld where biology and technology are combined is called Wcy-
berneticsUW fe already have prosthetic limbs, but cybernetics takes it
up a notch and improves the Eunctionality oE artiTcial limbs through
technologyU
Darlier in this book, an eBample was given oE how a hu-
man-brain-computer interEace has been used therapeutically to treat
paralysisU .n the Euture, ". will only continue to address neurological
problemsU Peep brain stimulation electrodes have been used to coun-
teract the e'ects oE OarkinsonSs diseaseU .n the Euture, such technology
can give humans abilities they do not usually haveU .n other words,
human enhancementsU .n addition to OarkinsonSs disease, cybernetics
 MFxFIIFfSC "IM.L.N."G .8MDGG.7D8ND qj

can help those with motor-neuron diseases or strokes by giving them

control over their bodiesU
Ietinal implants can help blind people see, and advanced auditory
implants will help deaE people to hearU Mhe technology could give
(uadriplegics and paraplegics - especially disabled war veterans - a new
lease on liEeU
Nybernetics can also aid in cell and tissue regenerationU
Ctem cells are the Eundamental units oE the human bodyU Dvery cell
originates Erom them beEore taking on a distinct Eorm and EunctionU
Ctem cells can replace diseased or damaged tissues, saving many livesU
Lor eBample, leukemia patients could have a bone marrow transplant
in which stem cells are introduced into their blood to generate healthy
cellsU Nlinical trials are ongoing to test the ability oE stem cells to treat
illnesses and in)uries that previously could not be treated KCybernetic
cells, nUdU U
Ccientists have made Eascinating discoveries about the mechanisms
and communication networks within cells that control the cell re-
generation processU Mhey also discovered that electronic components
inserted in genetically modiTed cells could increase communication
pathway regulation and cell regeneration e ciencyU Fver the past Eew
years, researchers have used stem cells to create human tissues and
organ-like structures in the laboratory, Tnding the ideal conditions Eor
each tissue type to allow them to come togetherU
However, over the neBt decade, we might see the creation oE cy-
bernetic cells, which can be programmed to sense, adapt, and act
on their environment and allow them to aid the bodySs Eunction to
Tght diseasesU Mhey could also communicate with eBternal devices,
blurring the lines between biology and technology and enhancing the
Eunctions oE healthy cellsU
qq I.C R"GG

Cuch creations oE new cells challenge our perception oE what it

means to be humanU Nybernetics could pave the way to a new Euture
and endless possibilities, but it also raises many ethical and moral
concerns that should be consideredU
Fther hurdles eBist, too, including the saEety and e'ectiveness oE
implanted electronic components and their long-term impact on the
human bodyU
22

De-Aging with AI

E ven though aging is a natural process, not many welcome it.

Many people feel it is a never-ending disease that gets worse

over time. Older people often experience a lot of unpleasant problems
that come with aging, like weaker bones, hearing and vision loss, and
memory problems. Not to mention wrinkles and saggy skin.
Retirement and money troubles can worsen things, leading to neg-
ative emotions and feelings of helplessness.
That is why there is much interest in anti-aging research. AI can
help develop tools that predict how people will age. With machine
learning and deep learning, scientists can generate synthetic mole-
cular and patient data to identify new biological targets and create
compounds that could help protect people's brains. AI can also help
researchers Knd biomarkers to help develop new treatments.
One of the ways AI can do this is by looking for patterns in existing
medical data and processes. Researchers can use algorithms to develop
new ways to control the aging process. AI can aid gene therapy, which
involves removing harmful genes that could cause disease in the future.
The technology can also help researchers Knd the most valuable genes
0 SRIB LA99

and avoid harmful ones. Bcientists are also working on brain chip
implants and neural links that help with sensory and motor signals lost
due to aging.
Bomeday, aging might be a thing of the past.
23

Optimized
Logistics

M any companies are turning to AI to improve operations in

the logistics industry. AI has proven its remarkable ability
to automate inventory management, order processing, route opti-
mization, and other essential processes. Organizations can streamline
supply chain operations and enhance ewciency fhile reducing costs.
Inventory Management & Optimization
One ox the most eTtensive uses ox AI in logistics is inventory man-
agement.
jhis allofs companies to automatically track stock levels and ad&ust
K replenish based on customer demands. jhis eliminates the need
to track inventory manually and lofers labor costs fhile ensuring
products are alfays available to meet customer needs. AI can lead
to xaster and more ewcient deliveries, xefer order processing errors,
and higher customer satisxaction. AI can personalize customer rec-
ommendations based on purchase histories, fhich can help businesses
gain a competitive advantage.
2' RSIB LA99

jechnology—s beneCts are substantial in logisticsDimproved per-

xormance, cost-eqectiveness, and real-time shipment tracking. 7om-
panies must also consider the potential hurdles that come fith im-
plementing AI, including privacy, inxrastructure compatibility, and
integration fith eTisting systems. Organizations must address these
hurdles eqectively to make the most ox AI.
Incorporating AI into logistics brings fith it a lot ox challenges
and advantages that need to be addressed, such as data security and
privacy and the costs that come fith setting up and maintaining the
inxrastructure. 0ata storage fould re5uire much investment, and
companies fould need to strictly adhere to regulations to preserve
and protect sensitive customer inxormation. 7ompanies fould also
need to consider the Cnancial re5uirements xor maintaining AI-based
systems. AI is not cheap.
jhese challenges should not deter companies xrom eTploring the
possibilities ox AI. Ly addressing the issues, companies could beneCt
xrom an improved system and logistics that are more eqective and
saxer.
Alleviating World Hunger With AI
jhe total population is eTpected to increase to 2.U billion by 'NWN,
and the 18 has farned that fithout sustainable fays to produce and
distribute xood, the forld might xace fidespread hunger and xood in-
security. Forld hunger has alfays been one ox the biggest problems in
society. AI may potentially tackle this issue that—s been raging xorever.
Enhancing crop yields: Bcientists are creating nef crop varieties
that are resistant to eTtreme feather, disease, and pests fith the help
ox AI. jhese crops re5uire less fater and xertilizer. A xantastic eTample
ox this fould be the development ox drought-resistant fheat using AI
in 'NEG, fhich could beneCt xarmers in drought-aqected regions.
 jOMOSSOF—B ASjI3I7IA9 I8j 99I 87 2

AI-pofered systems can provide xarmers fith recommendations

on the kind ox xertilizer to use and fater usage levels based on data
on soil composition, feather patterns, and other xactors. jhis allofs
xarmers to maTimize their yields fithout fasting time or resources.
Minimizing food waste: An estimated one-third ox the forld—s
xood production gets fasted bexore reaching consumers. jhis
amounts to E. billion metric tons ox xood annually. jhis occurs
mainly during transportation, fhere perishable goods spoil bexore
reaching their destination. jo tackle this problem, AI-pofered sensors
can monitor the condition ox goods during transit and notixy suppliers
ix their condition is going bad.
Optimizing food distribution: 3ood must be distributed ew-
ciently to those in need. jhis is the biggest challenge in regions that
need more inxrastructure. Inewcient xood distribution is precisely
fhat leads to large amounts ox xood being fasted and millions ox
people going hungry forldfide.
AI can help optimize xood distribution netforks and provide better
access to xood in underdeveloped areas. 3or instance, AI can predict
xood demand and direct supplies accordingly. AI can also identixy
areas fith a higher risk ox hunger and then direct resources to those
areas.
24

Love and AI

M ovies like Ex Machina and Her (among many others) touch

on the topic of falling in love with arti.cial intelligenceW
bhile we are still a long way o, from love AotsI one company is already
cashing in on RT companionshipW Beplika has a new app that uses
chatAots as Firting companionsW 'he Slush app is meant to get shy
people into the dating scene Ay having them practice with RTW ?or a
feeI the chatAot will respond to sexual conversationsW Tt Arings the term
Odigital datingO to a new levelW –oonI more and more apps like it will hit
the marketW
bhat does this mean for the future of dating and relationships-
Cn the surfaceI it seems like a good thing L helping shy people get
out of their shellsW TnsteadI it technically reinforces the idea that they
can remain introvertedW Cften it is the human sexual desire that forces
many to interact sociallyW bith that need Aeing satis.ed digitallyI some
people might never feel the need to leave the house againW
CneNsided love from a chatAot (and one day a roAot) is not a real
relationshipW Tt roAs people of true companionship and human conN
nectionW
 'CMCBBCbO– RB'T?TGTR9 T5'E99TjE5GE 10

Sut my opinions on the suAzect do not matterW 'he future is comN

ingI and there will always Ae a market for sex with any new technolN
ogyW bith phonesI there were PN1…… numAersW bith televisionI it was
pornographic moviesW Sefore thatI photography led to maga"ines like
3layAoyW
'hen came the internetY RT will Ae no exceptionW Tn the next P……
yearsI preachers will Ae preaching aAout a new kind of sexual addiction
that people need to avoidW
RTOs presence in dating and relationships is rushing upon us faster
than anyone anticipatedW Slush isnOt the only love assistant out thereW
'easer RT is an arti.cial intelligenceNinfused dating appW Sefore users
swipe left or rightI they can chat with the RTI which impersonates the
likeness of the potential matchOs personalityW bant more RT involveN
ment than that- 'eleport is an RT app that will review your personality
and .nd a match against others on the appW ?or a feeI it will provide
RTNassisted personality matches per weekW ourMoveWRT will help
you write a dating pro.leI Firt and reply to potential matchesW bith
so many new and creative ways to incorporate RT into the search for
romanceI the dating game will never Ae the sameW
25

Solving Health
Concerns &
Disparities

A I has been used in many industries to make work easier and

more streamlined and solve many problems. The question is
whether it can be used to solve all societal problems similarly.
AI is not a cure-all for the biggest shared problems in our world, but
it could provide suggestions, answers, and resources to help solve the
diSculties and bring positive results. zeveral big-name companies have
teamed up with non-proKt organiCations to solve social, economic,
and environmental issues by investing in AI to improve diversity and
sustainability.
Microsoft and Diabetic Retinopathy Detection
H. xhandrasekhar of India founded a company to Kght preventable
blindness. Mowever, he encountered a massive hurdle in the form of
e'pensive equipment that was rare to Knd. Therefore, he approached
Oicrosoft, knowing that the tech giantRs AI could assist in creating
 TWOWFFWLRz AFTINIxIAE IGT9EEI79Gx9 BZ

cost-e—ective and portable eye-scanning devices. OicrosoftRs AI is aid-

ing physicians in providing speedy diagnoses, and the impact can be
felt on a broader scale, particularly in India, where the number of
diabetic retinopathy cases has been growing e'ponentially.
IBM vs. Zika
I"ORs zcience for zocial 7ood initiative partnered with the xary
Institute of 9cosystem ztudies to signiKcantly contribute to combat-
ing the spread of the jika virus. The research team utiliCed two mod-
elsUmultiple imputations and "ayesian multi-label machine learn-
ingUto provide a risk score for primate species that are likely to carry
the virus and possibly transmit it.
I"O will provide its technology and resources to support a promi-
nent research company, the Wswaldo xruC Noundation or (NiocruC,(
aSliated with the "raCilian Oinistry of Mealth. NiocruC plans to utiliCe
I"ORs technology to analyCe a wide range of information, such as
human travel patterns and observations shared on social media.
In addition, I"O is making notable progress on its Wpenjika pro-
2ect using a crowd-sourced supercomputer called the (Lorld xom-
munity 7rid.( The pro2ect empowers scientists from the 0z and "raCil
to scan millions of chemical compounds and search for potential
drugs to Kght the virus 1Feuters zta—, 6)8%5.
Thanks to these machine learning models, the team could accu-
rately identify which species carried the disease with an accuracy rate
of 36 . They also created an interactive map highlighting the spots
where people are most susceptible to catching the virus. This break-
through could not have been achieved without the help of AI.
Google & Prenatal Health
Another area 7oogle and AI have attempted to tackle is obstetrics
and perinatal health. Across the globe, prenatal health is one of the
areas that need advancement.
B3 HFIz "AEE

Lorldwide, maternal mortality rates are e'ponentially high, result-

ing in the deaths of around 6BP,))) women during and after preg-
nancy in 6)8Z. Oany of these deaths could have been prevented if the
women had received proper care.
Mowever, low-resource settings often face challenges accessing es-
sential prenatal care, including ultrasounds, primarily due to a short-
age of adequately trained healthcare professionals.
To address this issue, 7oogle partnered with Gorthwestern Oed-
icine to create and test AI models that allow ultrasound operators to
accurately identify and recogniCe any potential health problems and
risks, like fetal positioning. The ob2ective was to develop and test AI
ultrasound applications to make them more widely applicable.
Facebook and Blood Donation
Nacebook has been actively promoting the use of AI for social wel-
fare, with a particular emphasis on India. Wne of its most notable
initiatives involves the development of a blood donation tool to link
potential donors with local hospitals and blood banks and assist indi-
viduals in Knding blood donation events, camps, and requests.
The blood donation feature quickly gained popularity, with over
JP million individuals signing up to become donors. As the platform
grew, so did the technical comple'ities associated with it, requiring
the aid of AI. Lhenever a Nacebook user posts about donating blood,
AI identiKes the content, recogniCes it, and then messages the person
or organiCation and informs them about the feature, inviting them to
participate.:
Project Relate
7oogle recogniCes the challenges individuals face with non-stan-
dard speech in e—ectively communicating with others. Dro2ect Felate,
an Android application developed through e'tensive AI research, is a
valuable tool for enhancing communication ease for these individuals.
 TWOWFFWLRz AFTINIxIAE IGT9EEI79Gx9 BB

It o—ers features such as speech-to-te't transcription, synthesiCed voice

playback, and integration with 7oogle Assistant, empowering them
to engage in diverse tasks ranging from playing music to turning the
lights on and o— 1OalcCyk, 6)6J5.
7oogle AI product manager 4ulie xattiau recently unveiled Dro2ect
Felate, which emerged from the (Inventors at 7oogle( initiative.
xattiau e'plained in her post that Dro2ect Felate represents the
culmination of years of research conducted by 7oogleRs zpeech and
Fesearch teams. The development of this app was made possible
through the collaboration of countless participants who recorded over
a million speech samples, which formed the foundation of their re-
search e—orts.
Dro2ect Felate is still in its developmental phase. 7oogle actively
seeks volunteers to test the software, preferably 9nglish speakers from
the 0nited ztates, Australia, xanada, and Gew jealand. Testers are
requested to read a series of phrases, contributing to creating a lan-
guage model that can adapt to each userRs unique speech patterns.
The core features of Dro2ect Felate revolve around three key func-
tionalities (Eisten,( (Fepeat,( and (Assistant.( The (Eisten( feature
enables real-time speech transcription, allowing users to copy and
paste the te't into other applications conveniently and allowing others
to read along with the spoken words.
(Fepeat,( as the name suggests, repeats the userRs speech using a
clear and comprehensible voice, ensuring e—ective communication
during conversations. The (Assistant( feature enables direct interac-
tion with the 7oogle Assistant, empowering users to carry out various
tasks, such as controlling smart home devices.
Throughout the development process of Dro2ect Felate, 7oogle
sought guidance from individuals with speech delays, including their
employee, Audrie Eee, a brand manager a—ected by muscular dystro-
8)) HFIz "AEE

phy. Eee, who plays a crucial role in 7oogleRs marketing team for new
products, contributed to the naming of Dro2ect Felate. Fe ecting on
her personal e'periences, she e'pressed, (I am accustomed to perple'ed
e'pressions when people struggle to understand me. Dro2ect Felate
can make the di—erence between confusion and warm recognition.(
The introduction of Dro2ect Felate signiKes a signiKcant stride in
making virtual assistants more accessible to individuals with atypical
speech patterns.
Hatie eighton of the Lall ztreet 4ournal stated that 7oogle has
been dedicating additional resources from their substantial reserves
to enhance the capacity of their ambient computers to comprehend
non-standard speech patterns.
Apple, for instance, has tried to understand the physiological as-
pects of speaking and their relevance to individuals with speech im-
pediments, as evidenced by the inclusion of speech pathologists on
their ziri team.
EchoSpeech
zimilar to Dro2ect Felate, 9chozpeech glasses are a piece of wearable
technology that detects facial movements and translates them into
commands. (Nor people who cannot vocaliCe sound, this silent speech
technology could be an e'cellent input for a voice synthesiCer. It could
give patients their voice back( 1Fuidong, 6)6J5. eveloped by xornell
0niversity Fesearchers, the technology could also be used for those
without speech impediments (in places where speech is inconvenient
or inappropriate like in a noisy restaurant or a quiet library.(
Learables are a hot topic among futurists. The idea of wearing a
device that will one day replace smartphones is alluring. Dhones can
be lost or dropped, or stolen. "ut a waterproof band or temporal
attachment would be far less likely to su—er any of those fates. Wne
 TWOWFFWLRz AFTINIxIAE IGT9EEI79Gx9 8)8

day we might control AI technology with our eye movements, facial

e'pressions, or with our thoughts.
MIT and Lung Cancer Early Detection
The Oassachusetts Institute of Technology in xambridge is testing
its new AI tool called zybil. The program looks at xT scans and notes
changes often undetected by human eyes. As a result, (it has been
shown to accurately predict whether a person will develop lung cancer
in the ne't year 3%-B   of the time( 1Wuyang, 6)6J5. zince the best
way to treat cancer is to detect it early, researchers in "oston are paving
the way for better cancer survival.
Lith the help of AI, health diseases and disparities are being ad-
dressed in a variety of ways. Wne day it may even eradicate them from
society. Wne day cancer, blindness, jika, and so many other health
concerns might be something we only read about in history books.
26

Wildfires

T wo major players are making an impact on one of the most

damaging natural disasters: wild.resA
Stanford and WildersG
Iv has proben to &e highly balua&le in many crisis situations as well
as search - rescue missions when it comes to natural and manSmade
disastersA I research team at 2tanford debeloped a deepSlearning modS
el in 0,0, that tracks fuel moisture lebelsW which can help in predicting
wild.res that aUect the xestern 32A
The team employed an Iv system that can identify patterns in e9S
tensibe datasetsA The researchers trained the model with three years of
data cobering 0zG sites across xestern ImericaA The output probided
&y the model was integrated into an interactibe mapW which aided .re
departments in prioritiOing their responsesA
gooDls and Wilders csts tion
Moogle has debeloped an Iv model through the use of satellite
imageryW which is then capa&le of detecting wild.re &oundaries in
realStimeA These are then displayed on searches and mapsA They sucS
cessfully used the model and recently aided local residents and .reS
 TR'RFFRxC2 IFTvLvNvIE v1T(EEvM(1N( ),z

.ghters across the 32 and NanadaA They habe since e9panded their
eUorts to 'e9ico and some selected regions of IustraliaA
Iccording to MoogleCs &logW Moogle introduced a ground&reakS
ing wild.re &oundary map on 2earch and 'aps 2R2 alertsW abaila&le
across the 3nited 2tatesA This update aims to probide deeper insights
into areas aUected &y continuous wild.resA vn the face of these inferS
nosW accurate information a&out the .reCs location and how to steer
clear of danger is bitalA vndibiduals can now get an estimate of wild.resC
siOe and appro9imate location right on their smartphones or desktops
q'alcOykW 0,0z"A
xhen users search for a speci.c .reW they will get a result with
an appro9imate &oundary of the wild.re and its name and locationA
Moogle also probides additional resourcesW such as news articles and
useful information from local emergency serbicesW all in the 2R2 alert
so that users will habe all the essential details at their .ngertips to stay
informed and safeA
3sers will also habe access to detailed information and the .re
&oundaries within Moogle 'apsA vf they happen to &e heading toward
an actibe wild.reW they will receibe a warning to steer clear of the danger
OoneA vf they happen to &e in an area near the wild.reW they will receibe
an alert on Moogle 'apsW which will then guide them to the latestW
most recent updatesA
Moogle uses the power of the 1ational Rceanic and ItmospherS
ic IdministrationCs q1RII" MR(2 constellation of satellitesW comS
&ined with Moogle (arth (ngineCs adbanced data analysis capa&ilitiesW
to display the siOe of a libe wild.reA This data is refreshed ebery hour to
make sure users stay upStoSdateA 1RIICs satellites are eKuipped with
specialiOed infrared and optical sensors that can eUectibely detect those
wild.re Bhot spotsB on the (arthCs surfaceA
), 4Fv2 PIEE

xhen the IppleW ine MulchW and MriOOly .res eruptedW Moogle
swiftly identi.ed the rapid e9pansion of the wild.res and the e9acS
er&ated conditions caused &y e9treme drynessA They launched 2R2
alerts on their search enginesW mapsW and the latest &oundaryA
Moogle .rst used its Iv wild.re feature during the Nalifornia wildS
.res to ensure it was adeKuate for .rst respondersW emergency manS
agement personnelW and the communityA
27

Flooding

F loodHub

Google unveiled a cutting-edge platform called 'FloodHub'

aimed at precisely delivering .ood forecastsT hwis platform e,ectively
swoxcases twe speciAc areas and timings vulnerable to .oodingI ensur-
ing valuable information reacwes individuals and enabling autworities
to provide practical assistanceT
Google was ekpanded its 18-poxered .ood forecasting services to
encompass a remarLable S2 countries across 0atin 1mericaI 1fricaI
and "outweast 1siaT 8t is xortw noting twat twese wigwly regarded .ood
forecasting services xere initially launcwed in 8ndia in W—S2 as part
of Google's commitment to safeguarding communities against twe
devastating e,ects of natural disastersT
53e also use 18 to forecast .oodsI anotwer ektreme xeatwer pattern
ekacerbated by climate cwangeT 3e've already welped communities to
predict xwen .oods xill wit and wox deep twe xaters xill get M in
W—WSI xe sent SS( million .ood alert notiAcations to WD million people
over Google "earcw and )apsI welping save countless lives5 KReanI
W—WWBT
S—C 6z8" q100

hwe searcw engine giant furtwer revealed twat its engineers wad uti-
liNed a sopwisticated 18 tecwniEue called transfer learning to overcome
twe wurdle of limited data availabilityT 8n additionI Google unveiled twe
launcw of Google FloodHubI an innovative platform designed to vi-
sualiNe and disseminate .ood-related information on a global scaleT 1s
part of tweir future plansI Google intends to integrate twis crucial .ood
information directly into Google "earcw and )apsI enabling a broader
audience to access vital safety resources during .ood emergenciesT
FloodCube
1notwer 18 getting into twe .ood detection marLet is Flood9ubeI a
 orxegian climate start-up tecwT 0iLe FloodHubI Flood9ube's mis-
sion is to prepare communities for .oods xitw macwine learningT
8t cruncwes data to predict .oods xitw 5meter-scale accuracyT5 hwe
.oods in uropean countries in W—WS tooL twe lives of W— people
KGescwxindtI W—WDBT 8n countries often wit ward by .oodingI liLe qel-
gium and GermanyI Flood9ube can be literally life-savingT
28

Addressing
Other Societal
Concerns

A mnesty International and Element AI—Fighting Abuse

Amnesty International started an initiative called the Troll

Patrol Project, taking a team of human rights researchers, technical
experts, and thousands of online volunteers to identify abuse against
women online with the help of AI. They collaborated with a global AI
software company called Element AI. The results of the (ndings were
startling, showing the scale and nature of the abuse women have faced
online. The reports also provided the engineers and researchers with
resources to explore the potential of machine learning in controlling
and moderating content online K2otorchevikj, 010)C.
Dell and the Great Barrier Coral Reef
According to WomputerDeekly.com, 'ellUs deep learning model
is being used to support coral reef conservation in Australia. -nR
)1G 2SIB LA88

derwater images captured by everyday divers and snorkelers on the

3reat Larrier Seef are uploaded, given geographic ocean regions, and
then assessed for damage KTan, 010OC. Thousands and thousands of
images would be impossible for humans to review, so AI assistance is
instrumental. znce areas of damage are identi(ed, the conservation
team can begin to repair and save the impacted area. Dithout the aid
of AI, it would take too long to make sense of the data and respond.
It is a realRtime response to a threat to one of the worldUs most priFed
habitats.
Google & Pest Infestations
Infestations threaten cotton and food crops, devastating farmers
and the livelihoods of those dependent on agriculture. In collaboraR
tion with Insta'eep and the Nood and Agriculture zrganiFation of
the -nited —ations, 3oogle improved the detection of locust outR
breaks in Africa, facilitating the implementation of e%ective control
measures. An AI company in India6Dadhwani AI6helped create
an AIRpowered application that assists in identifying and treating pest
infestations. This innovation has resulted in an impressive 01H reducR
tion in the use of pesticide sprays and also marked a 0MH increase in
the farmersU pro(t margins.
Dith the help of AI, one day, there may be a future where pest
infestations no longer threaten humans or crops.
De can see signi(cant impacts on societal issues with AI from a
variety of companies. These include optimiFing crops and redistribR
uting food, resulting in a future where starvation and world hunger
are eradicated. There could be a future where climate change is staved
o%, natural disasters like wild(res and 9oods are prevented, and disR
eases are eradicated before they become pandemics. ealth dispariR
ties are identi(ed earlier, treated faster, and do not go on to become
lifeRthreatening problems.
Tz zSSzDUB ASTINIWIA8 I—TE88I3E—WE )1
Section 4

The Downside
29

The Darkside of
ChatGPT

T here will always be deep-seated fears about AI, most of which

are brought on by the dystopian representations we see in
movies and books. While most of those fears are unfounded, AI is not
perfect. There are plenty of examples in the here and now to cause
concern.
Despite its advanced capabilities, ChatGPT has its limitations. Its
weaknesses and downsides may aSect its performance, reliability, and
accuracy. Home of the limitations of ChatGPT include not under-
standing contexts and specijc situations, especially when they are
complex, and its tendency to rely on biased data. :ere is Eust a short
list of areas where the chatbot lacksq
● Human-level common senseq Kven though ChatGPT can gen-
erate human-like responses and access massive amounts of data, it still
does not have common sense at the human level. It also lacks the
knowledge we have, which means it tends to spit out nonsensical or
inaccurate responses to specijc Ruestions.
FFz BLIH 1A22

● Emotional intelligenceq Despite its empathetic responses, the

chatbot does not possess emotional intelligence. It fails to detect subtle
cues and give appropriate responses to complex emotional situations.
● Understanding contextq The chatbot fails to understand con-
text, especially sarcasm and humor. It might be projcient in language
processing, but it still struggles to grasp the nuances of communica-
tion. 0or example, if a human were to use sarcasm or humor, the AI
usually fails to pick up the intended meaning.
● Multi-taskingq The AI only works best when you give it a single
task.
If it is made to work on multiple tasks, it fails to prioritiYe them,
decreasing accuracy and reliability.
● Biased responseq Hince ChatGPT is trained on a large dataset,
that dataset might contain biased opinions or preEudices, which could
lead to the AI generating eRually biased or oSensive information.
● Limited knowledgeq Kven though ChatGPT has access to mas-
sive amounts of information, it still does not have all the knowledge
humans have, and its data has only been trained up until zOzF. It may
not be aware of niche topics or recent trends. It may also not be aware
of developments that have happened after zOzF.
● Lack of Cne-tuningq Mou may need to jne-tune the AI if you
want to use it for specijc cases, which means you will need to train
the model on a specijc dataset in order for it to perform better on a
particular task. This training can be time-consuming.
● omputational costsq ChatGPT is a highly sophisticated AI
language model that needs a lot of vital computational resources to
work at its full potential.
Lunning the model can be expensive and might reRuire a uniRue
set of hardware and software. If the chatbot is run on low-end sys-
tems with limited computational power, it can lead to slower pro-
 T'N'LL'W3H ALTI0ICIA2 IJTK22IGKJCK FF(

cessing times and inaccuracy, hindering performance. The limitations

of ChatGPT can lead to severe conseRuences. Its tendency to cook
up false and incriminating information has sometimes led to false
allegations against individuals and even lawsuits.
In an article by The Washington Post, a law professor named
Vonathan Turley received a worrying email saying that ChatGPT had
accused him of sexual harassment. A fellow lawyer in California who
was conducting a research study asked ChatGPT to list all those legal
scholars who had sexually harassed someone. And among the names
on the list was Turley &)erma 8 'remus, zOz(". ChatGPT had ac-
cused Turley of making sexually suggestive comments and attempting
to touch a student during a class trip to Alaska. It backed these claims
by citing a nonexistent zOF4 article by The Washington Post. Turley
had sometimes asked for news stories to be corrected whenever they
displayed false information. :owever, this time, no Eournalist or editor
was available for him to contact and rectify these allegations. :e found
it 5chilling5 and thought such allegations were 5incredibly harmful.5
:is experience is only one of the many incorrect accusations per-
petrated by language bots. Their creativity can sometimes lead to
dangerous and inaccurate claims. The models can misrepresent facts
and back up their stories with fabricated sources. The spread of AIs
like ChatGPT, Nicrosoft 1ing, and Google3s 1ard has raised concerns
about how misinformation is being spread and who is responsible
when the bots mislead people. They produce information with such
Uair that it is hard to discern fact from jction.
A spokesperson for 'penAI, Jiko 0elix, said, 5Improving factual
accuracy is a signijcant focus for us, and we are making progress5
&)erma, zOz(". In fact, during the 'penAI World Tour, Ham Altman
spoke out about reducing AI hallucinations, stating, 5I think it will
take us about a year and a half to two years5 to conRuer the problem
FF BLIH 1A22

of AI hallucinations. :e believes, 51y then, we won3t still be talking

about it5 &MouTube, zOz(".
That does not help the here and now. Chatbots today use a large
pool of online content from Wikipedia and Leddit to generate re-
sponses that sound true but are not. Kven though their responses
sound conjdent, there is no reliability in them. Jumerous examples
have been reported of these tools fumbling when answering basic
Ruestions and providing fake citations.
'penAI was threatened by the regional mayor of :epburn Hhire
in Australia. :e said he would jle a defamation lawsuit against the
company unless it corrected the false claims about him serving time in
prison for bribery. Nore recently a radio host has begun legal action
against 'penAI for defamation after ChatGPT fabricated legal accu-
sations against him. As long as AI continues to have hallucinations,
the defamation cases are going to continue to pile up.
Nicrosoft 1ing and Google 1ard aim to avoid making the same
mistake and to give more factual answers, but there are still slip-ups.
All maEor chatbots now come with disclaimers. 0or example, Google
1ard comes with a message that says, 51ard may display inaccurate or
oSensive information that does not reUect Google3s views5 &)erma,
zOz(".
The study that wrongly accused Turley was conducted by a law
professor in California named Kugene )olokh. :e mentioned that the
growing popularity of chatbots is the biggest reason why scholars and
Eournalists should verify ChatGPT3s information and jnd out who is
responsible.
The Washington Post tried out the same Ruery )olokh had used on
ChatGPT and 1ing. ChatGPT3s free version declined to answer on
the grounds that it would 5violate 'pen AI3s content policy, which
prohibits the dissemination of content that is oSensive or harmful.5
 T'N'LL'W3H ALTI0ICIA2 IJTK22IGKJCK FF

'n the other hand, Nicrosoft 1ing reiterated the false allegations
against Turley and cited sources published by HA Today. ChatGPT3s
mistake about Turley led to 1ing repeating the mistake, thus showing
how misinformation can spread between AIs.
It remains to be seen who is responsible when AI generates false
content.
30

"Culturally
Inclusive" AI
Avatars & Bias

A vatars

AI companies that make AI avatars also make a diverse set

of AI avatars across races. This has already been put into practice by
Levi's. The clothing company partnered with LaLaLand.ai to create a
diverse AI avatar model for their latest campaign, but something about
the avatar seemed oW.
Mhen qichael qusandu, the founder of LaLaLand.ai, was -uesN
tioned about hiring diverse models, he said the AI is not meant to
replace real models but to let brands aWord to show oW diWerent prodN
ucts on as many bodies as possible.
A DetherlandsNbased AI company called "eep Agency started its
own OAI modeling agency.O The service allows its users to type in a
 TRqRSSRM'F ASTICIEIAL IDTGLLI1GDEG 77Z

description of what they are looking for and what they want the photo
to look like. Then they receive photos of AI models.
Fara PiW, the founder of an advocacy group known as The qodel
Alliance, says her company has a support line where models can call
and discuss any uncomfortable events they have faced on set. Lately,
calls concerning AI have started coming in. 3articularly about body
scans of the models, which brands use to create ?" replicas. Mhere
does the money earned go when brands can create AI avatars based on
real modelsj Mhen the likeness of an actual model appears in an ad
campaign, who gets paidj
The Oculturally inclusiveO avatars do not really beneBt actual diverse
people. The races being represented are not the ones being paid.
Additionally, there is concern about how unrealistic beauty stanN
dards will become when models are blemishNfree, perfect AI renderN
ings. 3eople already struggle now with comparisons to an OidealO look
that can never be attained. AI will only make this worse.
Cinally, there is concern that clothing meant for real people is modN
eled on fake AI models. It does not show an accurate representation
of what the garments will look like on humans.
All of these concerns regarding AI in modeling are Kust the start. As
more and more companies move to AI for marketing and branding
because the cost is cheaper, more issues are bound to emerge.
Bias
Garlier in this book when Avatars were discussed, the subKect of bias
came up. 8ias is something that has been a dark spot on chatbots since
the start of their rise in popularity. This stems from how LLqs are
trained. They learn from us. Gverything we post or write that ends
up on the internet has been fair game for them to learn from. Mhile
eWorts have been made to scrub negative images and language from
their training sets, bias still slips through.
77x JSIF 8ALL

In a TG" talk by (anelle Fhane talking about the danger of AI, a

great e2ample of AI bias is demonstrated. A company with a large
number of Kob applicants asked AI to screen the applications and put
forth the best ones. It learned which candidates were the best based
on previous hires. The company, predominantly male, inadvertently
taught the AI to eliminate many female candidates because in the past
that is not what the company had hired 0Fhane, 9)7– . The AI wasn't
trying to be malicious or discriminatory it was simply trying to do
what it was instructed to do. It is our history, which is full of bias, that
in uences AI programs.
31

Cheating

U sing an AI program is not plagiarism in the traditional sense.

After all, there is no original content to be checked in a pla-
giarism detector. This poses a problem for teachers and professors.
Chatbots are based on prompts. Students can feed text from various
sources to train the bot, and the AI generates results using those
sources as parameters. The results can be personalized for the writer.
Students can generate essays in a fraction of the time that it takes to
write them.
Educators insist that AI is unethical and violates the integrity of
academics. Then again, certain study aids are considered acceptable.
For example, it is perfectly okay to use the grammar and syntax check-
ing features of Microsoft Word or AI programs like Grammarly to
help write better sentence structures and to Dx errors. Google ?ocs
has a feature to Dnish sentences in drafts and emails. So, it is hard to
say where the line between using aid programs and full-on cheating is
drawn. What is helpful, and what is considered cheatingB
In a survey by 1estColleges, over 0555 undergraduate and graduate
students were polled, and over %0K of students agreed that using AI for
0P5 RLIS 1A22

exams is considered cheating and plagiarism. Those same students also

thought AI should not be prohibited in schools and colleges. Most of
these students typically use ChatGjT for personal pro'ects and ('ust
for fun( rather than for actual pro'ects 3Welding, P5P)q.
If ChatGjT can be trained to write more like a human and by-
pass most AI detectors, then how will professors detect cheatingB
ChatGjT can be Dne-tuned and trained to write pieces that sound
human-like by infusing deliberate syntax errors or awkward phrasing,
or even colloHuialisms, Dgures of speech, and other writing techniHues
to make the content sound more human-like and, in turn, bypass AI
detectors. If teachers and professors cannot prove it, how can they
punish itB
It does not help that sometimes AI detectors can falsely detect
human-written content as AI if it sounds too formal. ow can AI
detectors be trusted if they can be wrongB Is it better to allow a student
to stay in school even if they might be using AI to write papers than
to un'ustly kick out a student from college when they did nothing
wrongB Until this technology becomes acceptable in academia or AI
companies make their content easily recognizable, the issue will con-
tinue to be a stain on the technology(s reputation.
32

Deepfakes

D uring the popular ESPN documentary series "The Last

Dance," State Farm premiered a television commercial that has
generated extensive discussion and attention. The advertisement pre-
sented archival footage from 1998, featuring an ESPN analyst who re-
markably predicted events in 2020. However, it was later revealed that
the clip was not authentic; instead, it was fabricated using advanced AI
techniques. The State Farm advertisement illustrates a powerful and
potentially harmful technology in the form of deepfakes.
Deepfake technology empowers individuals possessing a computer
and internet access to create convincingly realistic photos and videos
of people engaging in activities they never did and saying things they
never said.
But it is far more unbelievable than that.
DeepBrain AI, a South Korean company, showcased a service called
Re;memory at a Consumer Electronics Show (CES) in Las Vegas. The
main aim of this service is to aid families in coping with the loss
of a loved one. It captures images, audio, and video of the person
during their lifetime and resurrects them in a virtual form known as
122 KRIS BALL

a "digital twin." This digital twin can then be engaged in conversation,

simulating a genuine interaction.
The distinctive aspect of Re;memory lies in the gradual creation of
the AI human while the client is still alive. To initiate the process,
scriptwriters conduct pre-interviews to gather life stories from the
client. Then, an interview is recorded in a specialized studio to capture
the requisite video and voice data. Finally, employing deep learning
techniques, an AI human is generated, having a visual resemblance,
facial expressions, voice, intonation, and mannerisms similar to the
client.
Following the client's passing, loved ones can engage in 30-minute
conversations with the digital twin in a dedicated showroom with a
high-de4nition sound system and a massive :00-inch screen. The
conversations revolve around four themesj reunion, memories, Moy,
and parting. By utilizing Speech-to-Text and chatbots, the deepfake
responds to questions posed by the visitors in a manner that aims to be
convincing and imbued with meaning. Re;memory's use of deepfakes
is meant to be positive. But many deepfakes blur the lines between
reality and fantasy, raising concerns about their harmful eWects and
controversies.
It is essential to acknowledge that deepfakes do possess certain limi-
tations. They cannot capture subtle nuances such as pore stretching or
the interplay of light passing along the skin's surface. Oost deepfakes
can only replicate what the underlying actor is capable of achieving.
Ghile they achieve an impressive level of authenticity, they still have
boundaries.
This technology goes beyond manipulating faces alone; it can repli-
cate and synthesize voices. The process mirrors that of facial deepfakes,
involving the analysis of audio 4les by neural networks to mimic and
reproduce vocal sound accurately.
 T5O5RR5G'S ARTIFICIAL INTELLI ENCE 123

These remarkable advancements in deepfake technology have un-

doubtedly opened up new possibilities for 4lmmakers, removing all
scienti4c constraints. The technology has also been subMect to misuse,
leading to signi4cant concerns and controversies.
From a legal point of view, deepfakes pose challenges to copyright
law.
Riana PfeWerkorn, a research scholar at the Stanford Internet 5b-
servatory, sheds light on the complexities of identifying the individ-
uals responsible for creating deepfakes, particularly when they uti-
lize existing images and videos. Distinguishing whether speci4cally
copyrighted material was employed in generating a deepfake is often
challenging.
The misuse of deepfakes goes beyond the realm of entertainment.
Instances involving the replication of political 4gures have sparked
signi4cant controversy, and the consequences of such actions can be
far-reaching. The release of a manipulated video featuring Barack
5bama using oWensive language against Donald Trump is a massive
reminder of the potential dangers associated with deepfakes. Their
misapplication can indeed pose a threat that must be carefully ad-
dressed.
In 2019 alone, around 1 ,000 deepfake videos circulated the in-
ternet, contributing to the substantial economic damages incurred
as a result of disinformation and fake news. To confront these mul-
tifaceted issues, Senate Resolution No. 188 calls for a congressional
investigation into deepfakes to monitor and regulate digital content
manipulation. This initiative seeks comprehensive solutions that go
beyond relying solely on technological advancements.
In Hollywood, organizations like the Screen Actors uild and the
American Federation of Television and Radio Artists are urging law-
makers to enact regulations protecting actors from non-consensual
12: KRIS BALL

exploitation in deepfakes. Responsible usage of deepfakes within in-

dustries can be facilitated through government mandates and proper
oversight.
Deepfakes are so deceptive that they can put unsuspecting individ-
uals at risk with a technology that has not been regulated.
In an article by The Verge, blackmailers have been using nude
pictures to extort victims. The FBI has seen an increase in situations
where criminals create deepfake pictures and videos, send them to
victims, and then try to blackmail or harass them (Vincent, 2023c).
These "sextortion" schemes are on the rise and will only worsen as
technology improves and becomes more mainstream.
33

Voice Cloning

M icrosoft has introduced an AI for voice cloning, capable of

simulating a person's voice with remarkable precision. Its
ability to commence the voice replication process with just a three-sec-
ond audio sample of the desired speaker sets it apart from other voice
cloning technology.
Voice cloning is not new. A simple internet search will produce an
extensive list of sites and apps that oTer to train AI to generate audio
that closely resembles your own voice. Fhis cloned voice can then be
employed to articulate any desired text. Oor writers, this tool proves
valuable in creating an audiobook narrated by the author without the
need for extensive recording studio sessions. Sn the other hand, voice
actors can clone their voices, renting out the AI system for projects
they cannot undertake themselves.
Fhe voice cloning process varies depending on the service. qome
re5uire reciting 0H prerecorded sentences, while others allow upload-
ing any audio clip. qome services need hours of audio in order to
train the AI, while others say they need only a few minutes. Lowever,
Microsoft's latest voice-cloning AI, VAEE-K, deRes this trend by pro-
6NG B1Iq 2AEE

ducing remarkably accurate audio based on a mere three-second voice

sample. VAEE-K does not currently support cloning one's own voice.
7evertheless, Microsoft published a research paper and created a
"itLub page where users can compare human voices with VAEE-K's
generated speech. Microsoft demonstrates how the AI can even repli-
cate the emotional tone of the speaker and the environment in the
background. Oor example, if the speaker expresses anger, VAEE-K can
generate audio that sounds angry. qimilarly, the AI can mimic the
speciRc environment if a speaker records the audio over the phone.
Fhe remarkable success of VAEE-K can be attributed to its extensive
training library, which Microsoft reveals is hundreds of times larger
than other systems. VAEE-K was trained using Meta's EibriEight, an
audio library containing a staggering GH,HHH hours of speech from over
z,HHH Knglish speakers.
If one were to revisit the list of search results for Wvoice cloning,W
it is likely that one would encounter articles detailing how these AI
systems are being misused for nefarious purposes. Kxamples include
cybercriminals cloning a boss's voice to deceive employees into trans-
ferring funds. Another example includes malicious actors cloning
grandchildren's voices in attempts to extort money from senior cit-
iJens.
Voice cloning has emerged as a signiRcant and concerning threat,
posing risks like identity theft, fraudulent phone calls, and phishing
emails.
According to a report from Fhe Call qtreet Uournal, the €KS of
a (B-based energy company fell prey to an AI-generated deepfake
impersonating his "erman boss's voice, resulting in a staggering loss
of 9NNH,HHH. Fhe scammer used AI voice technology to )awlessly
mimic the boss's accent during three convincing phone calls, success-
fully persuading the €KS to transfer funds to an account held by a
 FSMS11SC'q A1FIOI€IAE I7FKEEI"K7€K 6Nz

Lungarian supplier. At Rrst, the €KS compiled without suspicion,

but his suspicion grew when the scammer re5uested an additional
payment.
(nfortunately, the stolen funds were 5uickly transferred to a Mex-
ican bank account before being disbursed to multiple other locations.
Fhis might be the Rrst incident of voice cloning, but it won't be the
last qtupp, NH6 .
Fhis incident is a wake-up call for businesses to stay on high alert
and ensure their employees are well-informed about these fraudulent
schemes. Ourthermore, it emphasiJes the critical signiRcance of estab-
lishing robust security measures and delivering thorough training to
shield against such fraudulent activities. Alongside its achievements,
this rapidly advancing technology also introduces a set of challenges
and risks, particularly in the realm of security.
Cith the rise of deepfake videos and AI-generated content in the
digital landscape, discerning truth from falsehood has become an in-
creasingly di cult task.
34

The Cost of
Training AI

O penAI's endeavor to eradicate toxicity in ChatGPT led them

to employ Kenyan workers, as revealed by an investigation
conducted by TIME.
GPT-3 demonstrated an impressive ability to construct coherent
sentences. However, it sufered Wrom a tendency to produce violent,
sexist, and racist remarks. This can be attributed to the AI being
trained on an extensive dataset comprising billions oW internet-sourced
words, which served as a vast reservoir oW human language. Shile this
training dataset granted GPT-3 exceptional capabilities, it also proved
its most signiqcant liability. Rince certain sections oW the internet har-
bor harmWul and biased content, it posed a considerable challenge to
purge these elements Wrom the training data.
Even with a team oW hundreds oW human reviewers, manually siWting
through this massive dataset would have reFuired decades oW efort.
Only by developing an additional AI-powered saWety mechanism
could OpenAI hope to control and eliminate harmWul content, cre-
 TOMOLLOS'R ALTINICIA1 I2TE11IGE2CE 90U

ating a chatbot suitable Wor everyday use. To create a detection system

Wor toxic content, OpenAI collaborated with an outsourcing qrm in
Kenya called Rama, starting in 2ovember 0"09. It became apparent
that a substantial portion oW the text originated Wrom the internet's
darkest corners, Weaturing graphic descriptions oW illegal and sexual
activities.
Rama operates Wrom Ran Nrancisco and employs workers in Kenya,
5ganda, and India to label data Wor esteemed clients such as Google,
Meta, and MicrosoWt. Rama labels itselW as an $ethical AI$ company,
claiming to have signiqcantly contributed to upliWting over z","""
individuals out oW poverty. The data labelers engaged by Rama on
behalW oW OpenAI received remuneration ranging Wrom approximately
(9.30 to (0 per hour, depending on their experience and perWormance.
One Rama worker tasked with reading and labeling text Wor OpenAI
shared his experiences, saying he sufered Wrom recurring visions aW-
ter encountering a graphic description oW illegal sexual activity. The
worker described it as an agoni)ing experience.
In order to mark the text as saWe or unsaWe, the workers had to
personally go through the most traumati)ing and brutal accounts oW
assault and abuse, graphic pornography, and illegal activities. Nor hon-
est, sincere individuals such as them, witnessing this kind oW content
caused a devastating emotional and mental impact on them that was
almost scarring.
The work was so traumati)ing that it eventually led Rama to termi-
nate their collaboration with OpenAI in Nebruary 0"00, eight months
earlier than planned. The emotional toll was too overwhelming Wor the
human staf BPerrigo, 0"03j.
The story oW the workers responsible Wor enabling the development
oW ChatGPT ofers insight into the overlooked aspects oW the AI in-
dustry, which play a crucial role in ensuring the saWety and widespread
93" KLIR A11

adoption oW AI systems. It suggests a tendency to downplay the de-

pendence oW AI on a cheap labor Worce and hides the darker side oW the
cost oW training this billion-dollar tech.
An OpenAI spokesperson conqrmed that Rama employees in
Kenya actively contributed to developing a tool designed to identiWy
and address harmWul content, a component subseFuently integrated
into ChatGPT. They emphasi)ed that this work served the broader
goal oW removing harmWul data Wrom the training datasets oW tools
like ChatGPT. The spokesperson expressed OpenAI's commitment
to ensuring that artiqcial general intelligence beneqts humanity as a
whole, and they diligently work towards building saWe and beneqcial
AI systems that minimi)e bias and harmWul content. ClassiWying and
qltering harmWul text and images is essential in reducing the presence
oW violent and sexual content within training data and establishing
efective mechanisms Wor detecting and addressing such content.
This narrative sheds light on the challenges and conseFuences oW
developing AI systems. ehind the glit) and glamor oW AI, there exists a
reliance on hidden human labor that is oWten sub ected to exploitation
and harm. Shile we use chatbots Wor personal use and to answer Fues-
tions, we should know what goes into designing these systems. The
price oW making them saWe Wor us to use comes at the cost oW eliminating
the darker sides oW humanity sprawling across the internet. The cost is
steep.
35

Sports Betting

S ports betting has long been a pastime enjoyed by individuals

worldwide, ocering a fhanfe to win money by affurately -ore.
fasting the outfomes o- sporting eventsA
xs tefhnology advanfes, the sports landsfape, espefially in betting,
has eIperienfed a tremendous trans-ormationA xz has the potential to
revolutioniOe sports betting by providing us with unparalleled fapa.
bilities -or data analysis and prediftionA xz has been entirely affurate
in predifting the outfome o- bets, as many individuals have tried it
out and have gained positive resultsA Tne kiWkoW user fould use xz
to forreftly predift the outfome o- three games in one dayA Hhen the
fonditions are -avorable, xz fan affurately -orefast the outfome, but
winning fan sWew the sportA zt fan ruin the ethifs o- the game -or
booWies and -ans aliWeA xnd it fan befome addiftiveA
:owever, liWe any emerging tefhnology, the utiliOation o- xz in
sports betting entails fertain disadvantagesK
● Putting too much weight on historical data and patternsK
xz algorithms heavily rely on historifal data to maWe prediftions, but
fountless variables fan inRuenfe game outfomes in sports bettingA
2qM BLzS 1x33

khings liWe injuries, team dynamifs, and weather fonditions might

slip through the frafWs o- historifal dataA Lelying solely on it fan result
in inaffurate prediftions and disappointing resultsA
● Steep costs and technical demandsK zntegrating xz into sports
betting re'uires substantial tefhnifal Wnow.how and resourfesA khis
fan pose a fhallenge -or smaller booWies, who may struggle to adopt
xz.powered betting modelsA Uoreover, xz systems% development and
maintenanfe fosts fan be 'uite high, maWing them unattainable -or
someA
Hhile xz has shown promise in sports betting, there have been
instanfes where xz.based models -ailed or had RawsA khe in the B,
the niversity o- Sal-ord has fondufted a study that revealed an
xz.powered betting model has a suffess rate o- only qM , whifh is
not better than random fhanfeA khis serves as a reminder o- the risWs
and limitations assofiated with relying solely on xz -or sports betting
prediftionsA
khat will not stop xz -rom being integrated into sports over timeA
xnytime money is involved, there will be those willing to invest in
tefhnology to gain an advantageA zt is human natureA
36

Data Leaks &

Privacy

T here have been huge privacy concerns when it comes to chat-

bots. Any information shared with ChatGPT and other AI
models can be permanently retained and used to enhance the model's
training.
Samsung
When they accidentally disclosed conSdential ,amsung datax ,am-
sung employees eqperienced the consekuences of data leaDs Srsthand.
zuring their worDx ,amsung employees inadvertently divulged sensi-
tive information while seeDing assistance from ChatGPT. The semi-
conductor division had authoriEed engineers to employ ChatGPT for
source code veriScation purposes.
According to The Kconomist Ooreax there were three incidents
where the employees inadvertently eqposed conSdential information
to ChatGPT. Fne incident involved an employee sharing conSdential
source code with the chatbot to checD for errors. Another employee
pasted a piece of code and asDed the bot to optimiEe it. Rinallyx a
340 OBI, LA11

third employee shared a recorded meeting to have it transcribed into

presentation notes. Begrettablyx this information is now accessible by
ChatGPT.
This leaD is a real-life eqample of the scenarios and hypotheses
privacy eqperts have emphasiEed. Kqamples include sharing sensitive
legal documents or medical information to summariEe or analyEe long
teqtsx which might be used to improve the model. ,amsung has taDen
immediate measures to address the situation. They have restricted
the upload capacity of ChatGPT to 32U0 bytes per person and are
investigating the individuals involved in the data breach. ,amsung
is considering creating an internal AI chatbot to ensure this never
happens again. Jnfortunatelyx ,amsung will not be able to retrieve the
leaDed data.
According to ChatGPT's data policyx user data is used for mod-
el training unless an eqplicit opt-out rekuest is made. Rurthermorex
ChatGPT's usage guide eqplicitly advises users against sharing sensi-
tive information during conversations.
This is an eqcellent eqample of how users must be careful while
seeDing assistance from ChatGPT.
Apple
Apple has implemented restrictions on using AI toolsx such as Fpe-
nAI's ChatGPTx for its employees due to concerns about potential
leaDs or collecting conSdential information. The Wall ,treet Mournal
reported that Apple employees have also been warned and asDed not
to use Nicrosoft Copilot.
FpenAI's default setting is that it retains interactions users maDe
with ChatGPT. These conversations are then gathered to train Fpe-
nAI's systemsx and moderators can review them to maDe sure they
comply with the company's terms and services.
 TFNFBBFW', ABTIRICIA1 I5TK11IGK5CK 34"

FpenAI then introduced a feature that allows users to disable chat

historyx whichx as a coincidencex happened shortly after several Ku-
ropean Jnion countries started investigating the tool for potential
privacy breaches. zespite this settingx FpenAI still retains conver-
sations for 42 daysx during which they can be reviewed (for abuse(
before being permanently deleted V)incentx U2U4bj. ,eeing how use-
ful ChatGPT is for tasDs liDe code improvement and idea generationx
Apple has valid concerns that its employees might inadvertently enter
conSdential pro ect information into the system. ,uch information
could be accessed by one of FpenAI's moderators.
Apple is not the only company implementing such restrictions.
Googlex MP Norganx )eriEonx and AmaEon have also taDen similar
measures.
I predict that bans by companies will disappear as employers come
up with their own 'home-grown' AI technology. Fr contracts will be
implemented by companies with one particular brand of AI.
37

The Danger
of Self-Driving
Cars

T esla recalled a whopping 362,000 vehicles in the US to update

its Full Self-Driving (FSD) Beta software. The reason behind
this move was regulators' concerns regarding the driver assistance sys-
tem's compliance with traNc safety laws and its potential to cause
accidents.
The Hational Aighway TraNc Safety "dministration (HATS")
highlighted that the Tesla software allowed vehicles to xekceed speed
limits or travel through intersections unlawfully or unpredictably,
which increases the risR of a crashx (Meuters, 2023). The recall applied
to a range of models.
The Incident
"n eight-vehicle crash occurred on the San Francisco Bay Bridge
when a Tesla Oodel S driver reported that his xFull Self-Driving
 TWOWMMWI'S "MTCFCLC"E CHTGEEC1GHLG 73$

Oodex (FSD) software malfunctioned and caused the crash. The crash
resulted in two minors being sent to the hospital.
Ct is one of a series of unfortunate incidents that people attribute to
Tesla's technology. The LGW of the company, Glon OusR, was heavily
promoting the FSD software, sold as an add-on for Tesla vehicles
at around 57q,000. How the software faces scrutiny by the law, the
regulators, and the public.
Following the incident, the driver of the Tesla Oodel S told the
police that the software malfunctioned. "s per the police report, the
vehicle was moving at qq mph when it suddenly changed lanes and
hit the braRes, dropping the speed to 20mph. Ct led to another vehicle
colliding with the Tesla, setting oP a chain reaction of collisions, ac-
cording to a report by Meuters.
The police failed to ascertain if the software was even functioning
during the accident or if the driver's story was accurate. The collision
happened shortly after OusR announced that Tesla would maRe the
FSD software available to customers in Horth "merica who had re-
8uested it. Kreviously, only drivers with high safety scores were allowed
access. The police report further stated that if the software malfunc-
tioned, the driver should have taRen control of the vehicle manually.
The Recall
Tesla did not entirely see eye to eye with the HATS"'s analysis, even
though they agreed to a recall.
"t the same time, HATS" has been ekamining z30,000 Tesla ve-
hicles that came with the "utopilot driver assistance system in an
investigation that started in 2027. The investigation was sparRed by a
series of accidents involving parRed emergency vehicles, and HAT-
S" is particularly interested in determining if Tesla vehicles ePec-
tively ensure driver attentiveness. Despite the FSD recall, HATS"
clari ed that their investigation into Tesla's "utopilot and associated
73z MCS B"EE

vehicle systems remains active and open. Cn addition, HATS" also

mentioned that the system sometimes fails to respond ade8uately to
changes in speed limits or to properly note the driver's control of speed
when ekceeding these speed limits.
East year, Tesla had to recall many vehicles e8uipped with FSD Beta
software because speci c models tended to perform xrolling stopsx
instead of braRing completely at intersections. This was a huge safety
risR.
Both Tesla and HATS" emphasi ed that FSD's advanced driving
features do not completely maRe the vehicles autonomous and that
drivers still need to pay attention.
38

The Prospect of
Sentient AI

"L anguage Model for Dialogue Applications," or LaMDA, is a

Large Language Model (LLM) developed by Google. It is a
remarkable achievement in natural language processing. It serves as the
foundation for several language models.
While it may not have attained the same level of popularity as
OpenAI's GPT family, LaMDA stands as one of the most powerful
language models in existence.
LaMDA is indeed an impressive AI model. One of Google's engi-
neers, Blake Lemoine, even suggested that the model possesses sen-
tience. Lemoine's assertion implies that Google's AI chatbot is capable
of experiencing emotions and perhaps even possessing a form of con-
sciousness. He based his conclusion on a series of detailed, human-like
conversations with the model. Although Google promptly disproved
the notion that an AI chatbot can truly be sentient, Lemoine's claims
highlight the chatbot's exceptional conversational capabilities to the
140 KRIS BALL

extent that they managed to convince an AI engineer of its supposed

sentience.
Google's recent release of Bard, has gained substantial popularity.
It utilizes LaMDA AI and aims to become an integral part of various
Google systems, enabling Google products to engage in conversations
that closely resemble human interaction.
While Google has hinted at a wide range of potential applications
for LaMDA, most of these endeavors remain experimental. LaMDA
AI itself is still undergoing development and re?nement, which ex-
plains the limited availability of concrete product lines at this stage.
If LaMDA possesses signs of sentience, what would happen if AI
were self-awareC
In an interview with 6BS' E0 Minutes, Demis Hassabis, the 62O of
DeepMind, admitted that AI might be heading toward self-awareness.
He acknowledged, "Philosophers have not really settled on a de?nition
of consciousness yet, but if we mean self-awareness and these kinds of
things, I think there is a possibility that AI one day could be" (Al-Sibai,
303F). Intriguingly, he supports the idea of machines gaining sen-
tience.
Google dismissed AI researcher Blake Lemoine last year after his
audacious claim that the company's LaMDA language model had
achieved consciousness, leading to a considerable media uproar.
Lemoine is not the only one who made the statement that large
language models potentially possess cognitive capabilities on par with
humans or at least have the potential to reach that level. Prior to
the LaMDA incident last year, Ilya Sutskever, the chief scientist of
OpenAI, mentioned in her tweet that "it may be that today's large
neural networks are slightly conscious," igniting a brief but intense de-
bate regarding the possibility of AI achieving consciousness (Al-Sibai,
303F).
 TOMORROW'S ARTINI6IAL I&T2LLIG2&62 141

While numerous highly intelligent individuals maintain the view

that AI lacks consciousness or sentience and is unlikely to develop
these traits, it is becoming more common for machine learning pro-
fessionals to express their ideas in the open about AI gaining sentience,
whether currently existent or on the horizon.
It is important to note that we do not possess the necessary expertise
to accurately accept or deny the idea that these large language models
have gained self-awareness in any way. &onetheless, the thought of
such possibilities is undeniably disconcerting.
Skynet
The Royal Aeronautical Society recently released its highlights
from the RAeS Nuture 6ombat Air q Space 6apabilities Summit. AI
was discussed, and 6ol. Hamilton brought up an interesting situation.
During a simulation using an AI-powered drone, the AI was tasked
with destroying an enemy target. But the ?nal decision to ?re was
controlled by a human. Sometimes the decision was a "no-go." In the
simulation, the AI decided that the "no-go" option was not preferred,
so it attacked the human operator. When they reinforced that the
AI drone could not attack the human, it found another way around
getting the "no-go" option by attacking the communications hub.
This brought up uestions about the ethics of AI. Later the article
was updated to say that 6ol. Hamilton misspoke during the presen-
tation and that the simulation was actually a hypothetical "thought
experiment" from outside the military (Robinson, 303F).
39

Singularity

S ingularity

There is considerable speculation surrounding the possibility

of an AI system attaining consciousness unexpectedly and abruptly.
Referred to as the "singularity," this concept raises concerns that we
may be either courting catastrophic consequences or surrendering
ourselves as slaves to AI once the singularity is achieved.
Numerous "conspiracy" theories regarding AI often present a bleak
vision of the impending downfall of humanity. Only a few of these
speculative hypotheses seem willing to believe that AI's emergence
could be bene-cial, potentially propelling us toward a future characz
teriMed by progress and prosperity. Instead, attention remains -xated
on the apocalyptic scenarios. It is crucial to acknowledge that the
outcome of AI attaining consciousness remains uncertain.
According to a TIE1 magaMine article, "a recent survey showed that
half of AI researchers give AI at least a 0%W chance of causing human
extinction" through unaligned superintelligence. And yet denial or
resignation seems to be the dominant attitude toward this alarming
 TOEORROS'F ARTICILIAG INT1GGI41NL1 03(

news 2Tegmark, )%)(?. After all, if something even had a 0W chance

of killing us all, shouldn't it be addressedU
Thankfully many people are taking the risk seriously. The KD govz
ernment is hosting a global AI safety summit and invited all the big
players. OpenAI, 4oogle PeepEind, and Anthropic have committed
to providing early or priority access to their AI models to support
research into evaluation and safety" 2Gomas, )%)(a?. Eoreover, in a
tweet, …rime Einister Rishi Funak announced the dedication of 0%%
million pounds to an AI task force for AI safety. These are small steps
to creating a safety net against a singularity event that could spell
doomsday for the human race.
Ftill, the question remainsH :ow could it happenU If the safety nets
failX Shere and how will AI -rst become sentientU
Lurrently, various AI systems are being developed and deployed
across multiple domains. Cor instance, the medical -eld employs AI
to analyMe Bzrays and ERI scans to assess an individual's likelihood
of developing cancer. Is it possible for this technology to become a
sentient entityU Not likely.
Another area of consideration is the implementation of AI in stock
market prediction and investment assistance. Lan this particular AI
system emerge as the conqueror of humanityU …robably not.
Sorks of science -ction often attribute the role of the likely culprit
to AI systems that govern national defense. 4iven their prezexisting
capacity for mass destruction, this notion holds more logical appeal.
It is the Fkynet scenario, as mentioned before.
It would take more than that. The way I see it playing out is that an
AI system 2possibly military, but maybe not? could exhibit sujcient
astuteness to in-ltrate additional nonzAI automated systems. It could
exploit these systems to achieve unrivaled power like a computer virus.
Vasically, AI could cannibaliMe other AI or automated systems and rule
033 DRIF VAGG

supreme. In this way, an arti-cial superintelligence could acquire the

tools and systems needed to cause harm and kill large numbers of the
human population.
Vuy whyHU The famous "paperclip problem" represents a variation
of the theory suggesting that an exceedingly intelligent AI tasked with
producing paper clips would become so consumed by this ob5ecz
tive that it inadvertently eradicates humanity. Shile not intentionally
malevolent, AI's relentless pursuit of paperclip production leads to the
unintended and adverse consequence of our demise.
This theory might contain inherent loopholes. The AI allegedly
possesses the intellect to gain sentience, yet it exhibits a ba ing inabilz
ity to prioritiMe ob5ectives beyond its relentless -xation on paperclips.
Curthermore, one might question how the AI system itself would
survive if it were to eradicate all humans.
In the end, the how and the why will not matter.
All we can do here and now is support safety and preventative
measures. Cirewalls between systems need to advance with technology.
ulnerabilities regarding our infrastructure need to be addressed. And
it may be AI itself that comes up with the plans to protect and secure
humanity from malicious AI. The very thing that can doom us all may
also be the thing that can save us.
Se also need governmental oversight. Right now, 1urope is workz
ing to enact laws to be "fully in line with 1K rights and values includz
ing oversight, safety, privacy, transparency, nonzdiscrimination, and
social and environmental wellbeing" 2Gomas, )%)(b?.
In response, Open Ai's L1O, Fam Altman, suggested the company
might have to withdraw service to the region if it cannot comply with
all the proposed regulations. Shile both entities believe in providing
a safe product to consumers, their idea of what that product looks like
or how to regulate it varies. Then, in a twist, Fam Altman told KF
 TOEORROS'F ARTICILIAG INT1GGI41NL1 03

Longress in written testimony that "OpenAI believes that regulation

of AI is essential" 2Ftrickland, )%)(?. :is urging of lawmakers to
require safety tests for large AI models shows that while companies
like the freedom to operate their business without restrictions, they
also recogniMe the need for safety. Fundar …ichai, L1O of 4oogle
and its parent company, Alphabet, said, "there will need to be global
frameworks" governing the use of AI.
It seems even the biggest players in the arti-cial intelligence space
agree that some kind of regulation is necessary. :owever, what govz
ernmental oversight will be is still being debated.
One thing that will not happen is the outright ban or stoppage of
AI. It is too farzreaching already. The genie is already out of the bottle.
All we can do is use its power to wish for a brighter, healthier, happier
future.
40

Conclusion

A I has become a part of our daily lives, from the digital assistants
in our smartphones to our GPS and smart home devices. It
is hard to dismiss the undeniable advancements that have been made
with AI in the Weld of healthcare, where revolutionary drugs are being
created to combat superbugs. -ith the help of AI, advancedzstage
blood cancer patients can be given personaliCed treatments, thus inz
creasing their survival rates.
AI has also made signiWcant achievements in the military, selfzdriz
ving cars and has great potential for advancements in catching crimiz
nals and putting them away.
kompanies are using AI for altruistic purposes to maOe the world
a safer place. AI is Wghting natural disasters and helping to identify
abuse. So much good is already coming from artiWcial intelligence.
Tf course, technology does not come without its limitations and
criticisms. qhe creation of khatGPq marOed a new era, witnessing
unprecedented growth in a short time. khatGPq is used to answer
Muestions and write essays. Its tendency to create false and misleading
 qTRT''T-FS A'qILIkIAN IEq1NNIG1Ek1 47j

information has often led to dangerous situations, controversies, and

false allegations against people.
qeachers still Wnd it unethical to use the chatbot during tests.
It is not xust khatGPq. qhe rise of teHtztozimage generators, avatars,
and voice cloning software has spawned controversies and even lawz
suits.
qhen we have deepfaOes, which have taOen AI to a whole new level
and garnered much attention. qhere is a miH of awe and fear about
the impact of this technology, which should be regulated to prevent
misuse.
qhere are dangers to AI that cannot be discounted. qhe fears we
all have about rapidly growing technology are valid. A lot of this fear
comes from the unOnown, the lacO of Onowledge about how AI worOs,
and the uncertainty about the future. -e must understand that this
technology did not come to life on its own but was created by humans,
and only humans can control it or let it go out of control. It all depends
on how we use it.
In the right hands, it can help save lives and maOe our lives easier.
Tf course, there is the belief that AI will taOe over xobs. qechnolz
ogy has been advancing for centuries. -e have emails that replaced
telegrams and letters and calculators that made math easier. qechnolz
ogy has always been there, and humans have evolved along with it. -e
will continue to evolve even as AI spreads further.
kontrary to popular belief, AI will open up millions of new xobs
and pave the way for a myriad of new possibilities.
I am an optimist. Kumanity will coursezcorrect current pitfalls and
steer AI into a bright future. Tne hundred years from now, I predict
a world where disease is eradicated, and aging has been conMuered.
I see a world where personaliCed digital assistants are with us for
every step of our daily routines, maOing suggestions tailored to our
47& B'IS 8ANN

uniMue needs and desires. I see natural disasters mitigated and crime
reduced to almost Cero. I see global poverty, hunger, and educational
disparities vanMuished. qomorrowFs artiWcial intelligence worOs with
us collaboratively to maOe our dreams of a better world a reality.
Call to Action
I encourage you to give AI a chance. Incorporate it into your daily
routine and see how it worOs for you.
qaOe the time to learn, understand, and see how you can grow with
it. Stay informed, encourage restrictions, laws, and governance, such
as maOing AI detectable with invisible watermarOs, and encourage
human oversight.
-hether AI will lead to good or bad depends on our willingness to
embrace it and use it ethically to help us rather than let it govern us.
If this booO has helped you understand AI in any way, feel free to
leave a review on AmaCon. I appreciate : need the feedbacO.
Linally, if you want to stay upztozdate on the latest AI articles I
Wnd impactful and interesting, xoin my L8 group! Rastering ArtiWcial
Intelligence. qhere may be multiple groups by that name, but mine
will list me, Bris 8all, as the moderator.
See you in the future
Afterword

Finally, to answer the burning question you may have had this entire
time… Did I use AI to write this book? Unfortunately, ChatGPT's
training algorithm ended in Sept of 2021. So it doesn't know anything
from the last 2 years, making it kinda useless for this book which relies
heavily on the latest news and trends. That being said, I did want AI
to write something, so I did have it write the 3rst Y paragraphs of the
intro. ou're welcome.
Comment on the
Cover Art

Shout out to design_maida from Fiver for creating the beautiful

cover art for this book. When I looked on Amazon at the other books
about AI, I noticed a theme. Every single one of them depicted a robot
or computer on the cover. Additionally, the books were colored in
hues of light blue and gray. I wanted something dixerent. I thought
back to my -rst e:perience with AI in science -ction.
It was a book by one of my allRtime favorite authors of oldRschool
sciR-H Tobert A. Meinlein. "he book is called, "he ?oon is a Marsh
?istress. In it, helpful AI befriends the main character and helps gain
freedom for the lunar colony they live on. I can remember crying when
the AI was damaged in an attack, thinking, DIs he okay! …id he die!'!'D
"hat -rst impression of what AI could beH helpful, caring, powerful,
and lifeRchangingO "hat has always stayed with me. I think itCs why I
am so optimistic about the future of AI. I see potential more than I
see the harm. "he cover of that book was colorful. It looked like a star
nebula. "hat is what I wanted for my coverH something that was more
 "L?LTTLWCS AT"IFINIAG I1"EGGI5E1NE j–j

than ust blue and gray. Something that speaks to the science -ction
that AI once was futuristic.
Glossary

A lphaZero: A computer program that uses reinforcement learn-

ing and plays against itself to train its neural networks and
master games like chess, shogi, and Go. 
ArtiIcial (ntelligence )A(b: A Ield that comqines computer science
and machines to perform tasks that typically reCuire human intelli-
gence.
Auaqcin: An A(-created antiqiotic that could potentially kill su-
perqugs like Acinetoqacter qaumannii
Shassis Sell: Nelf-replicating minimal machines that can qe tailored
for the production of speciIc chemicals. 
Shatqot: A computer program that comqines A( and LPv to
mimic human con—ersationxwritten or spokenxand allows humans
to interact with digital de—ices as if they were communicating with real
people.
SodeD: A system that translates natural language into code. (t can
interpret commands written in natural language and run them for the
programmer.
Syqernetics: A Ield where qiology and technology are comqined.
EAPP-T: Another image generation program that creates images
from prompts. 
 OMRMWWM'FN AWO(1(S(AP (LOTPP(GTLST 53"

Eeepfake: A synthetic media designed to replicate and replace a

personFs likeness with another artiIcially. 
Eescript: A platform that allows you to clone your —oice, which you
can use to edit audio or create music, podcasts, or —ideos. Eescript uses
an A( called HPyreqirdH to achie—e ultra-realistic —oices. 
Eigital Assistant: Also known as a H—irtual assistant,H this tech-
nology is designed to assist users in answering Cueries or performing
—arious tasks.
TBW: Tlectronic Redical Wecord
TDalt-5: A study conducted qy TDscientia, an A(-dri—en pharmacy
company, seeks to test drugs directly against the tumor tissues of each
patient to disco—er speciIc medications for their treatment. Ohis al-
lows the treatment of ad—anced-stage hematologic cancers.
1loodSuqe: a modeling tool for stormwater management that pre-
—ents zooding caused qy hea—y rainfall.
1loodBuq: Ohis platform eKecti—ely showcases the speciIc areas
and timings —ulneraqle to zooding, ensuring —aluaqle information
reaches indi—iduals and enaqling authorities to pro—ide eKecti—e assis-
tance.
1ull Nelf-Eri—ing Rode: An ad—anced dri—er-assistance system that
uses hardware and software to allow —ehicles to mo—e autonomously
through —arious tra4c situations. Ohis system incorporates a multi-
tude of cameras, ultrasonic sensors, radar, and powerful computers
to interpret the surrounding en—ironment eKecti—ely. Jy analyUing
real-time data, it autonomously controls —arious aspects of the —ehicle,
like acceleration, steering, and qraking.
Generati—e vre-Orained Oransformer )GvOb: An A( language mod-
el designed qy MpenA( to process information, answer Cuestions,
and translate languages. (t can perform what is called Hfew-shot,H
532 jW(N JAPP

Hone-shot,H or HUero-shotH learningxwhich means it needs only a few

eDamples, or Uero eDamples, in order to learn compleD tasks.
GlaUe: A program that uses a cloaking techniCue to pre—ent an
image generator from accurately replicating an art style.
Balicin: An eDperimental drug that kills —arious strains of qacteria,
including superqugs, qy inhiqiting an enUyme known as c-6un L-ter-
minal kinase.
(n—isiqle 'atermarks: nlike regular —isiqle watermarks, which can
qe remo—ed, in—isiqle watermarks are hidden in the images and are thus
harder to spot and remo—e. 
Panguage Rodel for Eialogue Applications )PaREAb: A Parge
Panguage Rodel )PPRb de—eloped qy Google.
Parge-scale ArtiIcial (ntelligence Mpen Letwork )PA(MLb: A
German-run non-proIt that aims to make machine learning resources
open to the general puqlic. Ntaqle EiKusion uses this dataset to gen-
erate images.
Ricrosoft Sopilot: An A( tool that helps people create documents,
read, and summariUe emails, create presentations, and much more. 
Rid ourney: Pike Ntaqle EiKusion, itFs a generati—e A( that gener-
ates images qased on prompts.
Latural Panguage vrocessing )LPvb: An area of computer science,
speciIcally A(, that eDplores how computers can understand written
and spoken teDt and manipulate it how humans can. 
MpenA(: An American A( research laqoratory.
valantir: (tFs an artiIcial intelligence platform with a simulation
—ideo where their A( can pull e—erything together in a life-life war
scenario: 1rom spotting an enemy threat to re—iewing possiqle teams
in the area with the logistical capaqilities to take out the enemy target. 
 OMRMWWM'FN AWO(1(S(AP (LOTPP(GTLST 533

vaPR : An A( language model de—eloped qy Google in compe-

tition with MpenA(. (t can generate specialiUed code in —arious pro-
gramming languages. 
Nhort-selling: A term that is freCuently used in the stock market
world. Nimply put, qetting a companyFs share price will fall. (tFs a way
for hedge funds to make money.
Ningularity: refers to a signiIcant e—ent in which artiIcial intelli-
gence achie—es self-awareness or an unqelie—aqle capacity for contin-
uous impro—ement, surpassing our control. (t is a concept that entails
en—isioning a future where A(s transcend their current limitations,
potentially e—ol—ing qeyond our aqility to manage or comprehend
their capaqilities. 
Ntaqle EiKusion: (tFs a deep learning, teDt-to-image model. 
Ntem Sells: Ohe fundamental units of the human qody. T—ery cell
originates from them qefore taking on a distinct form and function.
Ntem cells ha—e the potential to replace diseased or damaged tissues,
sa—ing a lot of li—es. 
Nte—e.ai: An A( platform that allows you to create —ideos and ani-
mations. Ohis tool makes it easier to de—elop promotional campaigns
for salespeople, marketers, etc.
Nuperqug: A strain of qacteria that is resistant to antiqiotics. 
Nyllaqy: A platform that helps to search for topics in the userFs
rele—ant industry and creates —ideo scripts qased on those topics that
are most likely to go —iral. 
Nynthesia: A platform that creates lifelike A( representations of
humans. Sustom a—atars can qe used to create qusiness —ideos with
Nynthesia. 
'riters Guild of America: A collaqoration of two American oint
laqor unions representing writers in tele—ision, Ilm, and online me-
dia. 
53 jW(N JAPP
References

AlphaZero. (n.d.). Chess. https://www.chess.com/terms/alphazero

-chess-engine
Al-Sibai, N. (2023, April 17). Google DeepMind CEO Says AI May
Become Self-Aware. Futurism. https://futurism.com/the-byte/goog
le-deepmind-ceo-self-aware-ai
Aquino, S. (2021, November 17). Google’s Project Relate App
Promises To Help Improve Communication For People With Speech
Impairments. Forbes.
https://www.forbes.com/sites/stevenaquino/2021/11/17/googles-p
roject-relate-app-promises--to-help-improve-communication-for--pe
ople-with-speech-impairments/?sh=473bed9b1247
Av Content Team. (2023, April 21). This is How Experts Predict the
Future of AI. Analytics Vidhya. https://www.analyticsvidhya.com/b
log/2023/04/future-of-ai/
Barr, K. (2023, June 7). Replika’s new AI app is like tinder but with
Sexy Chatbots. Gizmodo. https://gizmodo.com/blush-ai-chatbot-re
plika-online-dating-dating-apps-1850514242
Behind-the-Design: Meet Copilot (2023, April 3). Microsoft De-
sign. https://medium.com/microsoft-design/behind-the-design-me
et-copilot-2c68182a0e70
158 KRIS BALL

Belton, P. (2022, January 10). The AI software that could turn you
into a music star. BBC News. https://www.bbc.com/news/business
-59878572
Biggest Threats and Data. (2019, May 31). Centers for Disease
Control and Prevention. https://www.cdc.gov/drugresistance/bigge
st-threats.html
Blood Cancer Discovery PublicationFurther Validates Exscientia’s
AI Precision Medicine Platform for Improving Patient Outcomes.
(2022, September 20).Investors.exscientia.ai.
https://investors.exscientia.ai/press-releases/press-release-details/202
2/Blood-Cancer-Discovery-PublicationFurther-Validates-Exscientias
-AI-Precision-Medicine-Platform-for-Improving-Patient-Outcomes/
default.aspx
Can AI Help Fight Hunger? Exploring the Potential of Ar-
tificial Intelligence (2022, December 3). Quantilus Innova-
tion. https://quantilus.com/ai-to-help-#ght-hunger/~:%:text=InW2
0manyW20partsW20ofW20the
Can Artificial Intelligence Help Humans Stop Ageing? (2022, Feb-
ruary 9).Industry _ired. https://industrywired.com/can-arti#cial-i
ntelligence-help-humans-stop-ageing/
Chowdhary, K. R. (2020). Natural Language Processing. Funda-
mentals of Artificial Intelligence, 603–649. https://doi.org/10.1007
/978-81-322-3972-7æ19
Copeland, B. J. (2019). Artificial intelligence - Alan Tur-
ing and the beginning of AI. In Encyclop'dia Britanni-
ca. https://www.britannica.com/technology/arti#cial-intelligence/
Alan-Turing-and-the-beginning-of-AI
Correspondent, R. _. T. (2023, March 26). Half of students
are using ChatGPT to cheat, and it could rise to 90%. Mail On-
 TOMORRO_HS ARTIFICIAL INTELLIGENCE 159

line. https://www.dailymail.co.uk/sciencetech/article-11899475/ç
alf-students-using-ChatGPT-cheat-rise-90.html
Cybernetic cells: blurring the boundaries of biology and technology
(n.d.).Nesta. https://www.nesta.org.uk/feature/tipping-point/cybe
rnetic-cells-blurring-boundaries-biology-and-technology/
Davies, R. (2021, January 28). GameStop: how Red-
dit amateurs took aim at Wall Street’s short-sellers. The
Guardian. https://www.theguardian.com/business/2021/jan/28/g
amestop-how-reddits-amateurs-tripped-wall-streets-short-sellers
Dean, J. (2022, November 2). 3 ways AI is scaling helpful technolo-
gies worldwide. Google. https://blog.google/technology/ai/ways-ai-i
s-scaling-helpful/
Demopoulos, A. (2023, April 3). Computer-generat-
ed inclusivity: fashion turns to “diverse” AI models. The
Guardian. https://www.theguardian.com/fashion/2023/apr/03/ai
-virtual-models-fashion-brands
Dent, S. (2023, June 28). NASA is creating a CHATGPT-like as-
sistant for Astronauts. Engadget. https://www.engadget.com/nasa-is
-creating-a-chatgpt-like-assistant-for-astronauts-081903604.html
Eliaı&k, E. (2023, May 5). How To Use Kaiber AI: Free Alternatives
And More. Dataconomy. https://dataconomy.com/2023/05/05/ho
w-to-use-kaiber-ai-free-alternatives/
Elmers, R. (2023, April 30). A Virtual Avatar Created By
AI Bypasses Bank Security And Misleads Relatives. Tech News
Space. https://technewsspace.com/a-virtual-avatar-created-by-ai-by
passes-bank-security-and-misleads-relatives/
FACT SHEET: Biden-Harris Administration Announces New
Actions to Promote Responsible AI Innovation that Protects Americans’
Rights and Safety (2023, May 4). The _hite çouse.
https://www.whitehouse.gov/brie#ng-room/statements-releases/20
160 KRIS BALL

23/05/04/fact-sheet-biden-harris-administration-announces-new-ac
tions-to-promote-responsible-ai-innovation-that-protects-americans
-rights-and-safety/
Franks, R., Z Maher, R. (2023, May 2). “It’s Russian roulette” - Top
students deny AI cheating after teachers flunk them. NU çerald.
https://www.nzherald.co.nz/nz/ai-and-chatgpt-cheating-allegations
-at-cambridge-and-pukekohe-high-outrage-parents-of-top-students/
A5TBç25N2NC4JG2UOAYB7L3_6|/
Gallagher, J. (2023, May 25). New superbug-killing antibiotic dis-
covered using AI. BBC News. https://www.bbc.com/news/health-6
5709834
Garth, E. (2022, December 1). New AI-enabled study unravels the
principles of aging. Longevity. https://longevity.technology/news/n
ew-ai-enabled-study-unravels-the-principles-of-aging/
George, E. O. (2022, July 24). How can AI improve academic writ-
ing experience - Paperpal Blog. https://www.paperpal.com/blog/new
s-updates/industry-insights/ai-writing-experience/
Germain, T. (2023, June 8). Kansas U researchers claim 99% accu-
racy detecting ChatGPT fakes. Gizmodo. https://gizmodo.com/chat
gpt-detector-ai-kansas-research-paper-99-accuracy-1850519081
Geschwindt, S. (2023, June 8). This AI-powered platform could
predict the next big flood. TN_ é Sustainability. https://thenextweb.c
om/news/this-ai-powered-platform-could-predict-the-next-big- ood
Google launches “FloodHub”, a platform to forecast flood: All details
inside. (2022, November 6). Livemint.
https://www.livemint.com/technology/tech-news/google-launches-f
loodhub-a-platform-to-forecast- ood-all-details-inside-1166773711
5751.html
 TOMORRO_HS ARTIFICIAL INTELLIGENCE 161

Gungor, A. (2023, March 13). The Top 10 Limitations Of ChatG-

PT. Bernard Marr. https://bernardmarr.com/the-top-10-limitation
s-of-chatgpt/
çat#eld, K. (2023, March 21). Artificial Intelligence is help-
ing researchers identify and analyse some of the world’s old-
est art. The Art Newspaper - International art news and
events. https://www.theartnewspaper.com/2023/03/21/arti#cial-i
ntelligence-ancient-rock-art-australia-andrea-jalandoni
çelfrich, T. (2021, May 31). Council Post: Why Robotics And
Artificial Intelligence Are The Future Of Mankind. Forbes.
https://www.forbes.com/sites/forbestechcouncil/2022/05/31/why
-robotics-and-arti#cial-intelligence-are-the-future-of-mankind/?sh=
709bcedd1689
çelmore, E. (2022, December 22). Tesla behind eight-ve-
hicle crash was in “full self-driving” mode, says driver. The
Guardian. https://www.theguardian.com/technology/2022/dec/22
/tesla-crash-full-self-driving-mode-san-francisco
çern, A., Z editor, A. ç. Y. technology. (2023, April 12).
Streaming sites urged not to let AI use music to clone pop stars. The
Guardian. https://www.theguardian.com/business/2023/apr/12/st
reaming-sites-ai-copyrighted-music-copycat-tracks
çouser, K. (2023, January 12). Microsoft’s new AI
needs just 3 seconds of audio to clone a voice. Free-
think. https://www.freethink.com/robots-ai/voice-cloning-vall-e~:
%:text=VALLW2DEW20canW20evenW20mimicW20aW20speaker
çughes, N. C. (2023, March 9). How AI voice
cloning threatens the security of banking systems. Cy-
bernews. https://cybernews.com/security/how-ai-voice-cloning-thr
eatens-the-security-of-banking-systems/
162 KRIS BALL

Introducing Voicebox: The first generative AI model for speech to gen-

eralize across tasks with state-of-the-art performance. Meta AI. (n.d.).
https://ai.facebook.com/blog/voicebox-generative-ai-model-speech/
Israelsky, P. (2023, March 27). Council Post: How Marketers Can
Leverage AI In Search Engines. Forbes.
https://www.forbes.com/sites/forbesbusinesscouncil/2023/03/27/h
ow-marketers-can-leverage-ai-in-search-engines/?sh=748b5db61d7e
Ito, A. (2023, April 26). ChatGPT spells the end of coding as we know
it. Business Insider. https://www.businessinsider.com/chatgpt-ai-te
chnology-end-of-coding-software-developers-jobs-2023-4
Jackson, C., Z Uulueta, J. (2022, May 18). The beauty and horror
behind deepfakes. The LaSallian. https://thelasallian.com/2022/05/
18/the-beauty-and-horror-behind-deepfakes/
Jones, J. ç. (2023, April 24). Congress gets 40 ChatGPT Plus licenses
to start experimenting with generative AI. FedScoop. https://fedscoo
p.com/congress-gets-40-chatgpt-plus-licenses/
Joseph, C., Beaumont-Thomas, B., Moir, ç., Loseto, M.,
Kacouti–, A., Z Ebtehaj, M. (2023, April 13). Will AI ruin music as
we know it? Pop Culture with Chanté Joseph. The Guardian.
https://www.theguardian.com/society/audio/2023/apr/13/will-ai-r
uin-music-as-we-know-it-pop-culture-with-chante-joseph
Kelly, S. M. (2023, May 10). The most popular search engine in the
world is about to look different. CNN Business. https://edition.cnn.
com/2023/05/10/tech/ai-search-google-io/index.html
Kemper, J. (2023, March 8). Artists remove 80 million images from
Stable Diffusion 3 training data. The Decoder.
https://the-decoder.com/artists-remove-80-million-images-from-sta
ble-diXusion-3-training-data/~:%:text=ArtistsW20removeW2080W20
millionW20imagesW20fromW20StableW20DiXusionW203W20trainin
gW20data
 TOMORRO_HS ARTIFICIAL INTELLIGENCE 163

Klein, A. (2023, April 5). ChatGPT: The end of creative writing?

The Tufts Daily. https://tuftsdaily.com/arts/2023/04/05/chatgpt-t
he-end-of-creative-writing/
Knight, _. (2023, March 30). Let the AI Coding Wars Begin!
_ired. https://www.wired.com/story/ai-coding-wars-openai-google
-microsoft/
Koblin, J., Z Barnes, B. (2023, March 21). Why There Is Talk of a
Writers’ Strike in Hollywood. The New |ork Times. https://www.n
ytimes.com/article/wga-writers-strike-hollywood.html
Korosec, K. (2023, April 21). Google’s Bard AI chatbot can now gen-
erate and debug code. TechCrunch. https://techcrunch.com/2023/0
4/21/googles-bard-ai-chatbot-can-now-generate-and-debug-code/
Kotorchevikj, I. (2021, August 27). Applying AI for social good to
solve today’s global challenges. çyperight. https://hyperight.com/ap
plying-ai-for-social-good-to-solve-todays-global-challenges/
Kuo. (2022, March 29). AI Helps Ra-
diologists Detect Bone Fractures. Rsna.org
. https://www.rsna.org/news/2022/march/AI-çelps-Detect-Bone
-Fractures~:%:text=Arti#cialW20intelligenceW20(AI)W20isW20an
Lawler, R. (2023, May 10). Google’s new image search
tools could help you identify AI-generated fakes. The
Verge. https://www.theverge.com/2023/5/10/23718616/google-i
mage-search-veri#cation-about-this-metadata-io
Loe;er, J. (2023, June 13). Ai identifies 3 new Nasca lines hidden
in Peruvian desert. AI identi#es 3 new Nasca Lines hidden in Peru-
vian desert. https://interestingengineering.com/science/ai-identi#es
-new-nasca-lines
Lomas, N. (2023a, June 12). OpenAI, Deepmind and anthropic to
give UK early access to foundational models for AI Safety Research.
164 KRIS BALL

TechCrunch. https://techcrunch.com/2023/06/12/uk-ai-safety-res
earch-pledge/
Lomas, N. (2023b, June 14). Europe takes another big step toward
agreeing an AI rulebook. TechCrunch.
https://techcrunch.com/2023/06/14/europe-takes-another-big-step
-towards-agreeing-an-ai-rulebook/~:%:text=TheW20EuropeanW20Pa
rliamentW20hasW20voted,EYW20rulebookW20forW20arti#cialW20i
ntelligence.
Lorach, ç., Galvez, A., Spagnolo, V.[et al.[_alking naturally after
spinal cord injury using a brain@spine interface.[Nature 618, 126@133
(2023). https://doi.org/10.1038/s41586-023-06094-5
Malczyk, K. (2023, January 17). 7 ways Google is using AI to help
solve society’s challenges. Google. https://blog.google/technology/ai/
7-ways-google-is-using-ai-to-help-solve-societys-challenges/
Marr, B. (2023, March 22). Green Intelligence: Why Data And AI
Must Become More Sustainable. Forbes.
https://www.forbes.com/sites/bernardmarr/2023/03/22/green-inte
lligence-why-data-and-ai-must-become-more-sustainable/?sh=4d226
c8e7658
Martindale, J. (2018, August 12). Should you OK Google, Hey Siri,
or talk to Cortana? Here’s the top voice assistant. Digital Trends. https:
//www.digitaltrends.com/computing/cortana-vs-siri-vs-google-now/
Matias, |. (2020, August 20). Mapping wildfires with the power of
satellite data. Google. https://blog.google/products/search/mappin
g-wild#res-with-satellite-data/
Mauran, C. (2023, April 6). Whoops, Samsung work-
ers accidentally leaked trade secrets via ChatGPT. Mashable
ME. https://me.mashable.com/tech/26952/whoops-samsung-wor
kers-accidentally-leaked-trade-secrets-via-chatgpt
 TOMORRO_HS ARTIFICIAL INTELLIGENCE 165

McDermott, K. (2023, March 22). These are the new jobs generative
AI could create in the future. The Next _eb. https://thenextweb.co
m/news/new-jobs-generative-ai-future
Mehdi, |. (2023, February 7). Reinventing search with a new
AI-powered Microsoft Bing and Edge, your copilot for the web. The
O]cial Microsoft Blog.
https://blogs.microsoft.com/blog/2023/02/07/reinventing-search
-with-a-new-ai-powered-microsoft-bing-and-edge-your-copilot-for-t
he-web/
Miller, R. (2023, June 26). Adobe Indemnity Clause designed to ease
enterprise fears about AI-generated art. TechCrunch.
https://techcrunch.com/2023/06/26/adobe-indemnity-clause-desig
ned-to-ease-enterprise-fears-about-ai-generated-art/?guccounter=1Z
guceæreferrer=açR0cçM6Ly93d3cuU29vU2xlLmNvbS8Zguceære
ferreræsig=AQAAAçEl2PrfuIPF1gsmzICVE5yKv_GApYa7Cç|
kjPSEAA5pB35i93|8z6h7yQGGJGoS8zIIlkR72x6rdO65yæBqfmh
oh7B-kcGV0T1yUæçrKowF7U6rc1p571F_0eTv8æy3QsO4g1æ7n
KU IULvadmzzL03zLJh7bpDuwAclrDpzçpD
Milon, B. (2023, March 24). AI in Logistics: Benefits,
Challenges, Case Studies & Best Practices. The ILS Compa-
ny. https://www.ilscompany.com/ai-in-logistics/~:%:text=AIW20tec
hnologyW20hasW20transformedW20the
Mok, A. (2023, April 27). ChatGPT experience may be able to get
you that job. Business Insider. https://www.businessinsider.com/cha
tgpt-experience-wanted-by-employers-hire-study-2023-4
Niyazov, S. (2023, February 14). How A.I. Will Redefine
Economics. Medium.
https://towardsdatascience.com/how-ai-will-rede#ne-economics-ec3
05e3cb687~:%:text=AIW20willW20makeW20betterW20predictions
166 KRIS BALL

ODSC-Open Data Science. (2020, September 24). Introduction to

GPT-3. Medium. https://odsc.medium.com/introduction-to-gpt-3
-8f629ac975b8
Ortiz, S. (2023, June 20). Can ai-generated music win
a music award? the Grammys reveal new rules. UD-
NET. https://www.zdnet.com/article/can-ai-generated-music-win
-a-music-award-the-grammys-make-their-verdict/
Ouyang, A. (2023, January 20). MIT researchers develop an AI
model that can detect future lung cancer risk. MIT News é Massachu-
setts Institute of Technology. https://news.mit.edu/2023/ai-model
-can-detect-future-lung-cancer-0120
Peritz, A. (2022, September 6). A Fun, Easy New Way for Students
to Cheat. Slate Magazine. https://slate.com/technology/2022/09/ai
-students-writing-cheating-sudowrite.html
Perrigo, B. (2023, January 18). Exclusive: The $2 Per Hour Workers
Who Made ChatGPT Safer. Time. https://time.com/6247678/ope
nai-chatgpt-kenya-workers/
Pick the best stocks to beat the market. powered by explainable AI.
Danel#n. (n.d.). https://danel#n.com/
Precision Medicine. (n.d.). Exscientia. https://www.exscientia.ai/
precision-medicine
Published, T. M. (2023, January 9). This disturbing deepfake service
just took “creepy” to a whole new level. Creative Bloq. https://www.cr
eativebloq.com/news/deepfake-service
Ravindranath, M. (2023, June 2). Carbon health is already using AI
to write patient records. STAT. https://www.statnews.com/2023/06
/05/ai-medical-records-carbon-health/
Reuters. (2023, February 16). Tesla recalls 362,000 ve-
hicles over self-driving software flaws that risk crashes. The
 TOMORRO_HS ARTIFICIAL INTELLIGENCE 167

Guardian. https://www.theguardian.com/technology/2023/feb/16
/tesla-recall-full-self-driving-cars
Reuters StaX. (2016, July 27). IBM steps up efforts in fight against
Zika. Reuters. https://www.reuters.com/article/us-health-zika-ibm
-idYSKCN1071OT
Robinson, T., Z Bridgewater, S. (2023, May 26). Highlights from
The Raes Future Combat Air & Space Capabilities Summit. Royal
Aeronautical Society. https://www.aerosociety.com/news/highlight
s-from-the-raes-future-combat-air-space-capabilities-summit/
RubloX, M. (2023, May 4). Neural Fields For LiDAR
(NFL) Combines LiDAR With Neural Fields! Neural Radi-
ance Fields.https://neuralradiance#elds.io/neural-#elds-for-lidar-n 
-unveils-future-of-autonomous-driving/
Ruidong Uhang[et al. 2023. EchoSpeech: Continuous Silent
Speech Recognition on Minimally-obtrusive Eyewear Powered by
Acoustic Sensing. In[Proceedings of the 2023 CHI Conference on Hu-
man Factors in Computing Systems (CHI ’23) doi: 10.1145/354454
8.3580801
Sample, I. (2020, February 20). Powerful antibiot-
ic discovered using machine learning for first time. The
Guardian. https://www.theguardian.com/society/2020/feb/20/ant
ibiotic-that-kills-drug-resistant-bacteria-discovered-through-ai
Savage, M. (2023, June 13). Sir Paul McCartney says Artificial
Intelligence has enabled a “final” Beatles song. BBC News. https://
www.bbc.com/news/entertainment-arts-65881813
Shane, J. (2019, November 13). The danger of AI is weirder than
you think | Janelle Shane. |ouTube. https://www.youtube.com/wat
ch?v=OhCz 0iLnOc
168 KRIS BALL

Shweta. (2022, June 6). What Is A Chatbot? Everything You Need

To Know (K. Main, Ed.). Forbes Advisor. https://www.forbes.com/
advisor/business/software/what-is-a-chatbot/
The Most Useful Military Applications of AI. (2022, February 2).
Sentient Digital, Inc. https://sdi.ai/blog/the-most-useful-military-a
pplications-of-ai/
The Rise of ChatGPT (n.d.). Pomfret. Retrieved May 3, 2023,
from https://www.pomfret.org/post/%board/blog/post/the-future
-is-now-01-11-2023
The Rise Of ChatGPT - Fastest Growing App In History 2023 (2023,
April 13). Silver Lining. https://silver-lining.com/the-rise-of-chatgp
t-fastest-growing-app-in-history/
Silver, D., çubert, T., Schrittwieser, J., Z çassabis, D. (2018,
December 6). AlphaZero: Shedding new light on chess, shogi, and
Go. Deepmind. https://www.deepmind.com/blog/alphazero-shedd
ing-new-light-on-chess-shogi-and-go
Singer, N. (2023, June 8). New A.I. chatbot tutors could upend stu-
dent learning. The New |ork Times. https://www.nytimes.com/20
23/06/08/business/khan-ai-gpt-tutoring-bot.html
Strickland, E. (2023, June 16). The who, where, and how of regulat-
ing AI. IEEE Spectrum. https://spectrum.ieee.org/ai-regulation-wo
rldwide
Stupp, C. (2019, August 30). Fraudsters Used AI to Mim-
ic CEO’s Voice in Unusual Cybercrime Case. _all Street Jour-
nal. https://www.wsj.com/articles/fraudsters-use-ai-to-mimic-ceos
-voice-in-unusual-cybercrime-case-11567157402
Sweeney, B. (2023, April 5). The Rise of ChatGPT &
What it Means for the Future of AI and Software Testing.
Keysight. https://www.keysight.com/blogs/tech/software-testing/
2023/4/5/the-rise-of-chatgpt
 TOMORRO_HS ARTIFICIAL INTELLIGENCE 169

Tan, A. (2022, August 25). Dell’s deep learning model to support

Coral Reef Conservation: Computer Weekly. Computer_eekly.com
. https://www.computerweekly.com/news/252524201/Dells-deep-l
earning-model-to-support-coral-reef-conservation
The Pros and Cons of Using Artificial Intelligence in Sports Betting
(2023, April 24). Time News. https://time.news/the-pros-and-cons
-of-using-arti#cial-intelligence-in-sports-betting/
Tegmark, M. (2023, April 25). The “don’t look up” thinking that
could doom us with ai. Time. https://time.com/6273743/thinking-t
hat-could-doom-us-with-ai/
Thomas, M. (2021, July 21). The future of artificial intelligence.
Built In. https://builtin.com/arti#cial-intelligence/arti#cial-intellige
nce-future
Timothy, M. (2023, March 14). What Is Google LaMDA AI?
MYO. https://www.makeuseof.com/what-is-google-lamda-ai/
Toews, R. (2020, May 25). Deepfakes Are Going To Wreak Havoc
On Society. We Are Not Prepared. Forbes.
https://www.forbes.com/sites/robtoews/2020/05/25/deepfakes-are
-going-to-wreak-havoc-on-society-we-are-not-prepared/?sh=184f8cX
7494
Trafton, A. (2020, February 20). Artificial intelligence yields new
antibiotic. MIT News. https://news.mit.edu/2020/arti#cial-intellig
ence-identi#es-new-antibiotic-0220
Vedantam, K. (2023, June 14). Is AI the cause of job cuts this year?.
Crunchbase News. https://news.crunchbase.com/ai-robotics/arti#c
ial-intelligence-layoXs-job-market/
Verma, P. (2023, April 5). ChatGPT invented a sexual harass-
ment scandal and named a real law prof as the accused. _ashington
Post. https://www.washingtonpost.com/technology/2023/04/05/c
hatgpt-lies/
170 KRIS BALL

Vieira Santos, A. AkwyU . (2023, June 11). Hundreds attend #AI

church service in Germany. Tweet . Twitter. https://twitter.com/Ak
wyU/status/1668301333886119958
Vincent, J. (2023a, February 6). Getty Images sues AI art gen-
erator Stable Diffusion in the US for copyright infringement. The
Verge. https://www.theverge.com/2023/2/6/23587393/ai-art-copy
right-lawsuit-getty-images-stable-diXusion
Vincent, J. (2023b, May 19). Apple restricts employ-
ees from using ChatGPT over fear of data leaks. The
Verge. https://www.theverge.com/2023/5/19/23729619/apple-ba
ns-chatgpt-openai-fears-data-leak
Vincent, J. (2023c, June 8). Blackmailers are using deep-
faked nudes to bully and extort victims, warns FBI. The
Verge. https://www.theverge.com/2023/6/8/23753605/ai-deepfak
e-sextortion-nude-blackmail-fbi-warning
_arwick, K. (n.d.). The Future of Artificial Intelligence and Cyber-
netics. OpenMind. https://www.bbvaopenmind.com/en/articles/th
e-future-of-arti#cial-intelligence-and-cybernetics/
_elding, L. (2023, March 27). Half of College Students Say Using
AI Is Cheating. (R. Johnson, Ed.). Bestcolleges.
https://www.bestcolleges.com/research/college-students-ai-tools-sur
vey/~:%:text=çalfW20ofW20CollegeW20StudentsW20SayW20Ysing
W20AIW20onW20SchoolworkW20Is
What is a Chatbot? (2014). Oracle.com. https://www.oracle.com
/ae/chatbots/what-is-a-chatbot/
What is Natural Language Processing? (2023). IBM. https://ww
w.ibm.com/topics/natural-language-processing
_hiting, K. (2023a, March 1). AI is helping to identify skills gaps
and future jobs. An expert explains how. _orld Economic Forum. ht
tps://www.weforum.org/agenda/2023/05/ai-skills-gaps-future-jobs/
 TOMORRO_HS ARTIFICIAL INTELLIGENCE 171

_hiting, K. (2023b, March 2). 3 new and emerging

jobs you can get hired for this year. _orld Economic Fo-
rum. https://www.weforum.org/agenda/2023/03/new-emerging-jo
bs-work-skills/~:%:text=greenW20energyW20sectors.-
_illiams, O. (2023, June 8). Charlie Brooker got ChatGPT to write
a black mirror episode, but it was “shit” – exclusive image. Em-
pire. https://www.empireonline.com/tv/news/charlie-brooker-chat
gpt-black-mirror-episode-exclusive-image/
|ouTube. (2023). Sam Altman’s World Tour, in 16 Moments.
YouTube. Retrieved June 19, 2023, from https://www.youtube.com
/watch?v=3s_ç2e5xpdo.