Download as pdf or txt
Download as pdf or txt
You are on page 1of 31

@

Thursday, February 8, 2024


Rajab 27, 1445 AH www.dailytrust.com
N250
Vol. 60, No. 15
32
PAGES

Abuja unsafe – Senate Forex crisis: Nothing for Senegal: US,


3 soldiers killed in Nasarawa Nigeria as our crude oil CDD condemn
NSA seeks UK help for security sold in advance – NGF presidential poll shift
PAGE 6>> PAGE 19>> PAGE 8>>

Bandits threaten to marry


bride, sell 62 wedding guests
Demand N100m ransom Page 4>>>

Nigeria beat S/Africa to set up AFCON final with Cote d’ Ivoire P 31

5 months after, Tinubu yet to


replace recalled ambassadors
We do things upside down in Nigeria – Ex-envoy New ones to be announced soon – Minister’s aide Page 3>>>
@
LAGOS EDITION

Thursday, February 8, 2024


Rajab 27, 1445 AH www.dailytrust.com
N250
Vol. 60, No. 15
32
PAGES

Abuja unsafe – Senate Forex crisis: Nothing for Senegal: US,


3 soldiers killed in Nasarawa Nigeria as our crude oil CDD condemn
NSA seeks UK help for security sold in advance – NGF presidential poll shift
PAGE 6>> PAGE 19>> PAGE 8>>

Bandits threaten to marry


bride, sell 62 wedding guests
Demand N100m ransom Page 4>>>

Nigeria beat S/Africa to set up AFCON final with Cote d’ Ivoire P 31

5 months after, Tinubu yet to


replace recalled ambassadors
We do things upside down in Nigeria – Ex-envoy New ones to be announced soon – Minister’s aide Page 3>>>
PAGETWO Thursday, February 8, 2024

FOOD FOR THOUGHT AFRICAN SAYINGS


The way I see it, if you The talk coming out of your mouth is
want the rainbow, you not something you can carry on your
gotta put up with the
rain head (African Proverbs)
— Dolly Parton Source: BBC
WEATHER Compiled by JAMIL H. SALIM
ABUJA KADUNA KANO MAIDUGURI JOS SOKOTO IBADAN ENUGU P/HARCOURT LAGOS

MOSTLY SUNNY MOSTLY SUNNY MOSTLY SUNNY MOSTLY CLOUDY SUNNY MOSTLY SUNNY SUNNY SUNNY MOSTLY CLOUDY SUNNY

34 18 30 16 27 14 29 14 26 11 30 17 37 21 35 19 34 21 35 24
MAX MIN MAX MIN MAX MIN MAX MIN MAX MIN MAX MIN MAX MIN MAX MIN MAX MIN MAX MIN
(Temperature in centigrade)

PRAYERS TIMES RAJAB 27, 1445 AH

PRAYERS ABUJA ENUGU KADUNA KANO KATSINA LAGOS MAIDUGURI P/HARCOURT SOKOTO
FAJR 5:41 5:47 5:41 5:39 5:44 5:53 5:19 5:36 5:53
DHUHR 12:52 12:49 12:49 12:45 12:49 1:05 12:25 12:51 12:58
ASR 4:08 4:05 4:05 4:01 4:05 4:21 3:41 4:07 4:14
MAGHRIB 6:40 6:42 6:36 6:30 6:32 6:57 6:10 6:45 6:41
ISHA 7:45 7:47 7:41 7:35 7:37 8:02 7:15 7:50 7:46
SOURCE: Society for the propagation of Islam, Kaduna

PHOTO
OF THE
DAY

 People picking tiger


nut as fleeing motorist
hit road side trader
along Nyanya road in
Abuja yesterday

Photo: Onyekachukwu Obi

STOCK INDEX
GAINERS MEYER TRIPPLEG JULI CORNERST AFRIPRUD LOSERS AIICO CADBURY SOKOTO
GUINEAINS TANTALIZER HONYFLOUR
CURRENT N5.72 N4.13 N0.84 N2.23 N8.75 CURRENT N1.18 N21.90 N0.51 N0.42 N4.01
CHANGE 0.52 0.37 0.07 0.18 0.70 CHANGE -0.13 -2.30 -0.05 -0.04 -0.30
%CHANGE 10.00% 9.84% 9.09% 8.78% 8.70% %CHANGE -9.92% -9.50% -8.93% -8.70% -6.96%

NO, THANK YOU!


Media Trust Limited journalists have pledged to uphold the Company’s policy of not asking or
e l p us
taking a gift by whatever name, from those they encounter in the course of their work. H uce
Please assist us by not seeking to influence our reporters and editors with your favours. Where they prod apers
p
news u can
can, our journalists are expected to graciously decline a gift. When it is pressed on them, they are
expected to declare it. The Company will write a letter thanking the giver and donating the amount
to charity. yo st.
tru
Report anyone who claims to be our staff, but engages in unethical conduct. To blow the whistle,
send an SMS to 08035896941, 08055497449 or an email to whistleblower@dailytrust.com
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 3
IN-DEPTH
5 months after, Tinubu fails to
replace recalled ambassadors
We do things upside down in Nigeria – Ex-envoy
New ones to be announced soon – Minister’s aide
By Joshua Odeyemi the Afe Babalola University, finely. There are no lapses
Ado-Ekiti, Professor Damilola anywhere.”

F
ive months later, Olawuyi (SAN), recalled that While assuring that the
President Bola Tinubu President Tinubu took office relationship between Nigeria
is yet to appoint new with a vow to put international and host governments was intact
ambassadors after recalling all diplomacy at the centre of the despite not having ambassadors
those representing the country country’s development strategy. in place in the foreign missions,
around the world. He said, “There have indeed he said, “That is why we have a
Recall that President Tinubu been positive signs of such mission or an embassy in the
on September 2, 2023, ordered increased global engagements, country. There are people who
the recall of all Nigeria’s with Nigeria playing key roles are working in those embassies.
ambassadors and envoys with in landmark international Like I told you, everything is
immediate effect. summits such as the United going on fine.”
Daily Trust reports that Nations General Assembly in Daily Trust further reports
Nigeria has 109 diplomatic New York and the most recent that in December, 2022, a report
missions worldwide comprising COP-28 in Dubai, United Arab published by this newspaper
76 embassies, 22 high Emirates (UAE). showed that Nigerian embassies
commissions and 11 consulates. “However, 2023 was generally and consulates were in a sorry
Since independence in a slow and underwhelming state and soiled by corruption.
1960, Nigeria has maintained start in terms of a clear and The report was anchored
diplomatic ties with many discernible foreign policy by #OurVotesCount (OVC),
countries. Even though there agenda. Early blunders such an initiative of the National
have been reports of dearth of as the outrage and backlash Association of Seadogs (NAS).
activities at some of Nigeria’s that trailed the rushed recall of  Ambassador Yusuf Tuggar The independently funded
embassies, high commissions Nigerian ambassadors were a some months after recalling He said, “Their replacements report on some selected
and consulates, experts who preventable embarrassment for the serving ones, the diplomat are being worked on by Nigerian missions, titled:
spoke to Daily Trust said a country of Nigeria’s stature. noted that it took a long time to President Tinubu. Very soon “State of Nigerian embassies
countries were taken more “Furthermore, more than six replace an ambassador. new ambassadors would be and consulates, 2022”, was
seriously when they were visible months after taking office, many He explained that, “You don’t announced.” presented by a former Nigerian
diplomatically. of our diplomatic missions have just call somebody and say, He explained that there Ambassador to Mexico, Ogbole
While asking Nigeria’s no clear leadership structure in ‘You, go to America.’ When you was no delay in the process Amedu-Ode, at an event in
diplomats to come back place, while uncertainties also agree on the person you want of appointment of new Abuja.
in September, presidential surround our representation in to send, you have to send his ambassadors, adding that, “It is The report reads in part:
spokesman, Ajuri Ngelale, the UN bodies. papers and every other thing to a natural process.” “Although not in high
in a statement, said, “The “This means that no matter the country, and until they (the He further said, “The proportion as with the case
president is determined the excellent progress the receiving country) accept, you task of selecting those who in most public institutions at
to ensure that world-class president makes when he don’t announce. will represent Nigeria is not home, the research found that
efficiency and quality will embarks on foreign missions, “It is when they have something that can be done in some Nigerian embassies and
henceforth characterise foreign there is little or no structure in concluded all the work, the a day. You have to look at the consulates are also soiled by
and domestic service delivery place for clear and actionable background and everything, track record of these people; you corruption.
to citizens, residents and follow-up. because we do the same thing. have to look at their loyalty and “There are reported cases of
prospective visitors.” “No country will feel When they want to nominate relationship to the government visitors being asked to pay non-
He said the decision was confident to engage with an somebody, they send all the of Nigeria; you have to do official fees for services that
sequel to a careful study of ambassador whose future is details and we tell our NIA and security checks; you have to do should either come for free or
the present state of affairs hanging in the balance. There DSS to check on the person. background checks up to their cheaper.”
at Nigerian consulates and is, therefore, an urgent need This could take six months, primary schools, because these The report also noted
embassies worldwide. to resolve the appointment of some have taken one year.” people will be representing that Nigerian embassies and
A former diplomat, who new and returning ambassadors Meanwhile, a source at the Nigeria.” consulates were poorly funded,
spoke to Daily Trust on as soon as possible, including Ministry of Foreign Affairs told Abdulkadir rejected the claim stressing that most of them were
condition of anonymity, said Nigeria’s representation at UN Daily Trust that, “Meetings have that activities had been on hold housed in unbefitting structures.
the long delay in appointing bodies such as WTO, WIPO been going on with stakeholders in Nigerian missions across the The report also noted
ambassadors could affect the and UNESCO.” to ensure that the right people world as a result of the delay non-digitisation of services,
relationship between Nigeria ‘We do things upside down are appointed for the job in in the appointment of new unavailability of courier
and some countries as some in Nigeria’ line with the president’s foreign ambassadors. services, outdated queuing
countries might not be open A former Nigerian policy direction. He said, “There are officers procedures and biometric-
to deal with a lower diplomatic Ambassador to the United “These people are going to be that have continued their work related inefficiencies, lack of
representation in their dealings States (US), Joe Keshi, expressed from all the 36 states, including because they are staff of the good physical infrastructure,
with a country. reservation over the rationale the FCT. Some of them are Ministry of Foreign Affairs. In poor internet and information
He said, “A Charge d Affairs behind the recall of all the career ambassadors and some the last month, I have gone to technology facilities, limited
may not be allowed to have ambassadors at the same time are non-career ambassadors.” about four missions and things level of interaction between
meetings with a foreign minister considering the work that ‘New ones to be announced are going on. The work is going embassy officials and Nigerians
of the host country because his would go into trying to replace soon’ on. in the diaspora and poor staff
position is just equivalent to them at the same time. Corroborating what the “I just came back from Saudi attitude.
that of a director. So, he may Keshi said, “Nigeria is a foreign affairs ministry’s source Arabia; all the meetings that The report recommended
have limitations in handling unique country; we do things said, Alkasim Abdulkadir, the the minister had were handled the elimination of bureaucratic
serious issues which require upside down. Now, replacing spokesman to the Minister of by the staff of the mission; the bottlenecks and delays that
higher authority from his host them is a headache. That is why Foreign Affairs, Yusuf Tuggar, acting ambassador and the make it possible for corrupt
country.” under Gen Sani Abacha they said there was no cause for consul-general. tendencies, especially with
While speaking with a didn’t make that mistake…” alarm as the government was “The chargés d’affaires regards to the imposition
national daily recently, a Deputy On the implication of not working on the appointment of have taken on the work of the of extra charges for express
Vice Chancellor (DVC) at naming new ambassadors new ambassadors soon. ambassadors very well and services.
NEWS
Like us on Facebook.com/dailytrust
4 follow us on Twitter: @daily_trust
Thursday, February 8, 2024

Bandits threaten to marry bride, sell 62 wedding guests


From Tijjani Ibrahim, Katsina

T
he bandits who abducted
women accompanying a
bride to her matrimonial
home at Damari, Sabuwa LGA
of Katsina State last Thursday
have released a video showing
the captives.
In the video, which is
currently trending on social
media, the bandits threatened
to tie the wedding knot between
the already married lady and
one of them, unless relations
of the captors paid a ransom of
N100 million to them.
Similarly, the outlaws vowed
to sell off the ‘62 wedding guests’
that were kidnapped alongside
the bride, if their demands were
not met.
During last Thursday’s
attack on the wedding convoy,
four members of a vigilante
group were reportedly killed
and no fewer than 55 wedding  Missing travelers and their relatives after released by the military in Jos yesterday Photo: Ado A. Musa
guests, including children, were necks, while the bride was seen have such funds.” attacks and abductions by bandit handed over to the Katsina State
snatched, and have since then dressed in an army uniform, He also said the kidnappers groups has increased in Katsina governor.
been held hostage, according to with one of the bandits saying told him they shot the video as a State, after months of relative Speaking to newsmen on
villagers. “Here is the bride adorned in challenge to the state governor, decline in the incidences. the incident, the Katsina State
The victims, including friends army uniform”. Dikko Umar Radda, who was It could be recalled that Commissioner for Internal
of the bride from Dandume, The captives were heard reported to have vowed to around the time of the wedding Security and Home Affairs, Dr
were ambushed at Sabuwa while pleading for help; asking their rescue the victims. guests’ abduction, some Nasiru Mu’azu Danmusa, said
travelling in an open van. relations to pay the ransom. “They said they made the assailants, believed to be in the government officials had met
In the footage, a gang leader, The driver of the vehicle that video to demonstrate their Siddi Forest, attacked Tashar with security agents and were
cladded in police uniform, put conveyed the wedding guests, seriousness to the governor,” Nadaya, near the Gazari District devising ways of rescuing the
the captives’ number at 63. was also seen in the video Abdullahi said, expressing border in Sabuwa LGA. captives unharmed.
He taunted the government carrying a gun, pleading that appreciation for the governor’s In this separate incident, a He appealed to the relatives of
saying they would marry off the ransom be paid. concern and promise of commercial motorcycle rider the captives to exercise patience,
the bride if the ransom was not The bride’s family confirmed rescuing the victims. lost his life and his bike was saying that rescuing the
paid. that the terrorists were Abdullahi disclosed that stolen. abductees was not something
“I am the one who abducted demanding a ransom of N100 among those abducted were The attackers also targeted that could be achieved
them, and I will never release million for the release of all the eight of his sisters and nine a group of four individuals, overnight.
them until ransom is paid. And captives. daughters. opened fire at them, and seized When contacted for reaction,
if there is anyone who thinks Haruna Abdullahi, an uncle Another family member, who their motorcycles. the police spokesman in
they could rescue them, they of the bride, stated: “They are simply identified himself as Similarly, armed bandits Katsina, ASP Abubakar Sadiq
should try it,” he said. asking for N100 million as Zubairu, revealed that his wife, had kidnapped 30 people from Aliyu, promised to reply to our
Also in the footage, some ransom. None of us has ever six children and 13 relatives Tasharnagulle village in Batsari enquiry regarding their efforts
of the captives were seen with seen that amount of money; so I were among the abductees. LGA of the state. They were but did not do so up to the time
AK-47 rifles hung around their told them directly that we don’t In recent times, the rate of later rescued by the military and of filing this report.

Why S/Court justices are yet to be Cancer: FG partners


inaugurated 48 days after Senate clearance pharmaceutical companies on
By John C. Azu 21, 2023, confirmed the fiat issued to Justice heard is that by the end of high medicine costs
Haruna Tsammani (North Mohammed Idris, who this month, they will do By Ojoma Akor
Some insights have East); Moore Adumein was already elevated to the all,” he said.
emerged about the delayed (South South); Jummai Court of Appeal to return A staff member of The Minister of State for Health and Social Welfare,
inauguration of the newly Sankey (North Central); under Section 396(7) of the Supreme Court, Dr Tunji Alausa, has said the federal government
appointed 11 justices Chidiebere Uwa (South the Administration of who pleaded anonymity, is collaborating with various partners, including
confirmed by the Senate in East); and Chioma Nwosu- Criminal Justice Act, 2015 confirmed that none of the pharmaceutical companies, to reduce the costs of
December last year despite Iheme (South East) to conclude Kalu’s trial was vehicles for the new justices cancer medications and care in the country.
the gap in the Supreme Others are Obande a fundamental breach of has been purchased unlike He stated this yesterday during the World Cancer
Court. Ogbuinya (South East); the constitution. previous appointments as Day Symposium organised by Project Pink Blue
Daily Trust gathered Stephen Adah (North “So, the Supreme Court each justice is usually given with the theme as ‘Economy, Tax and Cancer
that some issues of Central); Habeeb Abiru management said let the three SUVs. Control: The Exit of Pharmaceutical Companies
accommodation and (South-West); Jamilu justices go and complete “They don’t come with from Nigeria’.
logistics are part of the Tukur (North West); their cases before being their vehicles from the He said the government was reviewing the
reasons for the delay in Abubakar Umar (North appointed,” he said. Court of Appeal; new ones country’s pharmaceutical laws to create regulations
inaugurating the new West); and Mohammed Explaining what he had to be provided for that would encourage local production of
justices. Idris (North Central) knows about the delay, a them,” he said. pharmaceuticals.
With 10 out of the A staff member of the Senior Advocate of Nigeria, He added that there is The executive director of Project Pink Blue,
constitutionally required Federal Judicial Service Murtala Abdulrasheed, a petition against one of Runcie Chidebe, expressed concern over the exit
21 justices left at the Commission (FJSC), who said there was no release the justices, which is being of pharma companies from Nigeria and its dire
Supreme Court going pleaded anonymity, said of funds for furnishing of sorted out. implications on the economy and the cost of cancer
into the appeals of last the delay was to enable comfortable apartments, Efforts made to obtain medications.
year’s general elections, the justices conclude their offices and purchase of the reaction of the Director He said the exit of the pharmaceutical companies
public outcry led to an outstanding cases at the vehicles for the newly of Information of the has caused an astronomical increase in the prices of
accelerated nomination Court of Appeal to avoid elevated justices. Supreme Court, Dr Festus drugs up by 200% or more.
and confirmation of the 11 the Orji Uzor Kalu scenario “The justices have not Akande were unsuccessful He said it is therefore worrisome how a population
justices. in May 2020. been provided with the as he was said to be of largely poor people can keep affording life-saving
The Senate on December He explained that tools to work; but what I indisposed. medicines.
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust NEWS 5
9 missing Bauchi Kano assembly urged to reinstate deposed emir Sanusi, dissolve new emirates
travelers found in Jos From Ahmad Datti, Kano Ganduje later split Kano emirate into of Assembly in the issue of emirate
five and appointed four more emirs for management. However, we humbly
From Hassan Ibrahim, men had been found. A group called Yan Dangwalen Jihar Gaya, Karaye, Bichi and Rano emirates. request your esteemed Assembly to
(Bauchi) & Ado A. Musa He said they were Kano has asked the Kano State House In a letter addressed to the Speaker revisit and reconsider the decision to
(Jos) arrested by Operation Safe of Assembly to reinstate the deposed of the assembly and signed by the remove HRH Sanusi Lamido Sanusi
Haven, maintaining peace Kano emir, Muhammadu Sanusi, and group’s chairman, Najib Abdulkadir from the throne.

T
he nine youths in the state.He said they dissolve the new emirates in the state. Salati, they said the removal of Sanusi “We believe that his reinstatement
from Kirfi LGA were released four days The state government led by the from the throne has caused division, will foster unity, peace, and stability
of Bauchi who after they were detained then Governor Abdullahi Ganduje had unrest and unnecessary tension among within Kano State and its neighbouring
were declared missing in by the military. on March 3, 2020, dethroned Sanusi the people. communities,” the group said.
Plateau State have been When contacted, the for showing “insubordination’’ to the “We would like to request a review When contacted, the chief press
found in Jos. spokesman of Operation authorities in the state. and potential dissolution of the secretary, Kano State House of
Daily Trust had Safe Haven, Captain Oya Sanusi’s supporters believe he was additional emirates. Assembly, Kamaludeen Sani Shawai,
reported on Wednesday James, neither answered sacked for opposing Ganduje’s re- “We acknowledge the rightful said he had not seen the letter
how the travelers were calls nor replied to a election bid. authority of the Kano State House personally, promising to get back.
declared missing on message sent to his phone
Saturday after leaving their
hometowns for Nasarawa
regarding the accusation
that the youths were
NESREA seals off 15 facilities over environmental infractions
State to earn a living. tortured. By Terkula Igidi Federal Capital Territory (FCT) over abate their environmental infractions
The Chairman of The father of one of the violations of environmental laws. after a series of compliance concern
Kirfi Local Government victims, Ahmed Ibrahim, The National Environmental The Director General of NESREA, notices had been issued to them.
Council, Alhaji also confirmed the release Standards and Regulations Professor Aliyu Jauro, who briefed the He stressed that the agency had
Abdulkadir Umar Dewu, of the youths to Daily Enforcement Agency (NESREA), media after the enforcement exercise, followed due process in clamping
confirmed that the young Trust. Wednesday, sealed 15 facilities in the said the facilities affected failed to down on the establishments.
6 NEWS Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024

Abuja unsafe – Senate


By Abdullateef Salau,
Balarabe Alkassim,
Idowu Isamotu, Abbas
Jimoh (Abuja) & Umar
Muhammed (Lafia)
3 soldiers, 2 vigilantes killed in Nasarawa NSA seeks UK help for security
T
he Senate yesterday
declared that the to invite you to brief us on those behind the attack on
nation’s seat of the efforts to tackle this Katakpa village.
power, the Federal Capital menace. NSA seeks UK help
Territory (FCT), Abuja, “While we welcome you, In the meantime, the
is under threat while we are not passing the buck, National Security Adviser,
expressing worry over the we are not blaming you. But Nuhu Ribadu, has sought
country’s acute insecurity. you are not complete. the support of the United
The President of the “We want you to know Kingdom with a view to
Senate, Godswill Akpabio, that we represent the addressing some security
said the FCT has been Nigerian people and we will challenges currently
infiltrated in places like only do their will. The Senate facing Nigeria, including
Kubwa, Bwari and other is of the view that the FCT is kidnapping, terrorism,
areas. under threat,” he said. banditry and oil theft.
He was speaking before Akpabio, thereafter, Ribadu, who convened
the Senate adjourned its directed the clerk of the the second edition of
briefing with heads of Senate to inform those the UK-Nigeria Security
security agencies to next invited to be present next Defence Partnership
week over the absence of the week. Dialogue in Abuja on
National Security Adviser Reps invite Wike, others Wednesday, explained that
(NSA), Nuhu Ribadu and Meanwhile, the House of the dialogue was in a decisive
Chief of Defence Staff, Representatives has resolved move to address the security
Christopher Musa. to also invite the Minister of challenges facing Nigeria
The Red Chamber had the FCT, Nyesom Wike, the and bolster regional and
last week summoned the National Security Adviser international security.
security chiefs to brief it and heads of all security On his part, the UK
on the rising insecurity agencies for an emergency National Security Adviser,
in Nigeria and efforts security briefing and strategy Tim Barrow, said his country
to address the spike in against the rising insecurity operates in a relationship
killings and kidnappings in in the nation’s capital. of mutual respect and
many parts of the country, It also mandated the supportiveness and shares
including the FCT. minister to install security a determination to make
The security meeting cameras around the FCT and its contributions separately
was postponed to February its environs as well as other and together to a better
13 after the Senate had security gadgets and equip world and to peace, security,
admitted those present into security personnel with stability and prosperity for
the chamber. modern security equipment all.
Those in attendance were to combat the rising and Meanwhile, the
Taoreed Lagbaja, Chief of frightening insecurity within presidential candidate of
Army Staff; Emmanuel the territory and its environs, the Labour Party (LP) in
Ogalla, Chief of Naval including the use of drones. the 2023 elections, Mr Peter
Staff; Hassan Abubakar, 3 soldiers, 2 vigilantes Obi, has said the government
Chief of Air Staff; Kayode killed in Nasarawa must evolve more serious
Egbetokun, Inspector- Just as the National and innovative strategies for
General of Police (IGP), Assembly worked to find dealing with this climate of
and Yusuf Bichi, Director- a solution to insecurity, a insecurity.
General of the Department suspected militia group in He said this on Wednesday
of State Services (DSS). Umaisha District, Toto LGA on his X handle.
Akpabio said the of Nasarawa State killed three
interactive session with soldiers and two vigilantes.
heads of security agencies Daily Trust reported that
was shifted because some of on February 1, 2024, some
those invited did not show yet-to-be-identified gunmen
up. murdered three persons and
He said the chief of destroyed property worth
defence staff, director millions of naira in an attack
general of the National on the village.
Intelligence Agency (NIA), Our correspondent learnt
Ahmed Rufai and defence that gunmen also launched
and police affairs ministers an attack recently on Okudu
needed to be present in village and killed several
order to have a holistic people.
review of the situation. Some army personnel
Speaking before had been deployed in
adjourning the security Katakpa and Okudu villages
briefing, the Senate president to maintain law and order
said “The situation is following the persistent
worrisome in Agatu, in communal crisis in the area.
Taraba, Oyo, Plateau, The Chairman of Toto
Mangu, Bokkos, Barkin LGA, Mr Abdullahi Aliyu-
Ladi. We also heard about Tashas, who confirmed
the infiltration (of bandits) the soldiers’ killing to
into the Federal Capital our correspondent on
Territory (FCT) in places like Wednesday, said some
Kubwa and Bwari. hoodlums ambushed the
“We have heard reports military men who were on
that they have cells where patrol.
they are congregating. Meanwhile, the Bassa
“We have also heard the Cultural Development
efforts of the security chiefs Union (BCDU), has called
and the security agencies on Governor Abdullahi
but reports are becoming Sule of Nasarawa State to as
worrisome and we decided a matter of urgency fish out
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 7
FOCUS ON GOMBE
-HZHOLQWKH6DYDQQDK EVERY THURSDAY
Co-created
CONTENT

How Inuwa Yahaya’s Capital Market Drive Sparks


Optimism for Sustainable Growth in Gombe
G
ombe State last week made water management, climate change Experts agreed that the recourse to Security Tracker among others are
an ecstatic appearance at the adaptation, energy efficiency, the capital market by Gombe holds indicative of the impressive enabling
capital market with a three- sustainable waste management, several opportunities for the state and environment.
in-one programme aimed at sustainable land use, biodiversity the sub-region. Lawal assured that the capital market
significantly reengaging the private conservation and any other categories Chairman, Nigerian Exchange Group would support Gombe in realising its
sector for the development of the state. as may be approved by Nigeria’s apex (NGX Group) Plc, Dr. Umaru Kwairanga dreams of a vibrant and prosperous
The state unveiled plans to raise capital market regulator, Securities and said underscored the importance economy.
about N30 billion from the capital Exchange Commission (SEC), from time of appropriate financing to unlock Experts said Yahaya, who doubles as
market to invest in major infrastructural to time. Nigeria’s vast potential across the states. the Chairman of Northern Governors
projects aimed at fostering sustainable Adaptation, energy efficiency, According to him, Nigeria is one Forum, could be the pathfinder for the
development. The state has also sustainable waste management, of the best investment destinations region, which growth rate belies its huge
launched a strategic private-public sustainable land use, biodiversity globally as it is blessed with abundant potential. Gombe shares boundaries
partnership drive to encourage private conservation and any other categories human and natural resources. with Yobe, Borno, Adamawa, Taraba
investments in key sectors of the state as may be approved by Nigeria’s apex “We have vast lands for agriculture and Bauchi states, all with vast climate-
economy. capital market regulator, Securities and and food production, almost every kind related potential, including agro-energy
Gombe State Governor, Muhammadu Exchange Commission (SEC), from time of mineral resources that you can think projects.
Inuwa Yahaya, who outlined the state’s to time. of, and a large hardworking populace,” Yahaya, whose state is credited as the
economic development blueprint at Inuwa explained that the green Kwairanga said. most peaceful state in the country, has
interactive sessions with capital market bond is aimed at raising funds for eco- He commended the visionary been commended for his leadership
stakeholders and strategic investors at friendly and environmentally friendly leadership of Yahaya, noting that with style and is seen as a leading influencer
the Nigerian Exchange (NGX) in Lagos, investments, especially in assets that a leader like him and an investor- within the region.
said the state could raise funds through will contribute to restoration and „ Governor Inuwa Yahaya friendly President Tinubu, the dream Chief Executive Officer, Centre for
ordinary and alternative bond issuances. upliftment of human life so that the of inclusive development will become the Promotion of Private Enterprise
While the initial target is a N30 billion state can reduce the impact of climate market potential for different goods and more realistic. (CPPE), Dr. Muda Yusuf, said accessing
ordinary bond, the state could adopt a change and global warming. services and as a veritable emerging He said the next growth engine of the the capital market by subnationals is a
mixed issuance of ordinary bond and He said the state was building on its market. world is Africa and this is going to be led welcome idea.
Sukuk, to meet the diverse demand of hugely successful private investment He pointed out that Gombe has been by Nigeria. “It could be helpful, especially for
the investing public. campaign, known as GoInvest 1.0, ranked as the best state in Nigeria in Managing Director, Backbone infrastructure projects. Not many states
Gombe plans to float green bonds to launched in 2022, with the roll out the Ease of Doing Business (EoDB) for Connectivity Network Nigeria, Ibrahim have the cash flow to fund infrastructure
fund many sustainable development of GoInvest 2.0, which holds several two consecutive years. It was ranked Dikko, said the company was investing projects and complete in record time,”
projects. The northeastern state has investment opportunities for investors. fifth out of 36 states under the fiscal in Gombe because of the huge potential Yusuf said.
budgeted about N120.7 billion for “With the support we saw and the transparency and integrity index. of the state. He, however, noted the need to ensure
capital projects in the year, targeting acceptance by the Nigerian capital The index tracked accessibility, open “We have just signed an agreement that the subnationals have the capacity
infrastructural projects across key market stakeholders, we are going to hit budget, public procurement, human with the Gombe State Government to to repay the debts and such repayment
sectors of roads, healthcare and our target,” Yahaya said. resources, anti-corruption and citizens’ position the state as a technology hub arrangement securely settled within the
education among others.The admixture He said the capital market is the ideal engagement. for Northeast Nigeria,” Dikko said. processes of the state governance.
of green bond and Sukuk fits the place for the governments and private According to him, Gombe presents Group Managing Director, GTI With the Gombe State Investment
geographical and geopolitical leanings sector to pool funds for development, several investment opportunities, Capital Group, Mr. Abubakar Lawal, Promotion Agency, which was
of the state. assuring that Gombe State will continue including tomatoes value chain and who was at the closing gong ceremony established on December 22, 2023,
Under Nigeria’s green bond regulatory to engage the market as strategic partner livestock. during which Yahaya emphasised the expected to begin full operations this
framework, a green bond is defined in its development programme. He pointed out that the state has the state’s readiness for private investors and month, the state appears to be living up
as any type of debt instrument, the He outlined that the state has several largest grazing reserve in Nigeria with beat the gong to signal close of the stock to its commitments to provide investors’
proceeds of which would be exclusively competitive advantages for investors, 146,000 hectares of land, comprising six market for the day, said Gombe was an friendly environment. The agency
applied to finance or re-finance in part including being one of Nigeria’s most veterinary clinics, milk collection centre attractive destination for investors. will streamline processes for investor
or in full new and or existing projects diverse and peaceful states, home and modern abattoir and 16 boreholes. According to him, the state’s facilitation, including land acquisition,
that have positive environmental to several multinationals, access to He said the government’s top rankings by many reputable permits, licenses, and access to essential
impact. international markets, abundant commitment to maintaining peace institutions, including United Nation services with a view to supporting
The rules indicated that green bonds natural resources, central location and fostering a business friendly Development Programme (UNDP), investors’ initiatives efficiently.
would be used exclusively to finance within the northeastern region, low-risk environment has been a key factor Ease of Doing Business and Fiscal — Culled from a news analysis
renewable and sustainable energy, investment environment, skilled, young in ensuring the state’s security and Transparency and Integrity Index and by Taofik Salako of the the Nation
clean transportation, sustainable and available workforce, clear and large attractiveness to investors. Council on Foreign Relations’ Nigeria Newspaper

Gombe Governor Pays Condolence Visit


to Yobe over Demise of Ex- Governor
Gov. Inuwa Rescues Gombe Communities
from Decades-Long Devastation
Governor Muhammadu Inuwa
Yahaya is currently constructing of
a N2.4bn four-span bridge at Hayin
Kwarin Misau, a densely populated
Suburb of Gombe Metropolis.
This vital infrastructure project,
when completed, will connect
Hayin Kwarin Misau, BCJ, and Bogo
Communities with other parts of
the metropolis to offer a lifeline to
„ L- R: Governor Mai Mala Buni, Governor Inuwa Yahaya, Speaker of Gombe State thousands of residents plagued by a
House of Assembly, Hon. Abubakar Mohammed Luggerewo and Chief of Staff to devastating gully erosion for decades.
Governor Inuwa, Abubakar Kari when the Gombe Governor paid condolence visit to
Yobe State over the demise of former Governor Bukar Ibrahim.
The communities have endured
the destructive force of gully erosion,
Gombe State Governor and man he described as a father to which has swept away hundreds of
Chairman of Northern States entire Yobe community. houses, destroyed business premises,
Governors’ Forum, Muhammadu “As you can see, this is Gombe and caused hardships for thousands
Inuwa Yahaya,has led a delegation State government delegation led by of residents.
on a condolence visit to the my humble self to identify with you A resident of the area, Ms. Ketura
government and people of Yobe on this sad moment of mourning Yusuf Kano, highlighted the profound
State over the demise of the first a statesman who devoted his impact of the monstrous gully, stating
civilian Governor of the State, Sen. entire life serving the people and that, “In my neighborhood alone, this
Bukar Abba Ibrahim. humanity, gully washed away not less than 400
Sen. Ibrahim died last Saturday in He said, “the news of the demise houses, destroyed properties, and
Saudi Arabia after a brief illness. of Senator Bukar Abba Ibrahim came afflicted untold hardships to the
Governor Inuwa Yahaya, had as a profound shock and a great loss residents.”
earlier in a statement, on behalf to the us. His legacy of service and Residents faced daily
of the 19 Northern Governors, contributions will endure in the challenges, including difficulties happy and grateful over this project. with the quality and progress
extended his heartfelt condolences hearts of not only the people of Yobe in transportation during the rainy It is a dream come true. Thankfully, of the project, assuring that the
to Governor Mai Mala Buni, State, but Nigerians as a whole. season, hindering children from Governor Inuwa came to our rescue.” construction, currently at 70-
Government and people of “We share in the grief of his attending school and posing risks to The project not only addresses our 75% completion, would meet the
Yobe State, as well as the family family and associates as well as patients or women in labour seeking immediate concerns but also uplifts stipulated timeframe before the next
and associates of the late elder government and people of Yobe hospital care. the socioeconomic activities in the rainy season.
statesman. State during this difficult time”. However, Governor Inuwa Yahaya’s area, saving thousands of houses Hon. Maijama’a called on residents
Received at the Government Governor Inuwa prayed Almighty administration has intervened with from further destruction. to continue supporting the policies
House, Damaturu by Governor Mai Allah in his infinite mercy to forgive the ongoing construction of the While Inspecting the project, the and programs of Governor Inuwa’s
Mala Buni during the visit, Governor the shortcomings of the deceased much-needed bridge. Commissioner of Works, Gombe administration, emphasizing the
Inuwa Yahaya expressed his deepest and reward his good deeds with Expressing gratitude, Ms. Ketura State, Hon. Usman Kallamu effort to build a better Gombe State
sympathy over the huge loss of the Aljannat Firdaus. Yusuf remarked, “We are indeed Maijama’a, expressed satisfaction for present and future generations.
8 NEWS Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024

Senegal: US, CDD condemn


ZYh^d&KZyWZ^^/KEK&/EdZ^d presidential poll shift
WZKhZDEdK&D/>yD/Ed/KE'>Ks^&KZd, By Abbas Jimoh & by actions taken to delay process. Elections are the
Joshua Odeyemi Senegal’s February 25 foundation of democracy,
EDWK&d,&Z>D/E/^dZzK&,>d,K&E/'Z/͘ presidential election, allowing citizens to

T
he United States which run contrary exercise their right to
Z&ZEEhDZ͗   K/ͬϮϬϮϰͬϱϬϱϱϰ and the Centre for to Senegal’s strong choose their leaders,” it
^Z/Wd/KE͗   WZKhZDEdK&D/>yD/Ed/KE'>Ks^&KZd, Democracy and democratic tradition.” said.
EDWK&d,&Z>D/E/^dZzK&,>d,K&E/'Z/͘
hE^W^K͗   ϰϮϭϯϮϮϬϯͲD/> yD KZ EKE ^hZ'/> WZKhZ
Development (CDD West Similarly, the CDD Meanwhile, human
'>Ks^ Africa) have condemned in a statement said that rights lawyer and Senior
>/Ed&KZ^hD/^^/KEK&K/͗ ϮϬd,&ZhZz͕ϮϬϮϰ the postponement of apart from disrupting the Advocate of Nigeria, Femi
WK^d/E'd͗  ϱd,&ZhZz͕ϮϬϮϰ the highly anticipated timeline for the conduct Falana, has called on the
ϭ͘! K:d/s^E^KW
presidential election of elections, this decision leadership of Heads of
hEKW^ŝƐĂƉƌŽĐƵƌĞŵĞŶƚĂŐĞŶƚĨŽƌƚŚĞEĂƟŽŶĂůDĂůĂƌŝĂůŝŵŝŶĂƟŽŶWƌŽŐƌĂŵƵŶĚĞƌƚŚĞ&ĞĚĞƌĂůDŝŶŝƐƚƌLJŽĨ,ĞĂůƚŚ͕ in Senegal, which was represents a clear State and Government
ƉƌŽĐƵƌŝŶŐǀĂƌŝŽƵƐĚƌƵŐƐĂŶĚŵĞĚŝĐĂůƐƵƉƉůŝĞƐ͘tĞŝŶƚĞŶĚƚŽƉƌŽĐƵƌĞŶŽŶͲƐƚĞƌŝůĞdžĂŵŝŶĂƟŽŶŐůŽǀĞƐĨŽƌŽƵƌĐůŝĞŶƚ originally scheduled for violation of the rule of law of the Economic
ƵŶĚĞƌƚŚĞDĂůĂƌŝĂůŝŵŝŶĂƟŽŶWƌŽŐƌĂŵŵĞ͘͘ 25 February. and the democratic rights Community of West
A US State Department of the Senegalese people. African States (ECOWAS)
Ϯ͘! yWdWZKhZDEdKDWKEEd^
dŚĞƚŽƚĂůƋƵĂŶƟƟĞƐ;ĂƉĂĐŬƐŝnjĞŽĨϭϬϬƉĐƐƉĞƌďŽdžͿŽĨƐƚĂŶĚĂƌĚƉŽǁĚĞƌĞĚĞdžĂŵŝŶĂƟŽŶŐůŽǀĞƐĂƌĞ͗ spokesman, Matthew “We therefore urge the to immediately reply to
y >ĂƌŐĞƐŝnjĞͲϱϬйŽĨƚŽƚĂůƋƵĂŶƟƚLJͲϱϳ͕ϱϲϳďŽdžĞƐ Miller, in a statement on Senegalese government the deteriorating human
y DĞĚŝƵŵƐŝnjĞͲϯϬйŽĨƚŽƚĂůƋƵĂŶƟƚLJͲϯϰ͕ϱϰϬďŽdžĞƐ Tuesday said “The United to respect the sanctity rights and rule of law
y ^ŵĂůůƐŝnjĞͲϮϬйŽĨƚŽƚĂůƋƵĂŶƟƚLJͲϮϯ͕ϬϮϳďŽdžĞƐ States is deeply concerned of the democratic crisis in Senegal.
ϯ͘! ^W/>WZKhZDEdKE/d/KE^E/d/KE>/E&KZDd/KE
/ŶŽƌĚĞƌƚŽďĞĐŽŶƐŝĚĞƌĞĚĂƐĂƉŽƚĞŶƟĂůƐƵƉƉůŝĞƌ͕ŝŶƚĞƌĞƐƚĞĚĐŽŵƉĂŶŝĞƐƐŚŽƵůĚƐƵďŵŝƚƚŚĞŝƌdžƉƌĞƐƐŝŽŶŽĨ/ŶƚĞƌĞƐƚ
ŝŶĐůƵĚŝŶŐ ƚŚĞ ŝŶĨŽƌŵĂƟŽŶ ƌĞƋƵĞƐƚĞĚ ŝŶ ƚŚŝƐ ƉƌŽĐĞƐƐ͘ dŚŝƐ ĐĂůů ĨŽƌ džƉƌĞƐƐŝŽŶ ŽĨ /ŶƚĞƌĞƐƚ ĚŽĞƐ ŶŽƚ ĐŽŶƐƟƚƵƚĞ Ă
ƐŽůŝĐŝƚĂƟŽŶ͘ hEKW^ ƌĞƐĞƌǀĞƐ ƚŚĞ ƌŝŐŚƚ ƚŽ ĐŚĂŶŐĞ Žƌ ĐĂŶĐĞů ƚŚĞ ƌĞƋƵŝƌĞŵĞŶƚ Ăƚ ĂŶLJ ƟŵĞ ĚƵƌŝŶŐ ƚŚĞ K/ ĂŶĚͬŽƌ
Hardship: Fresh protest breaks
ƐŽůŝĐŝƚĂƟŽŶƉƌŽĐĞƐƐ͘hEKW^ĂůƐŽƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽƌĞƋƵŝƌĞĐŽŵƉůŝĂŶĐĞǁŝƚŚĂĚĚŝƟŽŶĂůĐŽŶĚŝƟŽŶƐĂƐĂŶĚǁŚĞŶ
ŝƐƐƵŝŶŐƚŚĞĮŶĂůƐŽůŝĐŝƚĂƟŽŶĚŽĐƵŵĞŶƚƐ͘^ƵďŵŝƫŶŐĂƌĞƉůLJƚŽĂĐĂůůĨŽƌK/ĚŽĞƐŶŽƚĂƵƚŽŵĂƟĐĂůůLJŐƵĂƌĂŶƚĞĞƌĞĐĞŝƉƚ
ŽĨƚŚĞƐŽůŝĐŝƚĂƟŽŶĚŽĐƵŵĞŶƚƐǁŚĞŶŝƐƐƵĞĚ͘/ŶǀŝƚĂƟŽŶƐƚŽďŝĚŽƌƌĞƋƵĞƐƚƐĨŽƌƉƌŽƉŽƐĂůƐĂŶĚĂŶLJƐƵďƐĞƋƵĞŶƚƉƵƌĐŚĂƐĞ
out in Niger State
ŽƌĚĞƌŽƌĐŽŶƚƌĂĐƚǁŝůůďĞŝƐƐƵĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞƌƵůĞƐĂŶĚƉƌŽĐĞĚƵƌĞƐŽĨhEKW^ By Seun Adeuyi & About Improving Lives”; meeting over the protests.
hEKW^ŝŶǀŝƚĞƐƐƵƉƉůŝĞƌƐĐĂƉĂďůĞŽĨƉƌŽǀŝĚŝŶŐƚŚĞŐŽŽĚƐŝŶĂďŽǀĞĐĂƚĞŐŽƌLJ;ƐͿƚŽƐƵďŵŝƚƚŚĞŝƌĞdžƉƌĞƐƐŝŽŶŽĨŝŶƚĞƌĞƐƚ͘ Saawua Terzungwe “Nigerians Are Suffering”; The meeting was
“Stop The Hardship Now”, presided over by the Chief
/ŶŽƌĚĞƌƚŽďĞĐŽŶƐŝĚĞƌĞĚĂƐĂƉŽƚĞŶƟĂůƐƵƉƉůŝĞƌ͕ŝŶƚĞƌĞƐƚĞĚĞŶƚĞƌƉƌŝƐĞƐƐŚŽƵůĚƐƵďŵŝƚƚŚĞŝƌdžƉƌĞƐƐŝŽŶŽĨ/ŶƚĞƌĞƐƚ Two days after protesters among others. of Staff to the President,
ŝŶĐůƵĚŝŶŐƚŚĞĨŽůůŽǁŝŶŐŝŶĨŽƌŵĂƟŽŶ͗ stormed the streets A group of women Femi Gbajabiamila in his
y ƌŝĞĨƉƌĞƐĞŶƚĂƟŽŶŽĨLJŽƵƌĐŽŵƉĂŶLJŝŶĐůƵĚŝŶŐŶƵŵďĞƌŽĨƐƚĂī͕ƚƵƌŶŽǀĞƌ͕LJĞĂƌƐŝŶďƵƐŝŶĞƐƐ
y ĞƚĂŝůƐŽĨƉƌĞǀŝŽƵƐůLJĞdžĞĐƵƚĞĚĐŽŶƚƌĂĐƚƐƌĞůĂƚĞĚƚŽƐƵƉƉůŝĞƐŽĨDĞĚŝĐĂůdžĂŵŝŶĂƟŽŶ'ůŽǀĞƐ͘
of Minna, Niger State had blocked the Minna- office at the Presidential
y ŽŶƚĂĐƚŝŶĨŽƌŵĂƟŽŶ;ĨƵůůŶĂŵĞĂŶĚĂĚĚƌĞƐƐ͕ĐŽƵŶƚƌLJ͕ƚĞůĞƉŚŽŶĞĂŶĚĨĂdžŶƵŵďĞƌƐ͕ĞͲŵĂŝůĂĚĚƌĞƐƐ͕ǁĞďƐŝƚĞ capital, over the rising Bida Road at the popular Villa, Abuja.
ĂŶĚĐŽŶƚĂĐƚƉĞƌƐŽŶͿ cost of living, protesters Kpakungu roundabout to Briefing State House
y dŚĞŽīĞƌĞĚƉƌŽĚƵĐƚŵƵƐƚďĞĞƌƟĮĞĚͬ>ŝĐĞŶƐĞĚďLJE&͘;WƌŽǀŝĚĞǀĂůŝĚE&ĞƌƟĮĐĂƚĞͿ have hit the streets of express their grievances correspondents after the
y dŚĞ WƌŽĚƵĐƚ ŵƵƐƚ ŚĂǀĞ ƚŚĞ h ; ŵĂƌŬŝŶŐͿ Žƌ h^ ;& WD Žƌ ϱϬϭŬͿ ƌĞŐƵůĂƚŽƌLJ ĂƉƉƌŽǀĂů ;WƌŽǀŝĚĞ
ĚŽĐƵŵĞŶƚĂƌLJĞǀŝĚĞŶĐĞͿ
Suleja, also in Niger. over the rising cost of meeting, the Minister of
y dŚĞWƌŽĚƵĐƚŵƵƐƚŚĂǀĞEϰϱϱĐĞƌƟĮĐĂƟŽŶǁŚŝĐŚĂƌĞĂƐĞƚŽĨƐƚĂŶĚĂƌĚƐƵƐĞĚĨŽƌŵĞĚŝĐĂůƐŝŶŐůĞͲƵƐĞŐůŽǀĞƐ Suleja is about 46 food items. Information and National
y dŚĞWƌŽĚƵĐƚŵƵƐƚŚĂǀĞĐĞƌƟĮĐĂƟŽŶĨŽƌƚŚĞ^dDϲϯϭϵĨŽƌŶŝƚƌŝůĞƌƵďďĞƌŐůŽǀĞƐ͘ŽƌƚŚĞ^dDϯϱϳϴĨŽƌ kilometres away from the A former National Vice Orientation, Mohammed
ŶĂƚƵƌĂůƌƵďďĞƌŐůŽǀĞƐ Federal Capital Territory Chairman of the ruling Idris, expressed President
y dŚĞWƌŽĚƵĐƚŵƵƐƚŚĂǀĞĐĞƌƟĮĐĂƟŽŶĨŽƌƚŚĞ/^KϭϭϭϵϯĨŽƌƐŝŶŐůĞͲƵƐĞƌƵďďĞƌĞdžĂŵŝŶĂƟŽŶŐůŽǀĞƐ
(FCT), Abuja. All Progressives Congress Tinubu’s worry over the
y dŚĞƉƌŽĚƵĐƚƐŵƵƐƚŵĞĞƚĂŶLJŽĨƚŚĞĨŽůůŽǁŝŶŐƐĞƚŽĨƉĞƌĨŽƌŵĂŶĐĞƐƚĂŶĚĂƌĚƐŽƌƚŚĞŝƌĞƋƵŝǀĂůĞŶƚ͖Eϰϱϱ͕Kƌ
^dDϲϯϭϵ͕ϯϱϳϴ͕ϱϮϱϬ͕Žƌϲϵϳϳ͕KƌEϯϳϰ͘ The protesters called (APC) in the North development.
ůƚĞƌŶĂƟǀĞůLJ͕ on President Bola Ahmed West, Salihu Mohammed He said there was
y KīĞƌĞĚŐůŽǀĞƐƐŚĂůůďĞĐŽŵƉůŝĂŶƚǁŝƚŚƚŚĞƌĞŐƵůĂƚŽƌLJƌĞƋƵŝƌĞŵĞŶƚƐĂŶĚƐƚĂŶĚĂƌĚƐŽĨŽŶĞŽĨƚŚĞ&ŽƵŶĚŝŶŐ Tinubu to end the Lukman, said President enough food in the
DĞŵďĞƌƐŽĨ'ůŽďĂů,ĂƌŵŽŶŝƐĂƟŽŶdĂƐŬ&ŽƌĐĞ;',d&Ϳ;ŶĂŵĞůLJ͕h͕h^͕ĂŶĂĚĂ͕ƵƐƚƌĂůŝĂ͕ĂŶĚ:ĂƉĂŶͿ͕ hardship because they Tinubu will ignore the country, adding that some
;Ğ͘Ő͘ƵƌŽƉĞ͗ƚŚĞƉƌŽĚƵĐƚDh^dďĞĂƌƚŚĞŵĂƌŬŽŶŝƚƐƉĂĐŬĂŐŝŶŐŝ͘ĞŚĂǀĞƚŚĞŽŶĨŽƌŵŝƚĠƵƌŽƉĠĞŶŶĞ
΀΁ĐĞƌƟĮĐĂƟŽŶ͖ŽƌĨŽƌh^͗&ĂƉƉƌŽǀĂůĐĞƌƟĮĐĂƚĞ͕ĞƚĐͿ͘;ŝĚĚĞƌƐƐŚŽƵůĚƐƵďŵŝƚƚŚĞŵĂŶƵĨĂĐƚƵƌĞƌΖƐ were subjected to it. protests over the high cost elements were trying to
ĚŽĐƵŵĞŶƚĂƌLJĞǀŝĚĞŶĐĞŽĨƚŚĞƐĞĐĞƌƟĮĐĂƟŽŶƐŝŶŶŐůŝƐŚůĂŶŐƵĂŐĞƉƌŽǀŝŶŐĐŽŵƉůŝĂŶĐĞͿ They carried placards of living at his peril. take advantage of the
y KīĞƌĞĚƉƌŽĚƵĐƚƐŵƵƐƚďĞŵĂŶƵĨĂĐƚƵƌĞĚĂƚĂƐŝƚĞƚŚĂƚŝƐ/^KϭϯϰϴϱŽƌ/^KϵϬϬϭĐĞƌƟĮĞĚYD^͘;ŝĚĚĞƌƚŽ with inscriptions such as Meanwhile, the federal high food prices and the
ƐƵďŵŝƚǀĂůŝĚ/^KĞƌƟĮĐĂƚĞŽĨƚŚĞŵĂŶƵĨĂĐƚƵƌĞƌͿ “Tinubu, Do Something government on Tuesday depreciation of the naira
y DĂŶƵĨĂĐƚƵƌĞƌΖƐƵƚŚŽƌŝnjĂƟŽŶƚŽƐƵƉƉůLJƚŚĞŐůŽǀĞƐŝĨƚŚĞǀĞŶĚŽƌŝƐŶŽƚĂŵĂŶƵĨĂĐƚƵƌĞƌ͘
y ĐŽŵƉůĞƚĞĚ͞^ĞĐƟŽŶ//ZĞƚƵƌŶĂďůĞƐ͟
Now!”; “Leadership Is All convened an emergency to cause havoc.

dŚĞdžƉƌĞƐƐŝŽŶŽĨ/ŶƚĞƌĞƐƚĂŶĚĂĐĐŽŵƉĂŶLJŝŶŐĚŽĐƵŵĞŶƚƐŵƵƐƚďĞƌĞĐĞŝǀĞĚƚŚƌŽƵŐŚƚŚĞhEKW^ͲƐŽƵƌĐŝŶŐWŽƌƚĂůďLJ
ŶŽůĂƚĞƌƚŚĂŶϮϬƚŚ&ĞďƌƵĂƌLJ͕ϮϬϮϰĂƚϭϳ͗ϬϬhd͘ Secure Nigeria, Catholic bishops tell Tinubu
WůĞĂƐĞŝŶĚŝĐĂƚĞZĞĨ͘EŽ͗͘K/ͬϮϬϮϰͬϱϬϱϱϰ͘ZĞƋƵĞƐƚĨŽƌdžƉƌĞƐƐŝŽŶŽĨ/ŶƚĞƌĞƐƚĨŽƌƚŚĞWƌŽĐƵƌĞŵĞŶƚŽĨDĞĚŝĐĂů By Abbas Jimoh Assistant Secretary- Umoh said the
džĂŵŝŶĂƟŽŶ'ůŽǀĞƐƚŽƚŚĞEĂƟŽŶĂůDĂůĂƌŝĂůŝŵŝŶĂƟŽŶWƌŽŐƌĂŵŵĞ;EDWͿŽĨƚŚĞ&ĞĚĞƌĂůDŝŶŝƐƚƌLJŽĨ,ĞĂůƚŚŽĨ
EŝŐĞƌŝĂŽŶĂůůƐƵďŵŝƐƐŝŽŶƐ͘ General, Michael Banjo; situation in the country
The Catholic Secretariat Director of Mission has deteriorated beyond
dŚĞůŝŶŬƚŽƚŚĞK/ŝŶƚŚĞhE'DŝƐŚƩƉƐ͗ͬͬǁǁǁ͘ƵŶŐŵ͘ŽƌŐͬWƵďůŝĐͬEŽƟĐĞͬϮϮϱϲϴϭ of Nigeria (CSN) has and Dialogue; Joseph description, citing the
urged the federal Nomhwange, National abduction and killing of
dŚŝƐĐĂůůĨŽƌdžƉƌĞƐƐŝŽŶŽĨ/ŶƚĞƌĞƐƚĚŽĞƐŶŽƚĐŽŶƐƟƚƵƚĞĂƐŽůŝĐŝƚĂƟŽŶ͘
government to tackle the Director of Social a nursing woman, her
hEKW^ƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽĐŚĂŶŐĞŽƌĐĂŶĐĞůƚŚĞƌĞƋƵŝƌĞŵĞŶƚĂƚĂŶLJƟŵĞĚƵƌŝŶŐƚŚĞK/ĂŶĚͬŽƌƐŽůŝĐŝƚĂƟŽŶƉƌŽĐĞƐƐ͘ insecurity pervading the Communications, Rev. kid and her mother who
hEKW^ ĂůƐŽ ƌĞƐĞƌǀĞƐ ƚŚĞ ƌŝŐŚƚ ƚŽ ƌĞƋƵŝƌĞ ĐŽŵƉůŝĂŶĐĞ ǁŝƚŚ ĂĚĚŝƟŽŶĂů ĐŽŶĚŝƟŽŶƐ ĂƐ ĂŶĚ ǁŚĞŶ ŝƐƐƵŝŶŐ ƚŚĞ ĮŶĂů country and ensure that Fr. Michael Nsikak were executed while
ƐŽůŝĐŝƚĂƟŽŶĚŽĐƵŵĞŶƚƐ͘ Nigerians are protected Umoh, and Director, the infant was spared in
against bandits and Pastoral Agents Abuja.
^ƵďŵŝƫŶŐĂƌĞƉůLJƚŽĂĐĂůůĨŽƌK/ĚŽĞƐŶŽƚĂƵƚŽŵĂƟĐĂůůLJŐƵĂƌĂŶƚĞĞƌĞĐĞŝƉƚŽĨƚŚĞƐŽůŝĐŝƚĂƟŽŶĚŽĐƵŵĞŶƚƐǁŚĞŶ
ŝƐƐƵĞĚ͘/ŶǀŝƚĂƟŽŶƐƚŽďŝĚŽƌƌĞƋƵĞƐƚƐĨŽƌƉƌŽƉŽƐĂůƐĂŶĚĂŶLJƐƵďƐĞƋƵĞŶƚƉƵƌĐŚĂƐĞŽƌĚĞƌŽƌĐŽŶƚƌĂĐƚǁŝůůďĞŝƐƐƵĞĚŝŶ kidnappers on rampage Department, Rev. Fr. Banjo on his part also
ĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞƌƵůĞƐĂŶĚƉƌŽĐĞĚƵƌĞƐŽĨhEKW^͘ in the country. Augustine Okochi, made urged the government
The Secretary-General the call on Wednesday to ensure the security of
/DWKZdEdEKd͗ of the CSN Rev. Fr. in Abuja at a news life and property in the
&ŽƌĐŽŵƉĂŶŝĞƐŶŽƚƌĞŐŝƐƚĞƌĞĚǁŝƚŚƚŚĞhE'ůŽďĂůDĂƌŬĞƚƉůĂĐĞŝƚŝƐŵĂŶĚĂƚŽƌLJƚŽĚŽƐŽƚŽďĞĂďůĞƚŽĚŽďƵƐŝŶĞƐƐǁŝƚŚ
hEKW^͘dŚĞhE'ůŽďĂůŵĂƌŬĞƚƉůĂĐĞ;hE'DͿŝƐĂĚĂƚĂďĂƐĞŽĨĂĐƟǀĞĂŶĚƉŽƚĞŶƟĂůƐƵƉƉůŝĞƌƐĂǀĂŝůĂďůĞƚŽĂůůhEĂŶĚ Zacharia Samjumi; conference. country.
tŽƌůĚĂŶŬƉƌŽĐƵƌĞŵĞŶƚƉĞƌƐŽŶŶĞů͕ĂŶĚŝƐƚŚĞŵĂŝŶƐƵƉƉůŝĞƌĚĂƚĂďĂƐĞŽĨŵŽƌĞƚŚĂŶϮϬhEŽƌŐĂŶŝnjĂƟŽŶƐ͘dŽƌĞŐŝƐƚĞƌ
ŐŽƚŽǁǁǁ͘ƵŶŐŵ͘ŽƌŐ͕ĐůŝĐŬŽŶ͞Z'/^dZEKt͟ŽƌŽŶZĞŐŝƐƚƌĂƟŽŶĚƌŽƉĚŽǁŶĂŶĚƐĞůĞĐƚ͞ZĞŐŝƐƚĞƌĂƐ^ƵƉƉůŝĞƌ͘͟

/ŶŽƌĚĞƌƚŽĂĐĐĞƐƐƚŚĞĨƵůůhEKW^K/ĚĞƚĂŝůƐ͕ƌĞƋƵĞƐƚĐůĂƌŝĮĐĂƟŽŶƐŽŶƚŚĞƚĞŶĚĞƌ͕ĂŶĚƐƵďŵŝƚĂǀĞŶĚŽƌƌĞƐƉŽŶƐĞƚŽĂ
FAAN stops multiple protocol services at Lagos Airport
K/ƵƐŝŶŐƚŚĞƐLJƐƚĞŵ͕ǀĞŶĚŽƌƐŶĞĞĚƚŽďĞƌĞŐŝƐƚĞƌĞĚĂƐĂhEKW^ǀĞŶĚŽƌĂƚƚŚĞhE'DƉŽƌƚĂůĂŶĚďĞůŽŐŐĞĚŝŶƚŽ From Abdullateef Aliyu, protocol services at activities of FAAN
hE'D͘&ŽƌŐƵŝĚĂŶĐĞŽŶŚŽǁƚŽƌĞŐŝƐƚĞƌŽŶhE'DĂŶĚƐƵďŵŝƚƌĞƐƉŽŶƐĞƐƚŽhEKW^ƚĞŶĚĞƌƐŝŶƚŚĞhEKW^Ğ^ŽƵƌĐŝŶŐ Lagos the airport instead of Protocol Unit and that of
Ɛ LJ Ɛ ƚ Ğ ŵ ͕  Ɖ ů Ğ Ă Ɛ Ğ  ƌ Ğ Ĩ Ğ ƌ  ƚ Ž  ƚ Ś Ğ  Ƶ Ɛ Ğ ƌ  Ő Ƶ ŝ Ě Ğ  Ă Ŷ Ě  Ž ƚ Ś Ğ ƌ  ƌ Ğ Ɛ Ž Ƶ ƌ Đ Ğ Ɛ  Ă ǀ Ă ŝ ů Ă ď ů Ğ  Ă ƚ ͗ bringing their protocols. the Ministry of Foreign
ŚƩƉƐ͗ͬͬĞƐŽƵƌĐŝŶŐ͘ƵŶŽƉƐ͘ŽƌŐͬηͬ,ĞůƉͬ'ƵŝĚĞƐ The Federal Airports The Managing Affairs.
/ŶƚĞƌĞƐƚĞĚǀĞŶĚŽƌƐŵƵƐƚƌĞƐƉŽŶĚƚŽƚŚŝƐK/ƵƐŝŶŐƚŚĞhEKW^Ğ^ŽƵƌĐŝŶŐƐLJƐƚĞŵ͕ǀŝĂƚŚĞhE'DƉŽƌƚĂů͘
Authority of Nigeria Director/Chief She spoke during
(FAAN) has decried Executive of FAAN, Mrs her maiden interactive
dŚĞůŝŶŬƚŽƚŚĞK/ŝŶƚŚĞhE'DŝƐŚƩƉƐ͗ͬͬǁǁǁ͘ƵŶŐŵ͘ŽƌŐͬWƵďůŝĐͬEŽƟĐĞͬϮϮϱϲϴϭ the proliferation of Olubunmi Kuku, who session with the Airline
protocol services at the stated this, said it should Operators Committee
ϰ͘! hEKW^ŽŶƚĂĐƚ/ŶĨŽƌŵĂƟŽŶ Murtala Muhammad be stopped immediately (AOC) and heads
ƩŶ͗ĚŝƚŚĚŽŵĂŬŽ
ͲŵĂŝů͗ĞĚŝƚŚĂΛƵŶŽƉƐ͘ŽƌŐ͕ International Airport as it contravenes of security agencies
(MMIA), Lagos. Executive Order 001 under the auspices of
Đ͗ŚŝĚŝŶŵĂŵĂůĂĐŚƵŬǁƵ/ŬĞĂŬŽƌ It urged other agencies of 2017 of the Federal the Airport Security
ͲŵĂŝů͗ĐŚŝĚŝŶŵĂŝŬΛƵŶŽƉƐ͘ŽƌŐ of government to Government and Committee at the
work with the existing undermines protocol airport.
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 9
10 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 23
08116759756
CITY & CRIME
Abuja doctor accused of Mob burns man accused of raping,
while the missing baby’s mother,
Favour, was taken to another clinic
within the community where she
FRSC officer Man bags life
crushed in Kogi imprisonment killing brother’s wife in Benue Police recover 4 rifles,
stealing day-old baby
was recuperating.
Also speaking, Favour’s elder
brother, Samuel Idowu, said the for raping ammunitions in Bauchi
doctor disappeared following the From Hope Abah, Makurdi home afterwards until a search party jungle justice. From Hassan Ibrahim,
Bauchi
By Adam Umar incident despite communicating
4-year-old girl discovered the woman’s lifeless body They alleged that the late man had

A
with him on phone for over five 22-year-old man has been with signs of being forcefully raped confessed to committing the rape and
Bauchi State Police Command

A
17-year-old girl, Favour hours. From Iniabasi Umo, Uyo burnt to death for allegedly and matchet cuts on her head and murder of his brother’s wife before
Idowu, has accused an A woman residing close to the raping and killing his brother’s nose. he was set ablaze by the mob, adding has recovered three AK-47 riffles,
Abuja-based medical hospital, who preferred to remain wife in Achoho community of Gwer The witnesses said that Botswar that both deceased belonged to the one AK-49 riffle and nine empty
The Akwa Ibom State High magazines in Ningi LGA of the
doctor of absconding with anonymous, alleged there were Court sitting in Ikot Ibritam, East LGA of Benue State. was later traced to Tse-Agberagba, Ayisa family.
her newborn baby in Dutsen- similar cases in the hospital, with The young man, simply identified the headquarters of Konshisha LGA, The state Police Public Relations state.
Oruk Anam LGA has The command’s Public Relations
Makaranta, a town in Bwari Area the latest one leading to a riot by sentenced a 32-year-old man, as Botswar, allegedly committed where his mother settled in a second Officer (PPRO), SP Catherine Anene,
Council of the FCT. residents. the murder of his brother’s wife on marriage but he was not found. did not respond to calls and message Officer, SP Ahmed Wakil, who
 The late FRSC officer Akaninyene Sunday Ekwere disclosed this in a statement,
Favour alleged that she went Another resident alleged that to life imprisonment for rape. Friday but angry mob seized him on But luck was said to have ran out put through her telephone to confirm
to Trendy Hospital, Clinic & about three weeks ago, a woman From Tijani Labaran, Lokoja Monday and set him ablaze. on him when an angry mob that went the incident. said a suspicious polythene bag
It was gathered that Ekwere, was sighted near River Chika-
Maternity, Dutsen-Makaranta, last confronted the doctor with thugs an engine oil, electrical Witnesses alleged that the deceased on his search caught up with him Anene, had however, in the past,
Wednesday after she started feeling  The hospital where the doctor for failing to deliver a baby to her An officer of the Federal Road Botswar had gone to the farm on at Agidi village on their way back warned against such jungle justice, Chika, about 200m away from the
operates from appliances and recharge card main road along the Gida-Dubu
signs of labour. after collecting some money from Safety Corps (FRSC), Kadiri Friday with his brother’s wife and from his mother’s home and then saying anyone caught in the act
seller lured a 4-year-old girl to quarters in the LGA.
Favour said, “The doctor gave told me that they were going to give her. Usman, has reportedly been killed that both of them did not return descended on him in the manner of would be made to face the law.
his shop where he defiled the Wakil explained that upon
me a tablet to place under my it immunisation. Attempts by our reporter to by a driver in Lokoja, Kogi State.
girl, who is the last child in a receiving the report, the operatives
City & Crime gathered that the
tongue and he inserted another
one in my private part. Labour
‘’When I opened my eyes again,
I discovered myself in a different
speak with the doctor yielded no
result as he was said to be in police incident happened yesterday while
family of five.
It was learnt that the mother
EFCC arrests 41 illegal miners in Kwara attached to Ningi Police Divisional
started afterwards and continued hospital.” custody. the victim was going to his work From Mumini Abdulkareem, Ilorin The arrest, the commission said, of the states. Headquarters led by the DPO,
 The mother of the baby of the victim discovered the cordoned the area and recovered
for up to three days. I gave birth on Favour denied an allegation that The Divisional Police Officer place in Koton Karfe, headquarters followed credible intelligence on the He said preliminary investigation
baby, she lamented that he had bruises around her private the following assorted firearms,
Saturday. He beat the baby before it there was an arrangement between (DPO) of Dutsen-Alhaji, CSP of Kogi LGA. Operatives of the Economic and activities of illegal miners. showed that the minerals suspected
since denied responsibility. part when she bathed her, three AK47 riffles, one AK49 riffle
cried, I fainted, and when I opened her and the doctor that he would Paul Danladi, who confirmed A witness said the driver who was Financial Crimes Commission (EFCC), The EFCC Zonal Commander, to be marble, white powder, lithium,
Our correspondent, who was at prompting her parents to and nine empty magazines.
my eyes, I saw the baby beside me. settle her with money in order to the incident, said the case had driving recklessly near a military Ilorin Zonal Command, Kwara State, Michael Nzekwe, said the suspects were lepidolite, among others, were being
the hospital on Tuesday, reports that report the matter to the While commending the officers,
The next thing was I saw two girls take over the child. been transferred to the Force barracks close to the Lokoja bridge have arrested 41 suspects and impounded apprehended at different locations in transported out of the country for
it was allegedly sealed by the police police. the state police commissioner,
taking the baby away. The doctor Asked about the father of the Headquarters. on the River Niger hit the officer on 12 trucks said to be containing solid Kwara and Oyo states while transporting production of goods at the expense of
In his confessional Auwal Mohammed Musa, urged
his motorcycle, adding that he died minerals mined without licence. truckloads of the assorted minerals out the Nigerian economy.
statement, Ekwere, an the operatives to sustain the
Hajj: 50 percent of Driver hospitalised after driving burning tanker before help could come his way.
The Sector Commander of FRSC
indigene of Ikot Ibritam and
a neighbour to the victim,
intelligence-led policing in a bid
to achieve the objectives of the
seats allocated to From
Ilorin
Mumini Abdulkareem, area, along airport road, Ilọrin on extinguished.
Wednesday. Speaking on the incident, the
City & Crime gathered that the spokesperson of the Kwara State
in the state, Mr Samuel Oyedeji,
said, “The late Kadiri Usman was
our staff in charge of the Koton
said he saw the minor playing
outside the compound and
command.

FCT paid for A driver simply identified as fire occurred around 8am during Fire Service, Hassan Adekunle, Karfe sector. He was going to
invited her to his shop, where Fire destroys
he rubbed vaseline oil on her
By Hussein Yahaya
Ayelabowo has been hospitalised the process of syphoning PMS into said the victim had been taken to resume work from his base in
private part and raped her. Ebonyi night club
after he drove a burning tanker out the filling station’s reservoir and the University of Ilorin Teaching Lokoja when he was hit and killed
In his judgment, the Judge, An early morning fire, on
of Bovas filling station in Odo-Ota took the firemen about one hour to Hospital (UITH), following a by a reckless driver in the morning.
The FCT Muslim Pilgrims Nkereuwem Obot, said Wednesday, gutted the popular
referral from a local facility. “Unfortunately, we could not
Welfare Board Wednesday said Akaninyene Ekwere does not Roky Fella Night Club, located at
Adekunle said, “After the fire apprehend the driver as he ran
less than 2500 intending pilgrims deserve to live in the midst of Udoji Street, Kpirikpiri, Abakaliki,
started, the driver summoned away before we could get there.”
have so far paid for their fares sane people as he is dangerous destroying property worth
courage to jump into the tanker and
to society.
out of the 4,365 allocated to
the FCT by the National Hajj
drove it out to avert a major disaster
before we quenched the inferno. But
Fire razes 10 shops Obot found the accused
millions of naira.
The Ebonyi Chief Fire Officer,
guilty and sentenced him to Mr Raphael Ibiam, who confirmed
Commission, four days to the
deadline.
his legs, laps and some part of his
face got burnt in the process. He is in Ogun market life imprisonment.
The convict who is
 The boys the incident to newsmen, said he
The Director of the Board, writhing in pain”, Adekunle added. From Peter Moses, Abeokuta received distress call about the
popularly called “Doctor” had
Abubakar Adamu-Evuti, who
stated this while addressing
He said the petrol tanker with
registration number AGG 728 XK At least 10 shops have been razed
earlier pleaded with the court Man remanded for alleged murder of 20-year-old lady incident around 6.30am.
Ibiam said that the cause of the
journalists in Abuja, said the to have mercy upon him as he An Iyaganku Magistrates’ Court, The Magistrate, Mr Olaolu defendant allegedly committed the inferno had yet to be ascertained.
was carrying 45,000 litres of PMS. down by a fire in the Lafenwa
February 12 deadline remains is a married man. Ibadan, on Wednesday ordered that Olanipekun, did not take the plea of the offence on Nov. 24, 2023, at Olowo According to him, the fire razed
Adekunle told our correspondent Market in Abeokuta, Ogun State.
unchanged, adding that Under the Violence one Kazeem Adiatu (44) be remanded defendant for want in jurisdiction. area in Ibadan. Amusan alleged that valuable property in the building,
that the heroics of the driver and the A witness, Muinatu Akinfenwa,
N4,699,000 has been approved Against Persons (Prohibition) in a correctional facility for allegedly He directed the police to return Adiatu unlawfully caused the death of which consists of a bar, restaurant
dedication of the fire crew saved the Iyaloja of the Lafenwa Market,
for this year’s hajj. Laws, 2020, rape carries life murdered a 20-year-old lady, one the case file to the Director of Public Temitope by hitting her with cement and the club at the centre. (NAN)
nearby buildings from the ravaging said the fire originated from a
He said those that have made  The ill-fate tanker imprisonment in addition to Temitope. Prosecution (DPP) for legal advice block on the head.
initial deposit of N5.5million
fire. dump site behind the shops.
Muinatu, who lamented the
the name of the victim being Adiatu, whose residential address and adjourned the case till March He said the offence contravened Doctor donates N79m
would have their balance
returned.
Wike to complete abandoned Kwali township stadium improper disposal of refuse behind
the market, commended the swift
entered in the registrar of sex
offenders in the state.
was not provided, was charged with
murder.
27 for mention. The prosecutor, Mr
Philip Amusan, told the court that the
Section 319 of the Criminal Laws of
Oyo State, 2000.
medical equipments
Adamu-Evuti advised those By Hussein Yahaya in the area council inherited by his
administration would be completed.
territory of President Bola Tinubu’s
commitment to improving their response of the DPO of Lafenwa, to Sokoto govt
who have interest to perform this
year’s Hajj but have not yet made The FCT Minister, Nyesom Wike, Our correspondent reports that the welfare through massive project the local government chairman
and various agencies, including the
Kano murder: Re-arraignment of wife, Ogun witnessed rise in From Abubakar Auwal,
Sokoto
has assured residents of Kwali 20,000 capacity sporting facilities provisions and job creation, the
any payment to use the four days’
window to do so. Area Council of his willingness to was awarded alongside five others minister empathised with residents Oodua Peoples Congress (OPC),
Amotekun, TRACE and market
hubby, 2 others stalled GBV cases in 2023 – CP Sokoto foreign based Medical
Doctor , Sa’idu Alhassan Wurno
complete the construction of the across the six area councils of the over the high cost of living being From Lubabatu I Garba, Kano City & Crime recalls that during the first From Peter Moses, Abeo- and addressed some of the
Our correspondent reports women, who collaborated to has donated medical equipments
that the airlifting of intending abandoned Kwali township stadium. territory during the administration experienced at the moment, noting arraignment, Hafsat pleaded not guilty to the kuta cases. The CP, therefore, worth N79 million to the state
Wike, who gave the assurance of Bala Mohammed. that the situation is temporary. combat the fire. enjoined mothers “to oversee
pilgrims will start on May 19, The state’s Commissioner for The re-arraignment of a housewife, Hafsat Sani charges after initially confessing to the police that government.
on Wednesday while flagging-off The conception of the project was He vowed that no on-going or Suraj, her husband, Dayyabu Abdullahi, and she singlehandedly stabbed Nafiu severally when The Commissioner of Police and protect the welfare of Hailed from Wurno LGA of the
while the orientation exercise Environment, Ola Oresanya, who
the construction of 11 km Kwali- geared towards the development of newly awarded projects under the two others, Adamu Muhammad and Nasidi he tried to stop her from committing suicide. (CP) in Ogun State, Abiodun their female adolescent state, Sa’idu is a orthopaedic and
ends in April. visited the scene on behalf of the
Sukuku-Abo road, also promised the sporting activities in the grassroot. current administration would be Muhammad, accused of complicity in the Her re-arraignment was slated for Tuesday, Alamutu, has lamented the children against predators trauma consultant in Germany.
He warned that with the new governor to commiserate with the While handing over the
residents that all abandoned projects While assuring residents of the abandoned. murder of one Nafiu Hafizu before a Kano State February 6, at the high court but was stalled as disturbing increase in cases so that we can collectively
regulations from Saudi Arabia, affected market women, expressed equipments to the deputy Governor
High Court was on Tuesday stalled. the prosecution counsel substituted the first of Gender-Based Violence counter and prevent these
there will be no room for late the governor’s sadness over the of the state, Engineer Idris Gobir
forms of abuses.
registration, adding that the
ongoing sensitization exercise
10 Ogun girls trained on shoemaking, others incident and pledged a swift
government intervention.
Hafsat, was accused of killing her “house
help”, Nafiu Hafizu, while the three others were
charge sheet with another one.
The prosecution counsels, led by Aisha
(GBV) experienced in 2023
across the state. “In conclusion,
we head into 2024, our
as on Wednesday, the doctor said the
gesture was meant to complement
will be put on hold during the From Peter Moses, Abeokuta Esther 2:0. “Project Esther is a teenage accused of concealment of the murder. Mahmud, moved an application for substitution He disclosed this while the efforts of the state government
Oresanya emphasised the addressing newsmen in determination to fight crime
Ramadan period. At the graduation ceremony empowerment programme that dangers of indiscriminate refuse The defense counsel, Huwaila Ibrahim of the charge with another one as she stated in improving healthcare service
Muhammad, applied to the court for that the first charge did not include a fourth Abeokuta on the activities of remains unwavering. With delivery in the state.
On accommodation, the board An NGO, B.A.B.E.S Redefined, held in Abeokuta, B.A.B.E.S caters for the needs and empowers burning during harmattan,
adjournment to another date. defendant, Malam Nasidi Muhammad. the command last year. the support of the press, the According to him, the second
said it has secured good ones but has trained girls on shoemaking, Redefined’s officials, led by the teenage girls with life and socio- declaring the said dumpsite illegal.
The defendants were earlier arraigned before a The defense team then applied for an Alamutu, however, said the public and all stakeholders, batch of the equipments would soon
urged all intending pilgrims to leather works, makeup, among Vice President, Chinelo Durojaiye, economic skills to be purposeful He assured that the state arrive the state.
Kano magistrates’ court presided over by Hadiza adjournment for the re-arraignment to another command, in collaboration we can create a safer
disclose their health status as others, in Ogun State. gave the trainees starter-packs for women as they grow.” government, in collaboration with Receiving the equipments,
Abdurrahman, where they, “…misled and gave day to enable them study the new charge. with the Commissioner environment where everyone
people with health challenges as The girls were trained for 10 their trades and attached them to She said the programme started local authorities, would construct Gobir thanked him for the gesture,
false information to the deceased’s family by Justice Zuwaira Yusuf granted the application for Women Affairs, Adijat can prosper and live without
well as pregnant women are not weeks on life and soft skills by mentors. in Lagos and was spreading across additional stalls to discourage describing him as a true son of the
saying that he died from pile surgery.” and adjourned the case to today, February 8. Adeleye, worked diligently fear.”
allowed for the exercise. the organisation under its Project Durojaiye explained that, the states of the federation. roadside displays. state.
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 11
INSIDE POLITICS
Ours is a government of the people. As
such, we will not impose any candidate
on the people of Kebbi State
– Governor Nasiru Idris of Kebbi State

INEC fixes Feb 14 for


postponed rerun elections
No date for Kano over insecurity Lawmakers-elect get Certificates of Return
By Abbas Jimoh concluded successfully across all supports the returning officer’s
designated constituencies, with the decision to announce results in the

T
he Independent National exception of Jalingo/Yorro/Zing Ikono/Ini Federal Constituency, as the
Electoral Commission (INEC) Federal Constituency. Here, the final number of registered voters in the two
has fixed February 14 for the declaration was postponed due to PUs did not affect the outcome of the
conduct of supplementary elections over-voting in certain polling units, election.
resulting from suspended elections impacting the margin of lead between Meanwhile, the commission on
in some polling units during last the candidates with the highest Wednesday presented certificates
Saturday’s rerun and by-elections. number of votes. of return (CoR) elected federal
The commission said it has resolved “Regarding the re-run elections, lawmakers who won in last Saturday’s
to conduct a supplementary election in disruptions occurred at two polling by-elections and re-run elections
Taraba State and a new rerun election units (PUs) in the Ikono/Ini Federal across the country, at the commission’s
in Enugu State. Constituency of Akwa Ibom State headquarters in Abuja.
National Commissioner and and across all PUs in the Enugu South Seven political parties won seats in
Chairman, Information and Voter State Constituency of Enugu State and both the National and State Houses of
Education Committee of INEC, Sam Kunchi/Tsanyawa State Constituency Assembly.
Olumekun, said this on Tuesday of Kano State, due to violence, They are Action Democratic Party
in a statement at the end of the thuggery and the hijacking of election (ADP), All Progressives Congress
commission’s regular management materials.” (APC), All Progressives Grand
meeting. The INEC top official said the Alliance (APGA), Labour Party (LP),
“Due to security concerns, the commission had previously suspended New Nigerian People’s Party (NNPP),
election in Kunchi/Tsanyawa State the re-run elections in these areas in Peoples Democratic Party (PDP) and
Constituency (in Kano State) will accordance with Section 24(3) of the the Young Progressives Party (YPP).
be held at a later date, after further Electoral Act 2022. Those who received the CoR
discussions with security agencies and He said, however, that following comprised three senators and
stakeholders,” Olumekun said. additional reports from our officials 15 members of the House of  Prof. Mahmood
Yakubu, INEC Chairman
He said, “The by-elections were in the affected states, the commission Representatives.

Protest: Stop blame game, fulfil How politicians use religion to


your promises, PRP tells APC
By Muslim Muhammad PRP, in a statement government. achieve goals in Plateau – Yilwatda
signed by the acting “It is disingenuous for From Ado Abubakar Musa, as representative of Islam because he was in the ANPP.
The Peoples Redemption National Publicity the APC to dismiss these Jos was deliberate by politicians The same thing happened
Party has countered the Secretary of the party, protests as mere instigation to de-market him and his to Pauline Tallen in 2011
All Progressives Congress Comrade Muhammed by the opposition, when, The governorship candidate of party, adding that using Islam when she was contesting for
(APC) for resorting Ishaq, lamented that in fact, they are a reflection the All Progressives Congress against him and his party was the governorship. In 2015,
to what it describes as the protests in Minna, of the growing discontent (APC), in Plateau State, not the first of its kind in the the same thing happened
baseless accusations and Niger State and Kano among the populace.” Nentawe Yilwatda, has berated history of politics in the state. to Simon Lalong. The same
fear-mongering against were not orchestrated by Ishaq insisted that it politicians in the state for He recalled that “In 1983, thing happened to me in 2023.
the opposition following opposition parties, rather was high time the APC immorally taking advantage John Kadiya of ECWA So, it is the normal culture
protests over hardship in they were grassroots stopped playing the blame of religion to achieve political Church, was tagged as the of Plateau politics that some
the country. expressions of frustration game and focused on gains. Muslim candidate on the people must tag somebody to
PRP described the and dissatisfaction with delivering on its promises Yilwatda said it has become Plateau when he contested have an Islamic outlook just
claims of the APC as the current state of affairs to the Nigerian people. a norm for politicians in the against the late Solomon Lar. It for political reasons. Once
an attempt to deflect in the country. The PRP further urged state to negatively and most is a well-known fact that John politics is over, that person
attention from the The statement added, the federal government to times erroneously associate Kadiya was a communion becomes a saint. The politics
legitimate concerns “The citizens of Nigeria “listen to their grievances one with Islam in order to member of ECWA Church, of Plateau State carry the same
raised by the Nigerian have the right to protest and work towards secure political advantage. a member of ECWA Church pattern.
people, adding that it was peacefully and demand addressing the root causes The governorship and an elder in ECWA “The funny aspect is that
disheartening. accountability from their of their discontent.” candidate disclosed this in Church. But he was tagged people are not wise enough to
Jos, while fielding questions as an Islamic leader. After the understand that some people
Edo gov’ship: APC rakes in N600m from sale of forms, from journalists regarding election was over, nobody
again called him an Islamic
are using politics to ensure
that a good candidate doesn’t
the outcome of the Supreme
inaugurates screening c’ttee today Court judgment, which leader. emerge. They use religion as
By Saawua Terzungwe party’s primary poll Ikhine. affirmed the election of “In 1991, the same thing a basis for presenting their
slated for February 17, Others are Col. Governor Caleb Mutfwang, happened when Fidelis candidates to the public,”
The All Progressives 2024. David Imuse (rtd.), and the campaign of calumny Tapgun was contesting against Yilwatda added.
Congress (APC) has Recall that the Gen. Charles Ehigie against him during the 2023 Bagudu Hirse. Hirse was He, however, said he had
raked in at least N600 Independent National Airhiavbere (rtd.), Sen. general elections. tagged as an Islamic candidate. accepted the Supreme Court’s
million from the sale of Electoral Commission Oserheimen Osunbor, He said the tactics of “In 2003, David Jang was judgement in good faith,
expression of interest (INEC) has fixed Blessing Agbomhere, attaching him and his party tagged as an Islamic candidate describing it as the will of God.
and nomination forms September 21, 2024, Hon Dennis Idahosa
to aspirants seeking its
ticket for the Edo State
for the off-season
governorship election in
and Ernest Afolabi
Umakhihe.
Electoral Act amendment bill scales second reading
By Balarabe Alkassim Electoral Act, 2022 and the sponsor, it “seeks to
governorship election. Edo State. Meanwhile, the
for Related Matters,” was amend selected sections
The party had pegged Those in the race APC in a statement on
The House of sponsored by the member of the Electoral Act, CAP
its forms at N50 million for the party’s ticket its verified X account
Representatives has passed representing Ughelli E6, LFN, 2004 to provide
for each aspirant. are Prince Clem Agba, yesterday announced
a bill seeking amendment North/Ughelli South/Udu for the pre-registration of
Our correspondent Senator Monday that the inauguration
of the Electoral Act 2022 Federal Constituency, Delta voters, same day elections,
reports that 12 aspirants Okpebholo, Lucky of the screening and
through second reading on State, Mr Francis Waive. electronic transmission
have purchased, filled Imasuen, Hon. Anamero appeals committees
Wednesday. According to the of results as well as
and returned their forms Sunday Dekeri, Pastor would be held today
The Bill titled “A Bill explanatory memorandum punishment for frivolous
with relevant documents Osagie Andrew Ize- at the party’s national
for an Act to amend the of the bill presented by election petitions.”
attached ahead of the Iyamu and Engr. Gideon secretariat in Abuja.
12 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024

[ THE SECOND WIND


HUZAIFA JEGA
08165502469 (sms only)
[ OPINION
Celebrating the Nigerian
Duniya Makaranta! Defence Academy @60
I
drove to Zaria from Kano on Monday could be held responsible for recurrent By Abiodun Oluwadare prepared to mitigate the diverse security
and I was pleased to see that that crashes. threats confronting the nation.
section of the new cross-country The prima facie assessment, and of

A
s the Nigerian Defence Academy The Academy plays a crucial leadership
highway begun by the administration course it has to be made clear that I have (NDA) marks its 60th anniversary, role in addressing extremism, particularly
of Muhammadu Buhari was all but no competence as far as traffic science it stands not only as a venerable in the context of the complex security
complete. The last time I drove on the goes, was that this was an act of God. institution but as a guardian of the nation’s challenges faced by Nigeria. An overview
same highway, there was a particularly Now, let’s be candid and truthful to security, embodying a rich history of of the NDA’s leadership role in addressing
gruesome accident - a head-on collision ourselves. We are slipping away, and the resilience, discipline, and unwavering extremism includes counterterrorism
between two minibuses, and there were reason, to me, is not the tragedy Islamic commitment. From its inception to the training, which is instrumental in providing
no survivors in the two vehicles. A third fundamentalists believe it is. For instance, present day, the NDA has played a pivotal specialized training to military personnel
vehicle, a minivan, was involved, and Islamic theology is explicit on what we do role in shaping the defenders of Nigeria and in counterterrorism tactics and strategies.
of the 11 occupants, nine survived with in terms of devotion is really for our own contributing significantly to the nation’s Given the persistent threat of extremist
varying degrees of injuries. good, not Allah’s. security landscape. groups in Nigeria, including Boko Haram,
A few days later, it was a subject of I remember sometime back there Established on October 5, 1964, the NDA the academy plays a vital role in preparing
discussion among my friends as the was a cholera epidemic in Zamfara, was born out of the necessity to have a officers for counterinsurgency operations.
incident apparently made the rounds in and the then state governor, Governor unified institution that could produce well- As a high-ranking military academy, the
social media and even the traditional Yari, was practically eaten alive because trained and disciplined officers capable of NDA has embarked on a holistic military
media. And somehow, the discussion he insinuated that the state was at defending Nigeria’s territorial integrity. The education that includes an understanding
veered into the territory of that popular the receiving end of God’s wrath as a timing was critical, as it coincided with a of the socio-political and economic factors
conservative Muslim doctrine of consequence of abandoning the dictates of period of heightened regional tensions and contributing to extremism for its cadets.
predestination--it was meant to happen, God. I am one of the fans of the deposed the impending Nigerian Civil War. The This holistic approach equips leaders with
and could not have been avoided. emir of Kano, Muhammadu Sanusi II, but academy emerged as a crucible where the a broader perspective to address the root
It was not about the negligence of the I disagreed with him when he joined the causes of extremism.
authorities who should have found a way lynch mob against Governor Yari. The NDA has also been continually
to rein in the excess of drivers who have a We seem to have a disturbingly narrow, As a high-ranking military unrelenting in the development of its trainees
burning need for speed, or the contractors simplistic and insecure view of what Islam in strategic leadership. The NDA focuses
who ought to have demarcated boundaries is and who God is. I will state here, that I academy, the NDA has on developing strategic leadership skills
on the lanes both inbound and outbound have a profound belief that every calamity, embarked on a holistic military among its cadets. This includes an emphasis
traffic must share as work continued on every evil is a consequence of letting on critical thinking, decision-making, and
the inbound lanes coming from Zaria. go of the Rope of Allah. Yes, as much as education that includes an adaptability, which are essential qualities
Moments like these have caused serious any community of Muslims everywhere understanding of the socio- for leaders confronting the multifaceted
clashes between what I thought of myself on this earth, we are conscious of the
and what others think of me. I don’t think demands of Islamic jurisprudence but not political and economic factors challenges posed by extremism.
The NDA places a strong emphasis
of myself as a fundamentalist even though so much with Islamic metaphysics. contributing to extremism for on instilling ethical leadership values in
my Muslim friends think I am one. I think We know that the proximate cause of
of myself as a moderate or even secularist epidemics such as cholera is the subject
its cadets. This holistic approach its cadets. Ethical leadership is crucial in
maintaining the integrity of the military
and my non-Muslim friends agree that I of hygiene--or lack thereof. There are equips leaders with a broader and fostering public trust, especially when
am just that. This being the case, and in too many references in the scripture and
prophetic tradition that hygiene is part
perspective to address the root combating extremist threats.
spite of spirited efforts, I am not able to The NDA fosters collaboration and
put a finger on why this is so. That I know and parcel of Islam. There is even a hadith causes of extremism joint training exercises with other security
of, I do not suffer from a bipolar disorder. saying that Allah is a pristine notion and agencies, such as the police and intelligence
That I know of, I am the same and act he accepts nothing that is not in like ethos of service to the nation was instilled services. This interagency cooperation
the same and think the same and talk the terms. I once stopped attending a certain in cadets who would go on to become the is essential for a coordinated response to
same and even look the same whether I mosque because it was unbelievable that vanguards of Nigeria’s security. extremism that goes beyond traditional
am among fellow Muslims or brotherly anyone would so much as pass through The Nigerian Civil War (1967-1970), also military operations.
non-Muslims. such a place much less expect anything known as the Biafran War, was a defining Research and analysis
But I digress. As I passed through the from such a location to be acceptable to one. At the end of their training before
same bend I met death and agony a year Allah, the most high. The NDA has left an indelible mark on commissioning, the NDA engages its cadets
or so ago this Monday in company of We abandoned the Rope of Allah the history of Nigeria, shaping the nation’s in research and analysis related to the
the friends who think I am a “Qur’an- when we decided to limit ourselves to the security architecture and producing leaders evolving nature of geopolitical development
thumper”, I passed by a crash site with a devotional choreography, we called Sallah who have contributed significantly to in the world. Cadets of the NDA are also
trailer carrying cattle and I think a cargo five times every day, fast for 29 days every various fields. required to conduct research in science
of onions. The trailer had somehow Ramadan, read and memorize the Qur’an, The NDA’s products had contributed and technology before being granted a
toppled over upon a Golf wagon and more go to Hajj too many times than can be significantly to Nigeria’s security commission.
than a dozen cattle were in the throes of counted but forgot to live like sane human environment right from the time of the This research contributes to the
death and in the process of being ritually beings instead of pigs. We abandoned the civil war (1967–1971) when its Course development of effective counterterrorism
slaughtered so that the meat could be Rope of Allah when we decided to build One cadets were commissioned and sent strategies and ensures that military leaders
considered Halal and permissible for grands mosques and forgot that Allah is to the war front. As young officers, the are informed and adaptable in their
consumption by Muslims. the essence of justice--and if you think commissioned officers demonstrated approach. The commissioned officers are
There was a banner hanging from the you can rob the public and then build a exceptional leadership and military skills in well-exposed to the daunting political
rear bumper of the trailer which read, mosque to absolve yourself, you’re only restoring peace and unity to the nation. shenanigans around the world.
“Duniya Makaranta”. It was rather poetic. fooling yourself. The NDA alumni were actively Community engagement and outreach
This world is indeed a classroom. Duniya Makaranta, says the involved in addressing internal uprisings One of the paramount areas that cadets are
There was an accident around the same Hausaman—meaning the world is a (1970s–2000s), including the Niger Delta exposed to during training is civil-military
vicinity, and as far as I could see the same classroom. And as long you keep on militancy. The academy adapted its training relations. This is a new trend, as the dynamics
causal circumstances were strikingly the learning and opening up your mind, to equip officers with the skills needed of education are changing people’s thinking.
same. And this time, both the inbound you will one day find truth and the face for counterinsurgency and peacekeeping In this regard, the curriculum of the NDA
and outbound lanes on that stretch of of God. Islam is in a dire need for a operations. is noted for community engagement and
road are 100% complete. And the vehicle holistic renaissance because we have long Subsequent internal uprisings and outreach programmes. Building positive
involved this time is inherently incapable abandoned the Rope of Allah and that is security challenges, including the Niger relationships with local communities is
of overspeeding even if only by virtue of the genesis of every problem we have as a Delta militancy and the Boko Haram crucial for gathering intelligence, preventing
the weight of the cargo it carried. community. insurgency, tested the mettle of NDA radicalisation, and gaining support in the
I lack the competence to decide whether Indeed, the world is a classroom. Learn alumni. The academy, adapting to evolving fight against extremism.
the trailer was overloaded, and because I about Allah, learn about Islam, and not threats, continued to refine its curriculum, In recent times, the NDA products that
kept moving and did not stop for a look, just political or jurisprudential Islam, ensuring that officers were equipped with are playing pivotal roles in the political arena
I have no record of whether or not there but the actual Islam enshrined by God the skills and mindset needed to address in the country are participating in erecting
were human casualties but from the looks the most high, and as delivered by his contemporary security challenges.
of it, there must have been. I also cannot messenger and you shall find redemption. Over the years, the NDA evolved its Col Oluwadare (rtd), NDA
tell whether there was an engineering Both here and the hereafter. curriculum to address emerging security
design flaw around that stretch which Allah yasa mu dace! challenges, ensuring that officers were well- — Continued on www.dailytrust.com
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
13
EDITORIAL [ PRETTY MUCH EVERYTHING[
CHIKA UNIGWE
chikaunigwe@dailytrust.com

No. 20 P.O.W. Mafemi Crescent, Off Solomon Lar Way, Utako District, Abuja
On being a good neighbour
There must be merit, integrity I think it was the great Ngugi
Wa Thiongo who once said in an
the man was arrested, and she took
the girl to Mirabel Centre, Lagos
interview a long time ago that writers where tests were carried out on her,
in police recruitment are like Cassandra (from Greek
mythology): doomed to prophesy but
and the medical report forwarded
to the police station holding the
never to be believed. There are times criminal. Unfortunately, the latest

T
he police, in every society, play a critical role in the maintenance of law and I scare myself by writing stories I am update is that the monster has been
order as well as the detection and prevention of crime. To recruit policemen sure I have made up, only to have released after “settling” with the girl’s
and women we can be proud of, we must take the issues of physical assessments the same scenarios as in my story family.
and background checks seriously, because we cannot plant maize and expect to play out in real life. Earlier this year, It is clear to me that this 43-year-
harvest rice. I started working on something new, old man didn’t just want a house
Therefore, anyone going into the Nigeria Police Force (NPF) must be a person and convinced the plot was getting help, he wanted a sex slave. There is
of good character and impeccable integrity. Such a person must also be someone out of hand, I paused the project. A no mention of his wife coming to the
that can be trusted enough to carry weapons on our behalf and put our national week later, I read a post on Twitter little girl’s aid, and as there is no way
that seemed like it was lifted from she wouldn’t have known what was
interest above any other. This is one thing we must ensure in the ongoing process of
the plot I was sure I’d made up. The going on, she is completely complicit
recruitment into the NPF. distressing thing is that the real life in this. Shame on her. To keep a child
Luckily for the country, the fierce legal battle as to who should be responsible for story is even wilder than what my in your home to look after your own
the recruitment of constables into the Nigeria Police Force has since been settled in imagination had conjured up. children, and watch your pedophilic
favour of the Police Service Commission (PSC) by the Supreme Court judgment of husband sexually abuse her night
July 20, 2023. It is imperative that the ongoing recruitment exercise should be based after night is a different level of evil.
on merit and personal character of such men and women.
The exercise, which started on January 8 this year, should be strict as persons with
To keep from being To live with a man like that, to have
him near your children even though
questionable character and those lacking in integrity had found their way into the overwhelmed, I always he is the father makes you as unfit to
police force and other security agencies in the past. For instance, there was outrage be a parent as he is.
when some alleged repentant criminals were recruited as constabularies in Kano State,
look for a silver lining, The little girl has now been
returned to her parents in Abia
with many Nigerians arguing that individuals with criminal records and or shady no matter how dark the State. I pray that whatever it was
pasts have no business being in the Force. But the PSC defended the recruitment,
noting that the “repentant criminals” were recruited as police constabulary because story. In this case, it’s that compelled them to send her out
to work, and to work for someone
they had realised that crime does not pay, adding that “the Constabulary operations the neighbour who put to whom they had no access (she
are covered and recognised by the Police Act, and are readily useful and needed now couldn’t even reach them when she
that the nation is fighting to end the siege of criminals across the country”. herself at risk to help a needed help) is removed so that she
Just last week, some police officers were dismissed by the Ogun State Police can stay home and be a child.
Command over armed robbery around Ijebu-Ode. The dismissed officers – Inspector
child, and the Mirabel I am not oblivious to the level
Taiwo Kolawole with Force Number AP/No 341113, Inspector John Ogbe with Force Centre which provided of poverty that encourages the
‘nwaneku’ industry: children from
Number AP/No 309292 and Cpl Idowu Sunday with Force Number 513707 – were
accused of robbing a Tai Solarin University student of over N300,000 on January 12, help, where all the other poor homes running after the spoilt
children of their bosses, fetching and
2024. NGOs the woman called carrying for their age mates, cleaning
Also, a human rights activist in Delta State, Harrison Gwamnishu, on the 19th of and cooking for an entire family, just
January 2024, made a post on X, formerly Twitter, where he accused the officers of didn’t come through for so that their own families back in
arresting a man and extorting $3,000 from him. “The police officers attached to the
Rivers State command left Port Harcourt to Aba, Abia State, arrested the man, took
her. Shout out to them. the villages (mostly) are able to eat. I
wish some charity would take up this
him to Rivers State, Bayelsa State and entered Ughelli, Delta State. After paying 3000 Both the woman and particular case, make sure the little
USD, they moved him back to Port Harcourt and dumped him. Let it be on record girl goes to school, that she has a life
that the commissioner of police in Rivers State is aware of this kidnapping by men the centre show what that would overshadow this terrible
one she’s just left. And as for the
under his supervision,” he alleged. is possible, even in a couple she lived with, they shouldn’t
The Rivers State Police Command responded through its spokesperson, Grace
Iringe-Koko, saying, “The $3000 has been recovered from the officers and returned broken system. Writing be raising kids at all. They do not
deserve to be parents. And they both
to the victims on 18th January”, and the officers have been arrested and made to face
disciplinary measures.
isn’t merely about ought to be properly punished. If I
put them in a novel. I know just how
Many such cases involving police officers who have abandoned and betrayed their documenting reality. It I’d have them punished.
oath are quite common. Members of the Nigeria Police Force are allegedly involved Perhaps, it isn’t so much that
in many criminalities and other nefarious activities, from armed robbery to drug
is also about imagining writers are prophets than that we
trafficking. what is possible are – by default- astute observers
of our societies. And what we think
The PSC had assured Nigerians that “the entire recruitment exercise is free and
are just stories we are making up are
will be based on merit and performance at each stage of the exercise.” We are urging
The story I saw on Twitter was really scenarios our consciousness
them to walk their talk on this. The Chairman of the PSC, Solomon Arase, while of a pre-teen girl who was working know are possible because we know
admonishing the staff of the commission involved in the recruitment process, asked as a domestic help and nanny – our society. To keep from being
them to “remember, you are the guardians of a process that not only holds inherent aka nwaneku- to three children. overwhelmed, I always look for a
significance but also paves the way for the forthcoming 30,000-man recruitment A 12-year-old. The illegality and silver lining, no matter how dark the
approved by the current administration.” unethicality of employing minors to story. In this case, it’s the neighbour
As the recruitment exercise is about to be concluded, it must not leave room for work for one aside, her male employer who put herself at risk to help a
people of questionable character to get into the force. We must also utilise technology – a husband and father - was also both child, and the Mirabel Centre which
in doing a sound background check on potential recruits to get a clear understanding physically and sexually abusive to this provided help, where all the other
of the people that the nation will entrust with arms. child. The little girl had the presence NGOs the woman called didn’t come
of mind to befriend another adult through for her. Shout out to them.
This is an important way to ensure we have a formidable, efficient and committed
tenant, and it was to this woman she Both the woman and the centre show
police force in which Nigerians will have trust. Nigeria is currently dealing with a lot told of her tribulations at the hands of what is possible, even in a broken
of security issues. Therefore, it is imperative to get this recruitment right, if we truly her 43-year-old oga. system. Writing isn’t merely about
seek to end the crisis. She asked her friend to help her documenting reality. It is also about
call her parents so she could return imagining what is possible.
home. While the 12 year old’s new *PSA: Located in LASUTH,
AHMED I. SHEKARAU: Ag. Group Chief Executive Officer/Editor-in-Chief (Print) friend and neighbour was looking for Mirabel Centre is a Sexual Assault
ways to get her out – including via Referral Centre. It provides free
NURA DAURA: Group ED, Finance and Corporate Services
NGOs as she couldn’t get the parents, and timely professional support to
NAZIRU MIKAILU: Group ED, Editor-in-Chief (Digital) an incident occurred that pulled a survivors of rape and sexual assault.
HAMZA IDRIS: General Editor crowd and hastened the girl’s removal Their phone number is 08155770000.
STELLA IYAJI: Group Planning & Commissioning Editor from the home of the pedophile. Her Pass it on to anyone you know who
ISIAKA WAKILI: Deputy General Editor benefactor got the police involved, (sadly) might be in need of it.
14 NEWS Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024

Court orders FG to fix prices of goods in 7 days


By Muideen Olaniyi ordered the government to
fix the price of milk, flour,
The Federal High Court salt, sugar, bicycles, and
in Lagos has ordered the their spare parts, matches,
Federal Government to motorcycles and their spare
fix the prices of goods and parts, motor vehicles and
petroleum products within their spare parts as well as
seven days. petroleum products, which
Justice Ambrose Lewis- includes diesel, Premium
Allagoa gave the order Motor Spirit and kerosene.
yesterday while delivering Falana had approached
judgment in a suit No the court to determine
FHC/L/CS/869/2023, filed whether by virtue of
by human rights activist, Section 4 of the Price
Mr. Femi Falana, against Control Act., the first
the Price Control Board respondent is carrying out
and the Attorney-General its duty to impose a price
of the Federation, listed on any goods that are of
as the first and second the kind specified in the
defendants. First Schedule to the Price
 From left: The General Officer Commanding (GOC) 81 Division, Nigerian Army, Maj. General Muhammed Takuti The judge specifically Control Act.
Usman; Ogun State Governor, Prince Dapo Abiodun; Commander, 35 Artillery Brigade, Alamala, Abeokuta, Brig-Gen
Muhammed Tajudeen Aminu and the Ogun State Commissioner of Police, Mr. Mustapha Alamutu, during a courtesy
visit to the governor’s office, Oke-Mosan, Abeokuta, on Wednesday
Mahdi detained over call
for probe of Buhari, ex-AGF
4 killed as gunmen attack Malami, others - Lawyer
By Dalhatu Liman government top officials
of sponsoring a campaign

Kogi community A Kaduna-based social


activist and whistleblower,
Malam Mahdi Shehu,
of calumny against Mr
Jim Obazee, the Special
Investigator appointed
From Tijani Labaran, Lokoja submitting a report on the attack part of the town that bothers was allegedly arrested by by President Tinubu to
to the Kogi State Governor Usman Nasarawa and Benue states and the police for calling on investigate the tenure of
Four persons have been reportedly Ahmed Ododo. shot sporadically. President Bola Tinubu to Godwin Emefiele at the
killed following an attack by The lawmaker, who represents However, the lawmaker appealed probe former President Central Bank of Nigeria.
gunmen on the Agojeju-Odo Omala constituency in the to the state government to prevail Muhammadu Buhari and Barrister Abubakar
community in Omala Local assembly, claimed that over 100 on the Commissioner of Police some of his top officials, revealed this in a
Government Area of Kogi State. gunmen invaded the community in Kogi, Benthrand Onuoha, and his counsel, Barrister M. I. statement titled: “On
A member of the Kogi State to launch the attack on January 30, other heads of security agencies Abubakar, has said. the arrest and detention
House of Assembly Umar Yahaya 2024 at about 3:30 pm. to deploy their personnel to the The lawyer alleged that of social critic/activist
confirmed the killing yesterday He said the gunmen entered affected areas to maintain law and his client was arrested and whistleblower,
while briefing reporters after the community via the eastern order. and detained on Tuesday Muhammad Mahdi
afternoon in Abuja by Shehu,” and issued in
3 suspects to face trial for Ibadan explosion - Makinde the Inspector-General of
Police (IGP) Monitoring
Abuja on Wednesday.
The counsel said the
From Adenike Kaffi, Ibadan explosion. the suspects quizzed were from Mali. Unit ostensibly on a police have claimed to
He added that the identified persons The chairman of the Nigeria petition written by have arrested Mr Mahdi
Oyo State governor, Seyi Makinde, will face prosecution based on the Institute of Structural Engineers, Buhari’s former Attorney- in his hotel room in
said he has received the official report investigation. Mbim Okutinyang, the lead General and Minister of Abuja based on a tip by
of the January 16 explosion that Owoseni said the character of the coordinator of the team that carried Justice, Abubakar Malami. Mr Malami, relating to
occurred at Adeyi Avenue in Bodija, explosive is known as ‘Water Gel Type out structural integrity on the affected The whistleblower’s an alleged WhatsApp
Ibadan, which killed five persons and Based Explosive’ and that an electric houses, also told journalists that 282 arrest was coming 24 chat between him and Mr
injured many others. spark triggered the explosion. houses were affected. hours after he accused, Mahdi claiming that the
The Special Adviser on Security to He explained that a closed-circuit Mr Alonge said the site of the through his verified X latter attempted to extort
the Governor, Fatai Owoseni, who TV in one of the affected houses gave incident had been cleared in terms handle, some Buhari N500 million from him.
briefed reporters after presenting the footage of how the incident happened. of radioactivity, as the EOC invited
report to the governor yesterday, said
three persons of interest had been
He said the government would also
check the immigration status of all the
the Nigerian Nuclear Regulatory
Agency (NNRA) to conduct another
EFCC quizzes ex-minister Sirika’s
identified concerning the cause of the people of interest since the majority of screening. brother over N8bn aviation contract
Zamfara gov inaugurates trust fund FG moves to curb molestation By Idowu Isamotu on Level 16.
While in office as
From Yusha’u A. Ibrahim, banditry and other criminal of school children The Economic and minister, Sirika was
Gusau activities in the state. Financial Crimes accused of conspiracy,
The state governor, By John C. Azu abuse of office, diversion
Commission (EFCC),
Zamfara State government Dauda Lawal, during the has arrested Abubakar of public funds, contract
The federal government has
has inaugurated a virtual inauguration of the expressed its determination Ahmad Sirika, the inflation, criminal breach
21-member Board of board yesterday, reiterated to protect and ensure a safe immediate younger of trust and money
Trustees of the State Security his commitment to end the learning environment for brother of the former laundering amounting to
Trust Fund intended to end spate of banditry in the state. children in the country. minister of Aviation, Hadi N8,069,176,864.
The Attorney General Abubakar Sirika. According to the EFCC,
NDLEA secures 168 years jail terms of the Federation and
Minister of Justice, Lateef
Daily Trust gathered the amount was for four
that Ahmad Sirika was aviation contracts from
for 15 drug kingpins in 2023 - Marwa Fagbemi (SAN), disclosed
this on Wednesday during reportedly arrested by the former minister to
By Abbas Jimoh headquarters in Abuja while the joint presentation of The Minister of the anti-graft agency on a company known as
addressing commanders, the manual of the Standard Education, Professor Tahir Sunday, February 4, 2024, Engirios Nigeria Limited,
The Chairman of the National officers and men during an Operating Procedure for the Mamman, on his part, said over an investigation of owned by his younger
Drug Law Enforcement awards and commendations Prosecution of Perpetrators the SOP was produced in the aviation ministry. brother.
Agency (NDLEA), Brig. ceremony, said the convicts of School-Related Gender- response to the menace of Ahmad Sirika was The anti-graft agency
Gen. Mohamed Buba collectively got 168 years of Based Violence (SRGBV) sexual abuses in schools alleged to have been said apart from being
Marwa (rtd), has said 15 imprisonment. cases in Nigeria with that could impact on school arrested over an N8 listed as the company’s
the Federal Ministry of attendance and retention at billion aviation ministry MD/CEO, Abubakar is
drug kingpins out of 3,412 A total of 104 personnel Education. basic levels, adding that the probe under Sirika, when the sole signatory to the
suspects were prosecuted and 13 commands that had He said every child has the aim is to deter the offence,
and convicted in 2023. outstanding performances right to receive an education and when it happens, to have he was awarded contracts company’s two accounts,
Marwa who spoke on in the 2nd half of 2023 were free from fear, intimidation, a speedy manner of dealing even though he is a civil domiciled in Zenith and
Wednesday at the agency’s recognised and rewarded. and violence. with it. servant, a deputy director Union banks.
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 15

HAPPY
CHINESE
NEW YEAR 2024
PROGRAM ON AIR ACROSS AFRICA

T
he project of Happy Chinese New Year
2024 is being held for a whole month
from February 5 to March 6, 2024,
on StarTimes TVs and StarTimes
ON App. During the month, viewers in many
African countries can watch the Chinese New
Year related programs on ST Sino Drama, ST
Guide E, ST Guide F, ST Chinese Homeland
and ST Kungfu. Viewers can also watch live and
playback broadcasts online via StarTimes ON
App.

The monthly project, highlighting China’s


unique cultural heritages, will showcase the
Chinese New Year customs and Chinese food,
beautiful scenery and unique culture. During
the Chinese New Year, African viewers either
in front of big TV screens or small cellphone
screens will be able to join the Chinese people
in the celebrations and share its culture and
experience the harmony and beauty of the
festival.

As an annual brand event to celebrate the


Chinese New Year, the one-month broadcasting
project of Happy Chinese New Year has become
an important platform for people of Africa to
share Chinese culture. Since 2021, the event has
been held in Africa for four consecutive years
aimed to promote the traditions of Chinese
New Year, and has continued to diversify its
content for African audience so that they can
better understand China and Chinese New Year.
Over the past four years, over 50 programs with
more than 20,000 minutes combined in time
slot have been broadcast, covering all 16 million
digital TV subscribers, and delivering a number
of well-produced programs that showcase the
latest development of China’s art as well as its
cultural exchanges with other countries.

These programs have been recognized by an


increasing number of African people, and
have deepened the friendship and mutual
understanding between them and the Chinese
people.

Joshua WOg,
CEO of StQT;es Niggia
16 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 17
18 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust


Thursday, February 8, 2024

CONSTRUCTION OF HAND PUMP FITTED BOREHOLES


IN TAFAWA BALEWA LGA, BAUCHI STATE TENDER NOTICE
ITT REF: RFQ 01-035-BOR-2024
INVITATION TO TENDER AND International Medical Corps is a global, humanitarian, non-pro¿t organization dedicated to saving lives and
INSTRUCTION TO TENDERERS relieving suɣering through health care training and relief and development programs.
For its integrated emergency health, nutrition, and wash portfolio of programs project in Nigeria International
1.0 PREAMBLE in the form of photographic evidence. Medical Corps is inviting competent, professional, and established suppliers/service providers capable of supply
Women Development Association for Self-
of the items/services listed below and as described in the tender documents.
Sustenance (WODASS) in partnership with 4.0 ACCESS AND SUBMISSION OF TENDER
WaterAid Nigeria with funding from Armani Beauty, DOCUMENTS AND COMPANY PROFILES ĂƚĞŐŽƌLJͬŝƚĞŵĞƐĐƌŝƉƚŝŽŶĂŶĚůŽĐĂƚŝŽŶ YƵĂŶƚŝƚŝĞƐ
L’Oreal Luxe Germany to implement Water and Interested bidders are to visit Women Development ZĞŶƚĂůsĞŚŝĐůĞĐŽƐƚƐŚŽƵůĚďĞŝŶĐůƵƐŝǀĞŽĨƌŝǀĞƌƐĂůĂƌLJ͕ŵĂŝŶƚĞŶĂŶĐĞ͕ĂŶĚĨƵĞů͘
Hygiene Promotion Project (WAHPP) in Bauchi Association for Self-Sustenance (WODASS) at sĞŚŝĐůĞƚLJƉĞ͗^hs;ϰdžϰ'yϰϳϬͿŽƌƐŝŵŝůĂƌ
State hereby invites tenders from reputable and No. 17 Tafawa Balewa Road GDSS Junction, Dass,
quali¿ed companies for the construction of 15 hand Bauchi State to access the bid documents or call the
sĞŚŝĐůĞLJĞĂƌ͗ϮϬϬϬĂŶĚĂďŽǀĞ͘ ϮϮ
>ŽĐĂƚŝŽŶͲǁŝƚŚŝŶWƵůŬĂ͕'ǁŽnjĂ͕ŝƵ͕ĂŵďŽĂ͕ĂŶŬŝ͕ŚŝďŽŬ͕ĂŵĂ͕,ĂǁƵůĂŶĚ
pump ¿tted boreholes in Tafawa Balewa Local following phone numbers 08065308457. A non-
ƐŬŝƌĂͲhďĂ
Government Area of Bauchi State. refundable administrative charge of N25,000 would
be paid by all interested bidders to account details ZĞŶƚĂůsĞŚŝĐůĞĐŽƐƚƐŚŽƵůĚďĞŝŶĐůƵƐŝǀĞŽĨƌŝǀĞƌƐĂůĂƌLJ͕ŵĂŝŶƚĞŶĂŶĐĞ͕ĂŶĚĨƵĞů͘
2.0 SCOPE OF WORK that would be provided by the responsible oɤcer. sĞŚŝĐůĞƚLJƉĞ͗^hs;ϰdžϰ,ŝŐŚůĂŶĚĞƌͬ'yϰϳϬͿŽƌƐŝŵŝůĂƌ
sĞŚŝĐůĞLJĞĂƌ͗ϮϬϬϬĂŶĚĂďŽǀĞ͘
ϱ
• LOT1: 5 boreholes – 3 in Gwallare (Luti Hayi, Lili
& Gwallare), 1 in Bodi (Maciyar Kukan Fulani) Submission of tender documents shall commence >ŽĐĂƚŝŽŶ͗ǁŝƚŚŝŶ<ĂŶŽ
and 1 in Funde community (Bununu A) from 8th to 22nd February 2024 between 9:30 ZĞŶƚĂůsĞŚŝĐůĞĐŽƐƚƐŚŽƵůĚďĞŝŶĐůƵƐŝǀĞŽĨƌŝǀĞƌƐĂůĂƌLJ͕ŵĂŝŶƚĞŶĂŶĐĞ͕ĂŶĚĨƵĞů͘
• LOT 2: 5 boreholes – 3 in Lere (Unguwan Kawari, am to 3.30 pm, Mondays to Fridays, except on sĞŚŝĐůĞƚLJƉĞ͗^hs;ϰdžϰ,ŝůƵdžŽďůĞĂďŝŶŽƌƐŝŵŝůĂƌͿ ϭ
Unguwan Kasa & Hamdala), 1 in Kwajolde (Rugan public holidays. Completed tender documents and >ŽĐĂƚŝŽŶ͗ǁŝƚŚŝŶƐŬŝƌĂͲhďĂ>'
Gambo) and 1 in Duguriyel (Badagari) company pro¿le, which shall be in Three copies ZĞŶƚĂůsĞŚŝĐůĞĐŽƐƚƐŚŽƵůĚďĞŝŶĐůƵƐŝǀĞŽĨƌŝǀĞƌƐĂůĂƌLJ͕ŵĂŝŶƚĞŶĂŶĐĞ͕ĂŶĚĨƵĞů͘
• LOT 3: 5 boreholes – 3 in Bar (Bar, Tudun Wada (ONE original and TWO photocopies), a
sĞŚŝĐůĞƚLJƉĞ͗^hs;ϰdžϰ,ŝŐŚůĂŶĚĞƌͬ'yϰϳϬͿŽƌƐŝŵŝůĂƌ
& Tanzandan) and 2 in Tafare (Tafare Fada & spreadsheet document of the completed BOQ and ϯ
sĞŚŝĐůĞLJĞĂƌ͗ϮϬϬϬĂŶĚĂďŽǀĞ͘
Gandi) copies of other bid documents are to be submitted in
a sealed envelope marked with the company’s Name, >ŽĐĂƚŝŽŶ͗ǁŝƚŚŝŶďƵũĂ
3.0 MANDATORY REQUIREMENTS at the top left-hand corner, and addressed to: ZĞŶƚĂůsĞŚŝĐůĞĐŽƐƚƐŚŽƵůĚďĞŝŶĐůƵƐŝǀĞŽĨƌŝǀĞƌƐĂůĂƌLJ͕ŵĂŝŶƚĞŶĂŶĐĞ͕ĂŶĚĨƵĞů͘
Companies interested in participating in the sĞŚŝĐůĞƚLJƉĞ͗^hs;ϰdžϰ,ŝůƵdžŽďůĞĂďŝŶŽƌƐŝŵŝůĂƌͿ
ϭ
tendering process are to submit their company Women Development Association for Self- sĞŚŝĐůĞLJĞĂƌ͗ϮϬϬϬĂŶĚĂďŽǀĞ͘
pro¿les which must contain the following: Sustenance (WODASS) >ŽĐĂƚŝŽŶ͗ǁŝƚŚŝŶDĂŝĚƵŐƵƌŝ
i. Evidence of registration with the Corporate Sealed envelopes will be received at WODASS at
Aɣairs Commission (CAC). No.17 Tafawa Balewa Road GDSS Junction, Dass
Retrieving Tender documents
ii. Evidence of the company’s audited ¿nancial Bauchi State until 12 noon on 22nd February The tender documents can be retrieved from February 5th Feb, 2024, between Monday to Friday from 10am to
account and Tax Clearance Certi¿cate for the last 2024. Bid opening shall follow at 12:30 pm on 4pm at following address:
three years (2021, 2022 and 2023). 22nd February 2024 at the same venue. 1. From International Medical Corps Nigeria oɤce in below address:
iii. List of certi¿ed Board Members showing their a) Plot 57 Damboa Road, Oɣ Circular Road GRA Extension Maiduguri Borno State
designation on the Board. 5.0 MANDATORY SITE VISIT b) Plot 882 Olu Awotesu Street, directly opposite Kuriftu Plaza, Oɣ Idris Ibrahim Crescent, Jabi, Abuja
iv. The forwarding letter submitting the bid Mandatory visit to the sites must be carried out by 2. By contacting the procurement department using below e-mail address imcnigeriaprocurement@
documents should be signed by the Chairman of all tenderers. This visit will take place within the InternationalMedicalCorps.org), or
the Board or his alternate. tender period. Tenderers are to take photo shots of ckibet@internationalmedicalcorps.org who will then share with you the tender package by email.
v. Resumé of key technical staɣ (Geologist or the locations as evidence of compliance.
Hydrogeologist, Civil Engineer or Electro- Submit bidding documents
Mechanical Engineer). 6.0 DISCLAIMER All tender documents should be submitted via secured email address mentioned below:
vi. Veri¿able evidence of similar projects previously This advertisement for “Invitation to Tender” shall Tender.ABV@InternationalMedicalCorps.Org
undertaken, including letters of awards and not be construed as a commitment on the part of
Completion Certi¿cates within the past three (3) WaterAid and its Partners nor shall it entitle any Deadline for submitting completed tender bids is 29th February 2024
years; also, indicate the ¿nancial value of these company to make any claim whatsoever, and/or seek Email title should be: Tender RFQ-01-035-BOR-2024 BPA Vehicle Rental Services in Nigeria
similar projects. any indemnity from WaterAid Nigeria or its Partners
vii. Certi¿ed copies of company bank statements in and/or any of their departments, by virtue of such A full schedule will be detailed in the tender documents. Award of contract will follow, following internal
the last 6 months. company having responded to this advertisement. evaluation process.
viii. Description and list of relevant equipment owned All expenses incurred in preparing an “Invitation International Medical Corps reserves the right to accept or reject any part of, or the entire tender in accordance
by the company, including proof of ownership or to Tender” response and all expenses otherwise
with internal procedures.
lease or license over the equipment. associated with the “Invitation to Tender” responses
ix. A work plan indicating how the work will be shall be borne solely by the prospective company.
carried out from start to ¿nish and the number
The winning bid or bids taken from this competitive bidding process, only by agreement of the winning bid/s, may
of days required to complete the work. Signed: be considered for entry into a ‘Blanket Purchase Agreements’ for future supply of the below items to International
x. Evidence of site visits to the communities/sites Management Medical Corps.
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 19
BUSINESS
CBN EXCHANGE RATES COMMODITIES PRICE BUREAU DE CHANGE RATES

SELLING BUYING
US DOLLAR Pound STERLING EURO YUAN/ RENMINBI RIYAL CFA Dollar Euro Pound S.
CRUDE OIL BRENT $80.1/bbl
Buying 860 974 844 108.1 118.5 0.70 N1,030 N1,045 N1,240
GOLD $1,799.07/ounce
Central NGN 864 974.5 843 107.5 118.7 0.71 SILVER $19.39/ounce Dollar Euro Pound S.
Selling NGN 869 975 845 108.3 118.8 0.72 NATURAL GAS $4.63/MMBtu N1,040 N1,060 N1,310

Forex crisis: Nothing for Nigeria as Electricity consumers


rise to 13m in
our crude oil sold in advance – NGF December – NERC
By Faruk Shuaibu
From Mumini Abdulkareem, or so had been sold in advance. So,
The Nigerian Electricity
Ilorin they don’t get value for whatever
Regulatory Commission
they are selling now. But gradually,
(NERC) has stated that the

K
wara State Governor things will change and we need
registered customers rose to
Ab d u l R a h m a n your support to understand us,” he
13,162,572 in December 2023.
AbdulRazaq and added.
The commission in a factsheet
chairman of the Nigeria AbdulRazaq said the
released on its official X handle,
Governors’ Forum (NGF) has government is immediately
formerly Twitter, showed that
called for patience over the working to force down the cost
only 5,842,726 customers are
ongoing economic hardships of key staple foods by releasing
metered with 7,319,846 billed
being experienced in the country. grains from the strategic reserve
on estimated billings.
The governor said this during and distributing the same to the
It said 43,631 customers were
a briefing in Ilorin with different people at intervals.
metered during the month.
segments of the state on efforts of The devaluation of the naira,
It went on to show the
the government to ease things for the Governor noted “meant that
Ibadan Electricity Distribution
the people. merchants from neighbouring
Company (IBEDC) had the
The sessions, which lasted for countries are mopping up grains
highest customers of 2,401,864
hours, involved labour union from Nigeria.
registered on its network
leaders from the transport,  Gov. AbdulRazaq
“This is because it is far cheaper
followed by the Abuja DisCo
artisans, market unions and to buy from the country and then
with 1,414,356 registered
students drawn from various According to him, “We dollars from sales of crude oil, resell at higher prices in their own
customers.
backgrounds in the state. (governors) held a meeting whereas we have low sales at the countries, especially in the West
Others include Enugu DisCo
In a statement signed by Rafiu on Tuesday afternoon which I moment. We used to experience African sub-region”.
with 1,396,440 customers, Benin
Ajakaye, Chief Press Secretary to joined through zoom, and it is a pipeline vandalism. Acknowledging the spike in
DisCo with 1,324,373; Ikeja
the Governor, AbdulRazaq said continuation of previous meetings. “But since the assumption of inflation, he urged the people
DisCo, 1,238,295; Port Harcourt
that different federal government The government is launching Tinubu’s government, production to be patient adding that the
DisCO with 1,179,194; Kano
committees are working round programmes to checkmate the of oil has increased. Not only that, government’s investments in gas-
DisCo, 872,656; Kaduna DisCo,
the clock to plug the spiraling fall rising food prices. the government realised recently powered vehicles will manifest
864,128; Jos DisCo, 730,402;
in the value of the naira and its “Our major problem is foreign that the crude oil we are, and will after their distribution in the
Yola DisCO 813,313 and Aba
impacts on consumer goods. exchange. We are getting US be getting in the next six months coming months.
power with 191,405 customers.
The sheet also stated that the

Four banks holding $5bn – Reps commission received 91,576


complaints during the period
with metering topping the most
By Balarabe Alkassim
To probe erring institutions that four commercial banks have
a cumulative excess holding of
complaints as 57,119 cases were
received followed by billing
The House of Representatives CBN had, as part of measures market forces and certain over five billion dollars as of with 17,734 cases.
has mandated its committees to address the rising foreign economic policies adopted by January 2024. Other complaints include
on Banking Regulations and exchange, directed banks to sell the government, including the He however said one interruption with 6,510 cases;
Banking Institutions to investigate excess dollars in their NOP. liberalisation of the dollar. commercial bank has been voltage, 1,244; disconnection,
non-compliance by banks and NOP is the net outstanding The lawmaker however identified to be fully compliant 1,182; load shedding, 422;
financial institutions with Central forex balance of all assets, expressed concern that as it always makes all forex in its delay 169 and other complaints,
Bank of Nigeria (CBN) directives liabilities and off-balance sheet commercial banks and certain reserve available to clients. 17,194 cases.
on the Net Open Position (NOP) items of commercial banks financial institutions in Nigeria Rep. Benson said, “This Daily Trust reports that while
limits. Presenting the motion, Benson usually hold back a large part speculative activity by metering existing electricity
The decision followed the stated that there has been a steady of forex they obtain either commercial banks and certain customers has been one of the
adoption of a motion on matters rise in the rate of the dollar in through purchase, borrowing or financial institutions has further major issues facing the sector,
of urgent national importance comparison to the naira, adding allocation from the CBN rather exacerbated the harsh economic the meter manufacturers
by Rep. Babajimi Benson that it rose to N1,520 to the dollar than lending to their customers situation in the country and led to association recently raised an
(APC, Lagos) at the plenary on in the last week. with a view to selling it when the difficulty by legitimate businesses alarm that the depreciation of
Wednesday. He said the astronomical exchange rate is high. to obtain forex for their business the naira might cause scarcity of
Daily Trust reports that the rise was due to the diverse He said records have shown transactions. available meters in the country.

Shettima inaugurates committee to unlock $2.5bn Green Economy


From Abdullateef Aliyu, Lagos Nigeria, supported by the Africa Federal Inland Revenue Service Industry, Trade and Investment, credible carbon credits. The plan
Carbon Market Initiative (ACMI), (FIRS), Mr Zacch Adedeji, and the The Ministry of Power, The also aims to ensure the inclusion of
Vice President Kashim Shettima will be working towards the Director General of the National Ministry of Agriculture and local communities and indigenous
will today at the presidential villa, implementation of a co-created Council on Climate Change Food Security, The Special groups.
Abuja, inaugurate the committee blueprint aimed at positioning (NCCC), Dr Dahiru Salisu, to co- Advisor to the President on Speaking at COP28, President
that has been directed by the country with the requisite chair the committee. Climate & NEC , The Managing Tinubu said, “This initiative stands
President Bola Ahmed Tinubu to frameworks and policies to Now, the co-chairs will be Director, Nigeria Sovereign as a testament to our dedication
develop Nigeria’s Carbon Market drive an efficient and sustainable joined by representatives from investment Authority. to environmental stewardship
Activation Plan. carbon market ecosystem with an the following government The committee was tasked with as clearly exemplified through
The inter-governmental estimated value of USD 2.5 billion. ministries and departments as developing a roadmap for making our collaboration with the Africa
committee is expected to guide the President Tinubu previously part of the National Carbon Nigeria an attractive hub for Carbon Market Initiative. Our
development of a National Carbon announced the creation of the Market Activation Plan investors by focusing on driving visionary plan is a strategic
Market Activation Plan that will inter-governmental committee Committee: The Ministry of investments in innovative, green guidepost, directing Nigeria
accelerate green growth and just on carbon markets at COP28 in Finance/ Coordinating Minister and sustainable initiatives across towards becoming an investment-
energy transition. December 2023, and appointed of the Economy, The Ministry of diverse sectors, with a focus on friendly destination for carbon
The Federal Government of the Executive Chairman of the Environment, The Ministry of establishing high-integrity and market investments.”
20 BUSINESS Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024
NEWS
By Faruk Shuaibu
FG partners US to increase Niger, firm sign multimillion
dollar irrigation pact
T investment in mining sector
he federal
government has
From Abdullateef Aliyu, Irrigation Infrastructure
disclosed plans
Lagos Advancement Scheme,
to work with the United Assistant to the minister, see what makes sense for vista of collaboration for will be executed by CMB
States of America (USA) to Segun Tomori, stated that the United States to do. We mining development would Developments, a company
The Niger State
unlock investment in the Hochstein stressed that the will then look at what the strengthen bilateral relations that represents Alkhorayef
Government has entered
mining sector. US had a special relationship infrastructural needs are and translate to mutual Group, a Saudi Arabian
into a partnership with
The partnership was made with Nigeria, thus the to unlock and make those benefits for both countries. conglomerate in Nigeria.
CBM Developments
known during a meeting interest to work with Nigeria investments more attractive. He further said, “We are The project will be
Company Ltd, an
by the Minister of Solid to unlock investments If you want to build a clean putting in place reforms funded by the Saudi EXIM
agriculture development
Minerals Development, Dr in the mining ecosystem mining sector, you can’t do to ensure that we have Bank and Nexim Bank
company that specialises
Dele Alake, and a delegation spanning infrastructural that without electricity. We an enabling environment through a credit line that
in irrigation development,
of the US government led development, technical are already working with in the sector, different was extended to NEXIM in
for the irrigation of 50,000
by Senior Advisor to the assistance in upscaling your government on clean from the experiences we November, 2023.
hectares.
US President on Energy mining operations. energy options for us to had in the past. I suggest Niger Foods has a
At a ceremony which
and Infrastructure, Amos The statement reads in finance.” that we form a small joint strategic plan of establishing
had Governor Mohammed
Hochstein, on the sidelines part: “Let’s figure out a way In his remarks, Alake working group that will 25 farm estates, starting
Bago in attendance, the
of the ongoing Investing in between us where we can lauded US interest fashion out modalities with 10,000 hectares per
agreement was signed
Africa Indaba, Cape Town, share whatever you have in the mining sector, for collaboration and local government area.
by CMB Development’s
South Africa. with our team, then we can emphasising that as Nigeria’s fast-track the flow of The state’s agricultural firm
Chairman, Ms Telia
In a statement, the Special work with companies to longstanding ally, a new information on both sides.” plans to create between
Urey, and the Executive
Chairman of Niger Foods, 250,000 and 5,000,000
the state-owned agricultural hectares for production,
 From left: Regional development vehicle, Mr aggregation, processing,
Director Central Africa Sammy Adigun. conditioning and storage
and Anglophone West The irrigation in all the local government
Africa, International project, The Niger areas of the state.
Finance Corporation
(IFC), Dr. Dahlia
Khalifa; MD/CEO, Wema Bank rewards staff, customers
Bank of Industry, Dr. From Yvonne Bank 5for5 Promo
Olasupo Olusi; and Ugwuezuoha, Lagos Season 3; a 10 per cent
the Regional Vice discount on all GAC cars;
President Africa,
IFC, Mr. Sergio Wema Bank has launched free prepaid gift cards
Pimenta, at the BOI- its 2024 Love Adventure worth N10,000 for ALAT
IFC Conference on campaign, offering customers; car loans and
Empowering Futures, customers and staff an device loans, including a
held in Lagos outstanding range of whopping N100,000 off
rewards and cash prizes all Samsung S24 Series
Photo: BOI loan purchases on ALAT;
all through February - the
famed month of love. free airtime and data for
The campaign, themed: customers who transact
“Your Love Adventure on ALAT and *945# free
Ogun constitutes c’ttee on investment is Possible with ALAT”,
is set to simultaneously
Dakore skincare products
and discounts on 5-Star
From Peter Moses, the growth of current and ambassadors to sharpen promotion and facilitation promote a culture of love restaurants on ALAT
Abeokuta potential investors willing their communication skills agency a success, described and appreciation among Rewards.
to do business in the state. and make accountability them as a link between the Wema Bank’s internal and The Executive Director,
Ogun State Governor, Dapo He explained that the and transparency their government and investors, external audiences. It aims Retail and Digital
Abiodun, has inaugurated a ambassadors would be watchword. adding that a proper to empower Wema Bank’s Business, Wema Bank,
12-man committee tagged responsible for enlightening He said the government regulatory framework customers with resources Tunde Mabawonku,
Ogun Invest Ambassadors investors on how to harness would, on a regular basis, would be established to and opportunities to attributed the inspiration
Network to create a robust the opportunities that carry out performance earn investors’ trust and bring their plans for the for the love campaign to
and seamless working abound and what they evaluation on them through respect. love season to life while the bank’s commitment to
relationship between the stood to gain by doing private organisations Identifying the calibre enriching them with a providing an exceptional
government and investors business with the state, transacting business with of people in the network’s plethora of rewards via its banking experience for
for businesses to thrive in adding that their role was the state, promising that chain, the Commissioner digital platform, ALAT, every customer and being
the state. pivotal in building bridges, those who performed well for Budget and Planning, including a N9,000,000 a support system for all
Abiodun, during fostering collaborations would be compensated Mr Olaolu Olabimtan, cash prize in the Wema stakeholders.
the inauguration and and attracting investors that accordingly. noted that a new lease of
orientation course for the would propel the state to Also speaking, the life would soon commence
ambassadors at the Ogun new heights. Commissioner for in the state’s investment Bank of Industry to disburse
Invest office, Isheri, Ifo
LGA, said the initiative was
Abiodun, represented
by the Commissioner
Industry,
Investment,
Trade and
Adebola
journey, expressing hope
that their selection would
N200bn to MSMEs, others
a landmark in the history for Finance and Chief Sofela, who admonished ensure a critical turning From Abiodun Alade, Sector Fund.
of the state as it would Economic Adviser, Dapo them to be diligent in point in the investment Lagos The BoI in a statement
make a huge difference to Okubadejo, tasked the making the investment atmosphere of the state. noted that the Presidential
The Bank of Industry Conditional Grant Scheme
NNPC, others begin production of oil from Akpo West Field (BOI) has been appointed
by the Federal Government
(PCGS), is a N50bn grant
scheme to support eligible
By Faruk Shuaibu interest, in partnership with meticulous planning, Storage and Offloading as the executing agency of Nano Business owners.
CNOOC (45%), Sapetro strategic collaboration, and (FPSO) facility via a subsea a N200 billion fund to It noted that the
The Nigerian National (15%), Prime 130 (16%), unwavering dedication from tie-back to keep costs low support businesses across Grant will be disbursed
Petroleum Company and the Nigerian National all stakeholders involved in and minimize greenhouse Nigeria. to a minimum of 1,000
Limited (NNPC Ltd) says Petroleum Company Ltd the project, will add 14,000 gas emissions.” The Federal Ministry beneficiaries (especially
the Akpo West, a Petroleum as the concessionaire of barrels per day of condensate He added that the of Industry, Trade, and Women and Youths) per
Mining Lease (PML) 2 the Production Sharing to the nation’s production. milestone was enabled by Investment (FMITI), Local Government Area
(formerly OML 130), has Contract (PSC). “This will be followed the strategic leadership of recently established three (LGA) in the 774 LGAs
started production of 14,000 “To optimise production up by the production the Group Chief Executive funds totaling N200bn to across the Nation and the
barrels of oil per day. from the nation’s oil and of about 4million cubic Officer (GCEO), Mr. Mele support businesses across 6 (six) Council Areas in the
A statement by gas assets, the Company has meters of gas per day by Kyari, and the Upstream Nigeria. FCT, adding that the target
NNPC’s Chief Corporate announced the successful 2028. The development Directorate of the NNPC The funds are the nano businesses include
Communications Officer, commencement of oil of Akpo West which is on Ltd whose support played Presidential Conditional traders, food vendors, ICT
Olufemi O. Soneye, production from the Akpo Petroleum Mining Lease no small role in propelling Grant Scheme (PCGS), businesses, transporters,
stated that the oil field is West Field,” he said. (PML) 2 (formerly OML the operators to actualise The FGN MSME artisans, creatives, among
operated by operated by Soneye said the milestone, 130) leverages the existing the short- and mid-term Intervention Fund and others and beneficiaries are
TotalEnergies with a 24% which is the result of Akpo Floating Production hydrocarbon production. the FGN Manufacturing not required to pay back.
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 21
GOLDEN HARVEST COMMODITY INDEX Quote What is your take
Commodity Kano (Dawanau mkt) Jingir Mkt, Plateau Dandume Mkt (Katsina) Saminaka, Mkt, Kaduna M/Biyu Mkt, Taraba Kumo Hatsi Mkt (Gombe) Egg is now a rich man’s food; it is no on our stories?
Maize (100kg) N57,000 N51,000 N56,000 N51,000 N45,000 N58,000 longer affordable for the poor. I am
Beans (100kg) N81,000 N80,000 N80,000 N80,000 N73,000 N82,000 considering switching to cheese for Send us your views,
Sorghum (100kg) N49,000 N50,000 N50,000 N45,000 N53,000 N50,000 my children as a source of protein comments as well as
Rice Paddy (100kg) N45,000 N ------- N46,000 N ------- N35,000 N44,500 pending when the process will contributions to agric@
Millet (100kg) N55,000 N50,000 N56,000 N51,000 N54,000 N58,000 normalise dailytrust.com or
Wheat (100kg) N58,000 N ------- N59,000 N51,000 N -------- N59,500
Rice (100kg) N105,000 N110,000 N100,000 N73,000
– Mrs Chinyere Obasi, a Lagos-based SMS: 08116759756
N95,000 N100,000
businesswoman

Why dried tomato price


From Idris Mahmud, Katsina

T
he general decline in
the volume of fresh

continues to rise in Katsina


tomatoes produced
this year may lead to high
demand and a rise in the cost
of the dried variety in the
forthcoming Ramadan and
Sallah periods, Daily Trust
reports.
According to the dealers, sun-
drying of tomatoes was mainly
a result of glut; so that farmers
and dealers could mitigate the
loss in the value of the produce;
but which has now become a
trend in the value chain of the
produce.
Malam Muhammad Kokami,
a tomato farmer and dealer, said
with the growing population in
the country and the high cost
of production, tomatoes would
hardly lose their value in their
production circle, as was the
case before.
“Not every farmer can engage
in tomato production like before
because of the high cost now.
Some of us have switched to
potato, onion, wheat or cabbage
production, and if you go round
the irrigation sites you will
notice that the volume produced
in the last two years has grossly
reduced.”
Kokami added that the  A tomato drying field at Danja, Katsina State
shortage of water in their tube
wells and rivers has forced some that the dealers were doing it to they were still sun-drying the July when irrigation farming has modern tomato drier and
farmers to abandon their crops maximize profit in future and as produce in order to meet up subsided and wet season fresh storage facilities. Take a look at
mid-way into production this a store of value. with the demand in the next few ones are yet to be in the markets. Danja, Dantankari, Tafoki, Kafur
year. “We are quite different from months. On the issue of modern and Bakori where tomatoes
“All these factors, plus our farmers because we are the “A crate of fresh tomato is storage and drying facilities, are yearly being produced in
growing population, demand players in the market and always now sold for N5,000 to N6,000, Kabiru Abubakar an agric commercial quantities yet there
has increased on the limited looking for opportunities to unlike when it was sold at a little entrepreneur said there was was no intervention in the
supply of tomato in the markets exploit. Since Kano farmers over N1,000. Presently a bag of no genuine commitment from system of storage and drying
hence farmers hardly sun-dry experienced a disease attack dried tomatoes goes for N45,000 both the government and the to mitigate loss and improve
the produce as they can rake on their tomato farms some and only God knows where it private sector, especially as quality,” Kabiru Abubakar said.
their revenue on the fresh ones months back, we envisaged will reach in the approaching dried tomato has now become a He called on the state
without any added cost or high demand for the produce Ramadan and Sallah periods,” value addition of sorts to tomato government to consider
labour,” Kokami said. here at this period and most said Alhaji Usman Abdu. production, especially in the intervening in the provision
Another tomato dealer, Alhaji importantly the dried one in the He further said they were North. of modern storage and drying
Usman Abdu, said farmers next few months,” he said. stockpiling the dried produce “For years, there were facilities just like it provides
sun-dried tomatoes just to He added that despite the to be released to the markets in promises but none of which solar-powered water pump
mitigate loss during glut, but market value of the fresh ones, the months of May, June, and came to fruition as it regards machines to irrigation farmers.

Dutch govt, IITA to train 10,000 Nigerian youths in agribusiness


By Vincent A. Yusuf kingdom was collaborating with between 18 and 35 in agribusiness. indirect beneficiaries of 40,000.
key institutions in the country to The Team Lead, YAS, Ms So at least every young person or
The Kingdom of the Netherlands, in promote food security, job creation Aline Mugisho, said the project every business created we intend
partnership with the International and wealth through agriculture for was being implemented with the to nurture it and to help them
Institute of Tropical Agriculture Nigerians. support of the Kingdom of the generate at least another four jobs.
(IITA), is set to train 10,000 The Dutch minister, along with Netherlands, while Golden Finger “We are accelerating their
Nigerian youths in agribusiness the Ambassador of the Netherlands Farms and Ranches, which is the businesses, making sure we link
using innovative technologies for to Nigeria, Mr Wouter Plomp, also agri-hub for YAS in Abuja, and them to direct market systems
sustainable food production. toured the Golden Finger Farms Bopinc serve as partners in training and also connect them to financial
The Minister of Foreign Trade and Ranches, which is the agri- the beneficiaries. institutions.
and Development Cooperation, hub for YAS in Abuja, and also Ms Mugisho said the project “You cannot have food security
Kingdom of the Netherlands, inaugurated a new training hall for focuses on the youth because unless you have a good income for
Mr Geoffrey van Leeuwen, while the project. Nigeria is at a very crucial time individuals and this individual’s
addressing the beneficiaries Youth in Agribusiness (YAS) where unemployment is rising and income eventually creates the
on Monday in Abuja, said the is a project by the International food security is a key challenge. precedence for us to have a food
youths are the future of Nigerian Institute of Tropical Agriculture “In YAS alone we are training secure youth and young people are
agriculture, adding that the (IITA) to train youths aged 10,000 youths with expected among the most affected,” she said.
22 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024
24 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024

$GYHUWRULDO

7+(8135(&('(17('0$*,&$/728&+2)1<(620:,.(,1)&7
7KH DSSRLQWPHQW RI 1\HVRP :LNH DV WKH )&7 0LQLVWHU LQ $XJXVW  E\ VKLQLQJOLJKWRQWKHWHUULWRU\DQGLWVSHRSOH
SUHVLGHQW%ROD7LQXEXZDVPHWZLWKDORWRIFHOHEUDWLRQVLQPRVWSDUWRIWKH
FRXQWU\DVDKLVWRULFDSSRLQWPHQWWKDWPDUNVWKH¿UVWLQVWDQFHRIDVRXWKHUQHU :KLOH RQ WKH LVVXH RI SROLWLFDO IHXG EHWZHHQ WKH PLQLVWHU DQG WKH LQFXPEHQW
KROGLQJWKHSRVLWLRQRI)&7PLQLVWHUVLQFHLWVFUHDWLRQDERXW¿YHGHFDGHVDJR JRYHUQRURI5LYHUVVWDWH6LPLQDOD\L)XEDUDWKDWKDVGHJHQHUDWHGWRDVWDWHD໤DLU
:KLOHKLVNLQVPHQLQ5LYHUVVWDWHDUHLQH[XOWDWLRQVZLWKWKLVGHYHORSPHQWWKH LWLVSHUWLQHQWWRFODULI\WKHLVVXHVWRDQ\RQHWKDWFDUHVWRNQRZ7KRXJK,DP
SHRSOH RI )&7 ZHUHDOVR LQ D MR\IXO PRGH WKDW WKH\ ZHUHVR OXFN\ WR KDYH D QHLWKHUDSDUW\WRWKHFDVHQRUDQLQGLJHQHRI5LYHUVVWDWHEXWZKHQWKHVLWXDWLRQ
KDUGZRUNLQJDQGH[SHULHQFHGPDQOLNH:LNHDVWKHLUPLQLVWHU+DYLQJNQRZQWKDW LVEHFRPLQJYHU\LUUHVSRQVLEOHDQGXQDFFHSWDEOHLWLVUHDVRQDEOHWRVD\RQHRU
ZKHQKHZDVWKHJRYHUQRURI5LYHUVVWDWHKHHQJLQHHUHGWKHWUDQVIRUPDWLRQRI WZRWKLQJVIRUWKHVDNHRISRVWHULW\
WKHVWDWHLQIUDVWUXFWXUDOODQGVFDSHFRXSOHGZLWKWKHIDFWWKDWKHLVVHULRXVLQ
ZKDWHYHUKHLVGRLQJDQ\ZKHUHKHJRHVDUHSUHFLVHO\WKHUHDVRQVZK\PDQ\)&7 7KLVSURWUDFWHGIHXGEHWZHHQWKHWZRLVDFODVVLFDOFDVHRIJRYHUQRU6LPLQDOD\L
UHVLGHQWVJUHHWHGKLVDSSRLQWPHQWZLWKRSWLPLVPDVWKHFDSLWDOFLW\\HDUQVIRUKLV )XEDUDELWWLQJWKH¿QJHUVWKDWIHGKLP,WLVDNQRZQIDFWWKDWWKHJRYHUQRUZDV
NLQGRITXDOLW\OHDGHUVKLSDQGDFKLHYHPHQWV XQGHUWKHWXWHODJHRI:LNHDOOKLVOLIHWLOOKHEHFDPHDJRYHUQRURI5LYHUVVWDWHRQ
WK0D\:KDWFDQEHVWURQJO\HVWDEOLVKHGLVWKDW)XEDUDLVDSROLWLFDO
,W ZDV QHDUO\ ¿YH GHFDGHV DIWHU LWV FUHDWLRQ WKH $EXMD ODQGVFDSH LV FOXPVLO\ FUHDWLRQ RI  1\HVRP :LNH ZKR PDGH KLP 3HUPDQHQW 6HFUHWDU\ $FFRXQWDQW
OLWWHUHG ZLWK DOO PDQQHU RI XQFRPSOHWHG SURMHFWV LQ ZKLFK VRPH DUH ZKLWH *HQHUDORI5LYHUV6WDWHDQGODWHUDQRLQWHGKLPDVKLVVXFFHVVRUDJDLQVWWKHZLVKHV
HOHSKDQWLQQDWXUH,QIDFWVRPHRIWKHSURMHFWVDSSHDUWREHMLQ[DVWKH\KDYH RIWKHVWDWHSDUW\H[HFXWLYHDOOZLWKLQDWZLQNOHRIDQH\H
RXWOLYHGVHYHUDODGPLQLVWUDWLRQVRIWKH)&7EXW\HWUHPDLQXQFRPSOHWHGGHVSLWH
WKH KXJH DPRXQW RI PRQH\ WKDW ZDV LQYHVWHG LQ WKHP ,PPHGLDWHO\ :LNH 'XULQJWKHJRYHUQRUVKLSFDPSDLJQVLQWKHVWDWHQRWPDQ\SHRSOHNQHZWKH
DVVXPHGR໥FHDVWKHPLQLVWHURI)&7KHGLGQ WZDVWHWLPHLQWDFNOLQJWKHVH PDQ 6LPLQDOD\L )XEDUD RWKHU WKDQ KH ZDV WKH PDQ *RYHUQRU 1\HVRP :LNH
JQDZLQJSUREOHPVKHDGORQJ7KHPLQLVWHUZLWKWKHVWURQJEDFNLQJRI3UHVLGHQW ZDQWHGWRVXFFHHGKLPDVDJRYHUQRURI5LYHUVLQ$VVXFK:LNHZDVDOORYHU
%ROD7LQXEXKDVHVWDEOLVKHGDQGGHPRQVWUDWHGDVWURQJZLOOWRDFKLHYHWKHGHVLUH WKHSODFHFDPSDLJQLQJIRUKLP,QDQXWVKHOOKHLQVWDOOHGKLPDVD3'3JRYHUQRU
JRDOVIRUWKH)&7LQDGGUHVVLQJLVVXHVRISURMHFWVWKDWDUHHLWKHUDEDQGRQHGRU RI 5LYHUV VWDWH DV KLV VXFFHVVRU LQ 0D\   GHVSLWH KLV RZQ GH¿DQW
ZLWKZRUNVRQJRLQJEXWDWVQDLOSDFH$PRQJWKHPDUHWKH0LOOHQQLXP7RZHUDQG UHODWLRQVKLS ZLWK WKH SDUW\ DW WKH QDWLRQDO OHYHO :KHQ RSSRVLWLRQ SDUWLHV
&XOWXUDOFHQWHUWKHSURMHFWZDVFRQFHSWXDOL]HGLQDQGDZDUGHGDWDFRVWRI FKDOOHQJHG)XEDUD VHOHFWLRQDWWKHHOHFWLRQWULEXQDO:LNHDJDLQVWHSSHGLQDQG
ZLWKSURMHFWHGFRPSOHWLRQLQ,WZDVSODQQHGWREHWR$EXMDZKDWRWKHU ZRUNHGLWRXWIRUKLPDVXVXDO0U:LNHKDVVKRZQVRPXFKORYHDQGWUXVWIRU
PDMRUPRQXPHQWVDFURVVWKHZRUOGVXFKDVWKH/RQGRQ%ULGJHWKH(L໤HO7RZHULQ )XEDUDMXVWOLNHKLVRZQSDWHUQDOVRQ%XWLPPHGLDWHO\)XEDUDDVVXPHGR໥FHRQ
3DULVDQGWKH6WDWXHRI/LEHUW\LQWKH8QLWHG6WDWHVDUHWRWKRVHFRXQWULHV7KH WK0D\KHZDVVRIDVWLQHQJDJLQJKLVJRGIDWKHULQDUDQFRURXVPDQQHU
SURMHFWKDVVLQFHEHHQDEDQGRQHGDWMXVWUDWHRIFRPSOHWLRQ %\ULGLQJWKHSROLWLFDOPDFKLQHU\RIKLVPDVWHUDQGURVHWRSRZHUZLWKRXWZRUNLQJ
IRULWPDNHVWKHJRYHUQRUQRWWREHJUDWHIXOWRWKRVHWKDWKHOSKLPXSWKHODGGHU
$GGLWLRQDOO\ WKURXJK YLEUDQF\ IRUHVLJKW DQG KDUG ZRUN WKH PLQLVWHU KDV )XEDUD VGHFLVLRQWRDQWDJRQL]HKLVJRGIDWKHUKDVDPRXQWWRDEOXQGHUWKDWZLOO
UHVXVFLWDWHGWKH1ELOOLRQ$EXMD&LW\&HQWUHSURMHFWVZKLFKZDVGHVLJQHGWR HQGKLVSROLWLFDODPELWLRQSUHPDWXUHO\
LQFOXGHIRXULQWHUQDWLRQDOKRWHOVUHVLGHQWLDOKRXVHVR໥FHVDQGVKRSVDVZHOODV
FRQGRPLQLXP,QDGGLWLRQWKHLQYHVWRUVZRXOGFRQVWUXFWD1DWLRQDO0DOODWWKH $WWKLVMXQFWXUHLWLVSHUWLQHQWWRHPSKDVL]HWKDWWKLVXQZDUUDQWHGIHXGEHWZHHQ
FRVWRIPLOOLRQDWQRFRVWWRWKH)&7$GPLQLVWUDWLRQ5HJUHWWDEO\WKHVWDWXVRI )XEDUDDQGKLVPHQWRUZLOOQRWFRQIHUDQ\DGYDQWDJHWRWKHJRYHUQRU+HIDLOHGWR
WKLVSURMHFWVWLOOUHPDLQVXQNQRZQWLOOGDWH\HDUVDIWHULWZDVDZDUGHG2WKHU UHDOL]HWKDWKHLVDSROLWLFDOQRYLFHZKRVHLQWULJXHVDQGJLPPLFNVDUHZLWKLQWKH
DEDQGRQHGSURMHFWVLQFOXGHVZRUOGWUDGHFHQWUHWKHHQGOHVV$SR.DUVKLURDG SDOPRIKLVJRGIDWKHU+HVKRXOGKDYHNQRZQWKDWKHLVMXVWOLNHDVRQDWWKHVLJKW
WKHFRQVWUXFWLRQRI.DUVKLGDP$SR:DVDURDGDQGWKHFRQVWUXFWLRQRIEHG RIKLVJRGIDWKHUDVORQJDV5LYHUVSROLWLFVLVFRQFHUQ
8WDNR*HQHUDO+RVSLWDODUHMXVWIHZDPRQJWKHSURMHFWVWKDWDUHDEDQGRQHGE\
VXFFHVVLYH DGPLQLVWUDWLRQV LQ D VSDQ RI PRUH WKDQ \HDUV 7KH PLQLVWHU V ,QYLHZRIWKLV,ZDQWWRUHPLQG)XEDUDWKDW:LNHLVDZDUULRUZKRKDVQHYHUORVW
IRUHVLJKWLQJRYHUQDQFHDQGGHPRQVWUDWLRQRILQQDWHFDSDFLW\IRULQQRYDWLYHLGHD DSROLWLFDOEDWWOHWKLVLPSOLHVWKDWWKHJRYHUQRUKDVVWDUWHGD¿JKWWKDWKHZLOO
LVTXLWHUHPDUNDEOHDQGRXWVWDQGLQJLQDGGUHVVLQJWKHVHLVVXHV QHYHUZLQ,QYLHZRIWKLV,FDQVD\ZLWKFRQ¿GHQFHWKDW)XEDUDKDVFRPPLWWHGD
SROLWLFDOVXLFLGH
'HVSLWHWKHUDSLGVXFFHVVUHFRUGHGWKHPLQLVWHULVQRWUHOHQWLQJLQKLVTXHVWWRULG
WKH)&7RIDEDQGRQHGSURMHFWVWKDWLVVFDWWHUHGDOORYHUWKHWHUULWRU\7KHUHFHQW *RYHUQRU)XEDUDKDYHXQGHUHVWLPDWHG:LNH VSROLWLFDOFDSDELOLW\WKHJRYHUQRU
GLUHFWLYHRIWKHPLQLVWHURQWKHFRPSOHWLRQRIWKH9LFH3UHVLGHQW VUHVLGHQFHDW$VR VKRXOGKDYHUHDOL]HGWKDW:LNHLVPRUHSRZHUIXOWKDQWKHZKROHRI5LYHUVSROLWLFDO
'ULYHWKDWZDVDEDQGRQHGIRURYHU\HDUVWKH2XWHU6RXWKHUQ([SUHVVZD\ ELJZLJVFRPELQHGLQFOXGLQJWKHJRYHUQRUKLPVHOIDQGWKDWLVZK\,OLNHQHGWKH
ZKLFKVWUHWFKHGIURP$$5DQRLQ$VRNRURWKURXJK'HHSHU/LIH-XQFWLRQ6$56 ¿JKWEHWZHHQWKHWZRRIWKHPDVD¿JKWEHWZHHQDQ³HOHSKDQWDQGDUDW´0U:LNH
$SRURXQGDERXWWR:DVD'LVWULFWDQGWKH2XWHU6RXWKHUQ([SUHVVZD\LQ-DKL KDYHVRPHPDJLFDOVWUHQJWKWKDWLVEH\RQGWKHSORWVRIKLVSROLWLFDOIRHV7KXV
'LVWULFWEHLQJFRQVWUXFWHGE\*LOPRU&RQVWUXFWLRQ¿UPDPRQJVRPDQ\RWKHUV :LNHLVDQXQGLVSXWDEOHSROLWLFDOHPSHURULQ5LYHUVDQGEH\RQG
:LNH VXQLTXHFDSDFLW\IRUSHUIRUPDQFHKDVQRZWXUQHGWKHFDSLWDOFLW\LQWRD
FHQWUHRIERRPLQJSURMHFWV *RY)XEDUDVKRXOGKDYHEHHQJUDWHIXOWR*RGIRUKDYLQJ:LNHDVKLVSROLWLFDOJRG
IDWKHUDQGQRWRWKHUZLVHWKHUHIRUHKHVKRXOGKDYHEHHQDOR\DOJRGVRQXQGHU
6XUSULVLQJO\ZLWKLQWKLVVKRUWSHULRGDV)&7PLQLVWHUDOODEDQGRQHGSURMHFWVKDYH DQ\FLUFXPVWDQFHV'HVSLWHEHHQDQH[HFXWLYHJRYHUQRURI5LYHUVVWDWH)XEDUD
EHHQ UHDFWLYDWHG ZLWK FRPSOHWLRQ GDWH DWWDFKHG WR HDFK SURMHFW :LWK WKHVH VKRXOGDOZD\VUHPLQGKLPVHOIWKDW:LNHSLFNHGKLPIURPWKHERWWRPRIWKHODGGHU
FRQVWUXFWLRQ DFWLYLWLHV WDNLQJ SODFH DOO RYHU )&7 WKH $EXMD UHVLGHQWV KDYH QXUWXUHGKLPDQGPDGHKLPZKDWKHLVWRGD\DQGWKDWVKRXOGKDYHZDUUDQWVKLP
ZLWQHVVHG DQ XQZDYHULQJ SXUVXLW RI JRRG JRYHUQDQFH DQG WKH IXO¿OOPHQW RI WREHJUDWHIXODQGSROLWLFDOO\OR\DOWR:LNHDWDOOWLPHVZLWKRXWDQ\KHVLWDWLRQ(YHQ
SHRSOHFHQWULF GHYHORSPHQW JRDOV WKDW OHG WR WKH PLUDFXORXV UHVXVFLWDWLRQ RI WKRXJKDVHHGRIGLVFRUGKDYHEHHQVRZQE\JRYHUQRU)XEDUDQRWZLWKVWDQGLQJLW
WKHVHDEDQGRQHGSURMHFWV:LNH VDFKLHYHPHQWRIWKLVIHDWLVQRWE\PDJLFEXWE\ LVQRWWRRODWHWRFRPHWRWHUPVZLWKUHDOLW\E\EHDWLQJDUHWUHDWDQGOHDQXSZLWK
D GLQW RI KDUG ZRUN DQG SHUVHYHUDQFH 7KH FRPELQDWLRQ RI KLV YLUWXHV RI KLVJRGIDWKHULQRUGHUWRDYRLGDQHQGWRWKHEHJLQQLQJRIKLVSROLWLFDOFDUHHU7KH
IRUWKULJKWQHVVDXGDFLW\DQGSUXGHQFHKDVVHUYHGDVDFDWDO\VWWRKLVQXPHURXV JRYHUQRU VKRXOG UHDOL]H WKDW GHPRFUDF\ LV D SURFHVV QRW D GHVWLQDWLRQ DQG
DFKLHYHPHQWVLQ)&7ZLWKLQWKLVWLPHWKHIHDWWKDWQRRQHKDVHYHUDFKLHYHGDVD WKHUHIRUHKHFDQ WGRZLWKRXWZLNHDVIDUDV5LYHUVSROLWLFVLVFRQFHUQ
PLQLVWHURI)&7VLQFHLWVLQFHSWLRQDVWKH)HGHUDO&DSLWDORI1LJHULD1RZRQGHU
:LNHZDVQLFNHGQDPH³0U3URMHFW´E\5LYHUVSHRSOHZKHQKHZDVWKHLUJRYHUQRU ,QFRQFOXVLRQLWLVZRUWK\IRUWKHJRYHUQRUWRQRWHWKDW:LNH VDFKLHYHPHQWLQWKH
SROLWLFDOFLUFOHKDYHRYHUVKDGRZHGDQ\SROLWLFDOZL]DUGDQGGHPRQVLQWKHZKROH
7KH PLQLVWHU V DFKLHYHPHQWV LQ WKH DUHD RI LQIUDVWUXFWXUDO GHYHORSPHQW KDYH RIVRXWKVRXWK:LNHKDVUHGH¿QHGWKHSROLWLFDOJRYHUQDQFHRI5LYHUVVWDWHDQG
EHHQH[WHQGHGWRDOOVHFWRUVRIWKH)&77KHUHFHQWFRQWUDFWDZDUGRI1ELOOLRQ OHIWLQGHOLEOHPDUNVWKDWFDQQHYHUEHDFKLHYHE\DQ\SROLWLFLDQIURPWKHVWDWHDQG
LQWKHHGXFDWLRQVHFWRUWKH0D\WKGHDGOLQHIRUWKHFRPSOHWLRQRI$EXMDOLJKW QRWHYHQWKHLQFXPEHQWJRYHUQRU)XEDUD7KXVSROLWLFDOKLVWRU\RI5LYHUVVWDWH
UDLOV\VWHPWKHGLVWULEXWLRQRIPHWULFWRQVRIULFHDVDSDOOLDWLYHPHDVXUHWR)&7 ZLOOQHYHUEHFRPSOHWHZLWKRXWPHQWLRQLQJ:LNH VQDPHDQGWKHUHIRUHKHZLOO
HPSOR\HHVDNLQGRIUDUHJHVWXUHWKDWKDVQHYHUEHHQVHHQLQWKHKLVWRU\RIWKH DOZD\VEHDSROLWLFDOJRGIDWKHULQ5LYHUVDVORQJDVKHOLYHV
)HGHUDO &DSLWDO DUH MXVW IHZ DPRQJ WKH QXPHURXV VXFFHVV UHFRUGHG E\ WKH
PLQLVWHU7KLVYLVLRQDU\IUDPHZRUNRI1\HVRP:LNHKDVGHWDLOHGDQDPELWLRXV
URDGPDSIRUIXUWKHUGHYHORSPHQWRIWKH)&7WKDWZLOO UHPDLQLQGHOLEOHLQWKH 6LJQHG,EUDKLP0XVWDSKD
KLVWRU\RIWKH)HGHUDOFDSLWDO7KXV:LNHLVQRWRQO\DPLQLVWHURI)&7EXWD LPXVW\EDED#JPDLOFRP
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 25

              


            
         
           
       ! " #   $    %&  
'  '(    )  *$ +   '   ,-   %.  
  #            !  
    "  !"         
       #

          $       $        
        %  $    $    $&'
 $&'(  ) $ *        
  +  +        
                           
 #

        $      
          
      #/$  
 $      +    $
+&0   $       $ &    
  1(

,    -  $$   $  $   $  


                 
    $ *       . # ### (  
              -  
   / ##    % #


   
26 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024

I, formerly known as MARYAM I formerly known and addressed as AISHA: I formerly known as MARIAM: This is to noti¿ed the I formerly known as MARIAM I formerly known as
IBRAHIM, now wish to be known and AMINU MUHAMMAD now wish to be called AISHA HASSAN now wish to be known general public that my name was wrongly MIRIAM ADEBD, I now wish to be TAHIRU GONI USMAN now wish
and addressed as AMINU MUHAMMAD and addressed as AISHA HASSAN capture as. IBRAHIM MIRIAM. Instead of
addressed as MARYAM IBRAHIM MAIGARI. With D.O.B 06/03/1993 not IBRAHIM MARIAM. Now wish to be known addressed and known as MARIAMO to be known and addressed as
ADAMU. All former documents 18/08/1989 All former documents remain
MUHAMMAD. All former documents and addressed as. IBRAHIM MARIAM. All ADEBO. All former documents remain TAHIR GONI USMAN All former
remain valid. General public should valid. AUTHORITY CONCERNED and the remain valid. Authorities concerned and former documents remain valid. Authority valid. ARM Pension and the general documents remain valid General
please take note. general public should please take note. general public should take note concerned and general public to take note. public should please take note. public should please take note

I, formerly known as I formerly known as HADIZA KABIR: I formerly known as OSERE: This is to noti¿ed the I formerly known and addressed ABBAS, I formerly known
ILOEKWUMA PASCHAL, now wish to be UMAR AHMAD now wish to be known KABIRU YAKUBU now wish to be general public that my name was wrongly as ABU KUBURAT OSHIONE now as ABBAS ALASSAN now wish to
known and addressed as ILOEKWUMMA capture as. OSERE AISHAT. Instead of be called and addressed as ABBAS
and addressed as HADIZA UMAR known and addressed as KABIR wish to be known and addressed
TOCHUKWU PASCHAL. All former OSERE AISHETU. Now wish to be known
and my date of birth is 20/03/1995. YAKUBU. All former documents and addressed as OSERE AISHETU. All as KUBURAT A. OSHIOMAH. All ALHASSAN. All former documents
documents remain valid. General public remain valid. Authorities concerned and
All former documents remain valid. remain valid. Authorities concerned former documents remain valid. Authority former documents remain valid.
should please take note.
General public should please take note and general public should take note concerned and general public to take note. General public to take note. general public should please take note.

I formally known as IFEOBU I formerly known as RETYON ZAINAB: I formerly known as I formerly known and addressed I formerly known and ABUBAKAR, I formerly known as
IKENNA OBIANOZIE now wish to be ZAINAB ABUBAKAR now wish to be as UCHENNA UMEH now wish to be ABUBAKAR IBRAHIM MUHAMMAD
DAVID NA’ANDEM, now wish to be addressed as MAIRAMU ADAMU
called and addressed as IFEOBU BRIAN known and addressed as ZAINAB TASI’U now wish to be called and addressed
known and addressed as DIELTING ABUBAKAR with correct DOB;30/11/1989 called and addressed as UCHENNA now wish to be known and addressed
IKENNA OBIANOZIE NKEMAKONAM. UMEHOKECHUKWU CHRISTAN. All as ABUBAKAR MUH’D IBRAHIM.
All former documents to remain valid. DAVID RETYON. All former not 01/01/1987. All former documents as MARYAM ADAMU BAMANGA. All former documents remain valid.
documents remain valid. General remain valid. Authorities concerned and former documents remain valid. Access All former documents remain valid.
General public and authorities concerned general public should take note Authorities concerned and general public
should please take note. public should please take note bank and general public to take note. General public to take note. should please take note.

I, formerly known as OLOYEDE I formerly known as YUSUF KATHERINE: I formerly known OMO: I formerly known and I, formally known as and FATIMA, I formerly known as
FRANCIS ERIAYOMI, now wish to AMINAT YETUNDE, now wish to be as PATRICK HELEN now wish to be addressed as. OMO ABRAHAM. called IKEKPEAZU, CHIOMA FATSIMA SANI now wish to be called
be known and addressed as OLOYEDE known and addressed as NURUDEEN known and addressed as KATHERINE Now wish to be known and addressed VIVIAN, now wish to be known as and addressed as FATIMA SANI.
ERIAYOMI FRANCIS. All former AMINAT YETUNDE. All former HELLEN AGIDI. All former documents as. OMO IGE. All former documents EKEMEZIE, CHIOMA VIVIAN. All All former documents remain valid.
documents remain valid. General documents remain valid. General remain valid. Authorities concerned remain valid. Authority concerned former documents remain relevant. Authorities concerned and general
public should please take note. public should please take note and general public should take note and general public to take note. NSITF, general public to take note. public should please take note.

CORRECTION OF NAME I, I formerly known as TANSOHOT NENDIRMWA: I formerly FAVOUR: I formerly known and I formally known as YA’U I, formerly known as OGENYI JOHN
formerly known as BELLO GANIYU NANCHIN TIMOTHY, now wish to known as JOHNTILAS NENDIRMWA addressed as. PIUS FAVOUR. Now wish ADAMU/ADAMU YA’U now wish OGBONUA and JOHN OGENYI OGENYI,
ABDUL, now wish to be known and CORDELIA, now wish to be known to be known and addressed as. CHIME now wish to be known and addressed
be known and addressed as BUTRIM to be called and address as ABBA as OGENYI JOHN,All former documents
addressed as BELLO ABDULGANIYU. as JOHN NENDIRMWA CORDELIA. CHIOMA FAVOUR. All former documents
NANCHIN NANLIR. All former ZAKARIYAU ADAMU. All former remain valid.and my correct D.O.B is
All former documents remain valid. All former documents remain valid. remain valid. Authority concerned and
documents remain valid. General Authorities concerned and the general general public to take note. document remain valid, authorities 25/01/1955. Authorities concerned and
General public should please take note. public should please take note and general public should take note general public should take note.
public should take note

I, formerly known as YAHAYA ADAMU: I formerly known AUTA: I formerly known and I formerly known and I was formally known as I formerly known as Rabi
and addressed as MUSA AISHATU addressed as AUTA IMANCHE JOSEPH
INUSA, now wish to be known and addressed as KUME LINDA YUSUF AHMED, now wish to be Usman now wish to be called and
MUHAMMAD but now wish to be called but now wish to be called and addressed
addressed as YAHAYA NAZIFI. and addressed as ADAMU AISHATU HEMBADOON now bears IJIR called as ABDULRAZAK AHMED addressed as Rabi’atu Usman saleh
as AUTA IMANCHE ELIJAH. All former
All former documents remain valid; MUHAMMAD. All former documents remain documents remain valid. The general LINDA HEMBADOON. Former SHALL. All former documents all former Documents remain valid
Banks and. General public should valid. The general public and any authority documents remain valid. Concerned remain valid. General Public should authorities concern and general
public and any authority concerned
concerned should take note, please
please take note. should take note, please. Authorities to take note, please. take note. public should take to note

I, formerly known as ZAIYOH NAME RECONCILIATION: This is to HADIZA: I formerly known and I, formerly known and addressed SANI: I, formerly known as UMAR SALIM, I formerly known as
TERKULA GOEFFREY, now wish to be con¿rm that HAMZA ADAMU ABDULLAHI addressed as KHADIJAT USMAN but as MARYAM ABDULKAREEM now UMAR FARUK now wish to be known and SALIM IBRAHIM TUKUR now wish
is one and the same person. That henceforth now wish to be called and addressed as wish to be known and addressed addressed as UMAR SANI FARUK and
known and addressed as GOEFFREY to be called and addressed as SALIM
I wish to be known and addressed as HAMZA HADIZA USMAN. All former documents my correct date of birth is 12/12/1994
AHUA ZAIYOL. All former documents ABDULLAHI ADAMU. AND D.O.B. as MARYAM ABDULKAREEM IBRAHIM . All former documents
remain valid, Banks, NIMC and. remain valid. The general public and any SHARAFADEEN. All former documents not 12/02/1990 and 12/02/1989. All
07/10/1983 All former documents remain remain valid. Authorities concerned and
authority concerned should take note, remain valid. General public to take note. former documents remain valid. General
General public should please take note. valid, general public should take note. general public should please take note.
please public should please take note

I, formerly known as MISS I formerly known as MISS OLA ISHAYA: I formally known and I, formerly known and CORRECTION OF NAME: ABUBAKAR, I formerly known
NGUJI FAVOUR OGECHUKWU, now OLAWUMI ALABA ELIZABETH, now addressed as SALISU ISHAYA now wish addressed as WAYA LAUKASA That my Name was wrongly captured as ABUBAKAR YUSUF now wish to be
wish to be known and addressed as MRS wish to be known and addressed as MRS to be called and addressed as ISHAYA called and addressed as ABUBAKAR
DAJO now wish to be known and as ALIH SEKINAT HAPPINESS
UYANWA FAVOUR OGECHUKWU. GBENGA-IDOWU OLAWUMI ALABA. DANFULANI SALISU. All former YUSUF SALISU. All former documents
All former documents remain valid. documents remain valid, the authority addressed as FILA DAJO All former Instead of ALI SEKINAT. All former
All former documents remain valid. remain valid. Authorities concerned and
General public should please take note. concern and the general public should documents remain valid. General documents remain valid general
General public should please take note. general public should please take note.
please take note. public to take note. public take note

I, formerly known as Miss ISAH: I formerly known as I formerly known and I, formerly known and addressed as I formally known as ZAINAB AHMAD, I formerly known as
IBRAHIM FATIMA ZAHRA, now GADO USUMAN, now wish to addressed as HYACINTH JOHN MAL. UMAR UMARU HAMMAADAMA AHMAD GORONYO now wish to be ATTAHIRU HARUNA now wish to
wish to be known and addressed as now wish to be known and addressed known and addressed as ZAINAB be called and addressed as AHMAD
be known and addressed as ISAH AGU now wish to be known and
Mrs IBRAHIM FATIMA ARAWOLE. as UMAR HAMMAADAMA D.O.B AHMAD SULEIMAN. General Public ADAMU AHMAD. All former documents
USMAN. All former documents addressed as UBA HYACINTH. 20/11/1988 NOT 10/11/1987. All
All former documents remain valid. and Authority Concerned should take remain valid. Authorities concerned and
remain valid. General public should All former documents remain valid. former documents remain valid. General note. All former Documents remain Valid
General public should please take note. general public should please take note.
please take note. General public to take note. public to take note.

I formally known as HUSSAINI I formerly known as RUTH I formerly known and IBRAHIM : I formerly known as MULIKAT: I formerly known ABDUL, I formerly known as
TELA. I now wish to be known and JAMES, now wish to be known addressed as ALHAJI ABDULLAHI ISAH IBRAHIM JALO now wish to be as YAKUBU MULIKAT, now ABDULMUHAIMINU ADO now wish
addressed as MUHAMMAD TELA All HASSAN now wish to be known and known and addressed as IBRAHIM to be called and addressed as ABDUL
and addressed as MARYAM wish to be known and addressed
ESSE ISA DOB 1-4-1980 not 28-2- USMAN ADO. All former documents
my documents remain Valid. Authority MOHAMMED M. All former addressed as ALHAJI ABDULLAHI as MULIKAT RAJI. All former
1980. All former documents remain valid, remain valid. Authorities concerned and
concerned and general public should documents remain valid. General SARKI. All former documents remain authority concerned and the general documents remain valid. General
take note. valid. General public to take note. general public should please take note.
public should please take note. public to please take note. public should please take note.

I formerly known as ROSE: I formerly known as I formerly known and addressed I formerly known and addressed ZAINAB: I, formally known as AMINA, I formerly known
OZOANIAGOLU LETICIA UJUNWA ROSEMARY ILIYA, now wish to as GARBA MUHAMMED HAMIDU as MILKA AKAWU MICHEAL now ZAINAB MOHAMMED, now wish to be as AMINA ALHAJI now wish to
now wish to be known and addressed now wish to be known and addressed wish to be known and addressed called and address as ZAINAB USMAN be called and addressed as AMINA
be known and addressed as ROSE
as ANIBUEZE LETICIA UJUNWA. all MOHAMMED. All former documents ABDULLAHI. All former documents
DAVID. All former documents as MUHAMMED UBA GARBA. as MILCAH AKAWU MICHEAL.
my documents remain valid authority remain valid. General public and remain valid. Authorities concerned and
concerned and general public should take remain valid. General public should All former documents remain valid. All former documents remain valid. authorities concerned should take note
General public to take note. General public to take note. general public should please take note.
note please take note accordingly.

I, formerly known as AHMAD MOHAMMED: I formerly AWEN: I formerly known and I formerly known and addressed CONFIRMATION OF NAME: This is I formerly known as
known as MUHAMMAD ILIYASU addressed as. ELAKAMAH AWEN. Now to inform the general public that KHADEEJAT
A AHMAD. Now wish to be known as ADAMU ADAMU MOHAMMED RABI’U and KHADEEJAT RABI’U YUSUF is
ABUBAKAR ZODE now wish to be
ABDULLAHI, now wish to be known wish to be known and addressed as. now wish to be known and addressed known and addressed as MOHAMMED
and addressed as AHMAD AHMAD one and same person, now wish to be known
and addressed as MOHAMMED ILIYA. ABDULKAREEM ALIDU AWEN. All
AHMAD. All my documents remain former documents remain valid. Authority as ADAMU MOHAMMED 11. All and addressed as KHADEEJAT RABI’U ABUBAKAR KWAZEGHE All former
All former documents remain valid. YUSUF. All documents remain valid. Authorities
Valid. Authority concerned and concerned and general public to take former documents remain valid. documents remain valid General
General public should please take note. concerned and the general public to take note.
general public should take note. note. General public to take note. public should please take note

I, formerly known as VIVIEN HADIZA: I, formerly known AISHAT: I formerly known and I formerly known and addressed .ALIYU:I formerly known as I formerly know as ALI
OBIAGELI AZUMAH, now wish to as HADIZA ABUBAKAR now addressed as. IBRAHIM AISHAT. Now as MOHAMMED DANLADI now HAUWAU ALIYU ALIYU now wish to USMAN MAINA now wish to
wish to be known and addressed as. wish to be known and addressed as be known and addressed as HAUWAU
be known and addressed as VIVIEN wish to be known and addressed be known and addressed as ALI
MUHAMMAD IBRAHIM AISHAT. All MISAU ALIYU. All former documents
OBIAGELI CHIGBU. All former as HADIZA HASSAN. All former former documents remain valid. Authority MUHAMMAD DANLADI. All former remain valid.Authorities concerned and USMAN MANNA All former
documents remain valid. General documents remain valid. General concerned and general public to take documents remain valid. General the general public should please take documents remain valid General
public should please take note. public should please take note. note. public to take note. note. public should please take note

I formerly known as MISS CHUKWUJEKWU: I, formerly known PETER: This is to noti¿ed the general I, formally known and addressed JAMES:I formerly known as I, formerly known as IBRAHIM
EUCHARIA KISMET IBEBUNJO as EMEKACHUKWUJEKWU OKOYE public that. IREDIA PETER (JNR), PETER as GLORIA AYEGBA UNEKWU now LIKITA DOCTOR JAMES now wish ISHAK to be known and addressed
now wish to be known and addressed now wish to be known and addressed as ADOLOR IREDIA. Belong to me and wish to be called and addressed as to be known and addressed as LIKITA as IBRAHIM ISHAQ NAFIU all
as Dr.(MRS) CHIGOZIE EUCHARIA CHUKWUJEKWU OKOYE and my correct same person. Now wish to be known and GLORIA AYEGBA ODOH. All former
date of birth is 01/01/1985. All former addressed as. PETER ADOLOR IREDIA. JAMES. All former documents remain former documents remain valid,
EDEM. All former documents remain documents remains valid. General public valid.Authorities concerned and the
documents remain valid. General public All former documents remain valid. Authority General public and the authority
valid. General public should please take and authorities concerned should please
should please take note concerned and general public to take note. general public should please take note. concerned should take note
note take note.

I, formerly known as I formerly known as FOLAKE ZAINAB: I formerly known and I formerly known and addressed ABUBAKAR:I formerly known as I, formerly known as
LIAZARUS WUNANG, now wish FLORENCE IBIMONI, now wish to addressed as. ZEINAB CHARLES. as JOSEPH OKON IMAOBONG HAMZA. ABUBAKAR. BAKO now wish MUHAMMADU MUSA wish to be
be known and addressed as AWOLOLA Now wish to be known and addressed ROSEMARY now wish to be known to be known and addressed as HAMZA. known and addressed as MUHAMMAD
to be known and addressed as
FLORENCE FOLAKE. All former as. ABDULLAHI ZAINAB. All former and addressed as JOSEPH IMAOBONG ABUBAKAR. All former documents ABDULKARIM former documents
SYLVESTER LAZARUS. All former documents remain valid. Authority ITOHOWO OKPON. All former remain valid.Authorities concerned and
documents remain valid. General public remain valid, General public and the
documents remain valid. General concerned and general public to take documents remain valid. General public the general public should please take
should please take note. authority concerned should take note
public should please take note. note. to take note. note.

I, formerly known and addressed I formerly known as USMAN JOSEPH: I formerly known SANI: I formerly known as SANI MRS SALIMA , I formerly known I, formerly known as KAMALA
as ABUBAKAR ZAKARIYYA now wish to NDAH, now wish to be known and and addressed as. JOSEPH OROSHI LAWAL now wish to be known and as SALIMA MUHAMMAD ZAIYAN ABDURRASHID wish to be known and
be known and addressed as ABUBAKAR CATHERINE. Now wish to be known addressed as SANI LAWAL FUNTUA now wish to be called and addressed as addressed as KAMALA ABDURRASHID
addressed as ODOMA USMAN
ZAKARIYYA MUHAMMAD. All former and addressed as. OGHAIMEH OROSHI . All former documents remain valid. MRS SALIMA MUHAMMAD ZAIYAN. ABDULLAHI former documents remain
documents remain valid. General public NDAH. All former documents CATHERINE. All former documents All former documents remain valid. valid, General public and the authority
Authority concerned and general public
should take note. remain valid. General public should remain valid. Authority concerned and Authorities concerned and general public concerned should take note
should please take note.
please take note general public to take note. should please take note.
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 27
Classifieds made easy PUBLIC NOTICE Page 2
I, formerly known as ZAINAB . I formally know SAIDU I formerly known as SANI AISHATU: I formerly known as BIYAYA: I Formerly known as OLATUNBOSUN: I, formerly known
KASIM wish to be known and JABIR, now wish to be known and SULAIMAN now wish to be known AISHATU MUSA TURAKI, now wish LIDIYA SHEHU Now wish to be called and addressed as Miss ADEOSHUN
to be called and addressed as AISHATU and addressed as BIYAYA SHEHU D.O.B OPEYEMI TITILOPE , now wish
addressed as MRS ZAINAB addressed as SAIDU KISHIMI. as SANI A SULAIMAN All former to be known and addressed as Mrs
MUHAMMAD AHMAD. All former is From 10/10/1975 To 10/10/1980
IBRAHIM former documents remain All former documents remain valid, documents remain valid Authority OLATUNBOSUN OPEYEMI TITILOPE.
documents remain valid. The Authority All Former documents remain valid Any
valid, General public and the authority Authorities concerned and general concerned and general public should concern and the general public should Authority concern and the General public All former documents remain valid. Authority
concerned should take note concerned and General public take note.
public should please take note. please take note please take note. to please take note

: I, formerly known as MUFIDA UMAR, I formerly known as I formerly known as HAMZA I formerly known as JAMILU ISMAIL: I, formerly known OMOTOSHO: My name was
AHMAD wish to be known and UMAR BARDE IDRIS now wish to SARKI now wish to be called MOHD SHAFTA now wish to be called as ISMAIL HASSAN KASKA, now wrongly written on my Nigerian passport
be called and addressed as UMAR and addressed as JAMILU MUHAMMAD wish to be known and called ISMAIL as OMOTOSHO MOTUNRAYO
addressed as MRS MUFIDA IDRIS as HAMZA MAGAJI All former
IDRIS CHIRA. All former documents SHAFTA All former documents remain HASSAN.All former documents remain VIVIAN. My correct name is
former documents remain valid, documents remain valid authority valid Authority concerned and the general OMOTOSHO VIVIAN MOTUNRAYO.
remain valid. Authorities concerned and valid.The general public and any
General public and the authority concerned and general public take public should please take note. All former documents remain valid. Nigeria
general public should please take note. authority concerned to please take note
concerned should take note note Immigration Service should take note.

I was formerly known as ABDULJABBAR, I formerly known I formerly known as HABU I formerly known as Amina ABDULLAHI: I, formerly known ADEWALE : I, formerly known and
as ABDULJABBAR ABDULJABBARU Ibrahim Saad now wish to be known as ABDULLAHI SANUSI SALISU, now addressed as ADEWALE JULIE OLUSEUN,
HAUWA OZISULE now wish to be MUHAMMAD now wish to be called now wish to be known and addressed as
now wish to be called and addressed as and called as Mrs. Amina S Ibrahim. wish to be known and called ABDULLAHI
called and addressed as HAUWA as ABUBAKAR MUHAMMAD ADEWALE JULIE-ABOSEDE OLUSEUN due
ABDULJABBAR ADAMU. All former SANUSI.All former documents remain
ALI SULE. All former documents All former documents remain valid All my former documents remain valid. to of¿cial purposes. All documents bearing my
documents remain valid. Authorities valid.The general public and any authority
remain valid Authorities concern concerned and general public should authority concerned and general Authorities concerned and general concerned to please take note.
former name remain valid. General public and
public should please take note Authorities concerned should please take note.
and general public to note please take note. public take note

UMAR:I Formerly known as IBRAHIM, I formerly known as I formerly known as AHMAD I formerly known as Rufaida MUHAMMAD: I, formerly known I, FORMERLY KNOWN AND
MOH D UMAR and MOH D IBRAHIM ABDULMUMIN IBRAHIM now wish to SULAIMAN now wish to be called and Abdullahi Sule now wish to be known as MOHD SELIM, now wish to be ADDRESSED AS MISS ADEGALU
UMAR NOW wish to be known and be called and addressed as IBRAHIM OMOLAYOMI MOROHUNKEJI. NOW WISH
addressed as AHMAD SULAIMAN and called as Rufaida Shehu Abdulkadir. known and addressed MUHAMMAD
TO BE KNOWN AND ADDRESSED AS MRS.
addressed as MOHAMMED UMAR DOB ABDULMUMIN HUSSAIN. All former ADO All former documents remain All my former documents remain valid. SALIM IBRAHIM.All former documents ROSIJI OMOLAYOMI MOROHUNKEJI.
12/12/2002 NOT 21/08/1992 All documents remain valid. Authorities Authorities concerned and general remain valid.The general public and any
valid. Authorities concerned and FORMER DOCUMENTS REMAIN VALID.
former documents remain valid General concerned and general public should public should please take note authority concerned to please take note GENERAL PUBLIC SHOULD TAKE NOTE.
public should please take note please take note. general public should please take note

I was formerly known as Nazi¿ SHARHAKILU I was formerly known I formerly known as ASIYA I formally known as RASILA DICKSON: I formerly known as I formerly known and addressed as
Mustapha now wish to be called and called SHARKILU MUHAMMAD SABI’U NAFADA now wish to be BABA now wish to be known as DICKSON AISEOSA OGIEMUDIA Mrs ATINUKE OMOTOLA AKINTOLA.
IBRAHIM now wish to be called and now wish to be called and addressed Now wish to be known and addressed
and addressed as Nazi¿ Mustapha addressed as SHARHAKILU MUHAMMAD called as ASIYA SABI’U IMRANA RISLAN MUSA BABA All former
as DICKSON AISOSA OGIEMIDIA as Mrs OLALEYE ATINUKE AISHAT
Balarabe . All former documents SHUAIBU. All former documents remain All former documents remain valid documents remain valid Authority LUCKY all former documents remain OMOTOLA. All former documents remain
remain valid Authorities concern valid.Authorities concerned and general authority concerned and general concern and general public take valid. Any authority concern and general valid. General public take note
public should please take note
and general public to note public take note note. public should please take note.

I was formerly known as COMFORT I was formerly known AUWALU, I formerly known ZAINAB: I, formerly known as USAINA: I, formerly known as That I was formerly known
ISMAILA YAHAYA now wish to be and called COMFORT E SOLOMON as AUWALU BABA now wish to be Zainab Sulaiman, now wish to be HUSSAINA GARBA, now wish to called and addressed as MISS JAMES
called and addressed as SAMAILA now wish to be called and addressed called and addressed as AUWALU known and addressed as ZAINAB be known and addressed as USAINA KEHINDE BOSE now wish to be known
as COMFORT ELISHA SOLOMON. BABA KANO. All former documents SANUSI.All former documents remain GARBA ILIYASU.All former documents called and addressed as MRS ADEJOJO
ALIYU YAHAYA. All former All former documents remain valid. KEHINDE BOSE. All former documents
remain valid. Authorities concerned and valid.The general public and any remain valid.The general public and any
documents remain valid Authorities Authorities concerned and general public remain valid. Authority concerned and
general public should please take note. authority concerned to please take note authority concerned to please take note
concern and general public to note should please take note General public take note.

I was formerly known as ABDALLAH I was formerly known I formerly known as GARZALI ISAAC: I Formerly known as BAKSON NAZIRU: I, formerly known as I, formerly known and addressed as
and called ABDALLAH ADAMU now MAJINDADI ISAAC Now wish to be called and ADELEKAN MOJISOLA OMOLABAKE
NAZIRU YAHAYA HASKE now ISA now wish to be called and MALLAM NAFIU, now wish to be
wish to be called and addressed as addressed as ISAAC MAJINDADI BAKSON. now wish to be known and addressed as
wish to be called and addressed as addressed as GAZALI MUHAMMAD First Name. ISAAC Middle Name. MAJINDADI known and called NAZIRU SALISU.
ABDALLAH NANA ADAMU. All former ISAH All former documents remain OLADIMEJI MOJISOLA OMOLABAKE.
SULAIMAN YAHAYA. All former documents remain valid.Authorities
Surname. BAKSON All Former documents remain All former documents remain valid. former documents remain valid. ogun-
documents remain valid Authorities valid. Authorities concerned and valid UBA BANK Plc Any Authority concern and
The general public and any authority
concerned and general public should the General public to please take note state Tescom authority concern and
concern and general public to note please take note general public should please take note concerned to please take note general public please take note

I formerly known as Asmau : ISA, I formally known as I formerly known as ALIYU DAVID: I, formerly known as SULEIMAN: I FORMALLY I formerly known and addressed as
Muhammad Hadi now wish to be IBRAHIM SALIHU now wish to GWADABE KAWU now wish to DAVID ENOCH, now wish to be known KNOWN AND CALLED SULEIMAN Miss AINA VICTORIA OLUWABUSAYO
be called and addressed as ALI and addressed as DAVID ENOCH RUKAIYA RUKAIYA NOW WISH TO .Now wish to be known and addressed
known and addressed as Asmau be known addressed as, IBRAHIM as Mrs AKINTUNDE VICTORIA
GWADABE All former documents JONATHAN.All former documents BE KNOWN AND CALLED SULEIMAN
Mohammed Hadi. All former ISMAIL NZHIMANI All former ELEOJO RUKAIYAT. ALL FORMER OLUWABUSAYO. All former documents
remain valid. Authorities concerned and remain valid. The general public and any
documents remain valid. Authority documents remain valid general authority concerned to please take note. DOCUMENTS REMAIN VALID. THE remain valid. Authority concerned and
general public should please take note
concern to please take note public should please take note. GENERAL PUBLIC TO NOTE General public take note.

I was formerly known as I formally known as I formerly known as SARATU DAUDA: I, formerly known ADEYEMI: I, formerly known and That i was formerly known called
MOHAMMED SALISU ADAMU now as DAUDA ABDULKARIMU, now addressed as ABDUL FATAI SEKINAT, and addressed MISS BABALOLA
MOHAMMED IDRIS MAZILA, MIKAIL ISAH now wish to be called
wish to be called and addressed as MOHAMMED SEKINAT AJOKE, AJAYI KUNMI ADUKE now wish to be known
now wish to be known addressed as, and addressed as SARATU MIKAIL wish to be known and called DAUDA SEKINAT , now wish to be known and addressed
MUHAMMAD SALISU ADAMU. ABDULKARIM.All former documents called and addressed as MRS JOLAOSO
MUHAMMADU IDRIS All former All former documents remain valid. as ADEYEMI SEKINAT TITILAYO. All
All former documents remain valid remain valid.The general public and any KUNMI ADUKE. All former documents
Authorities concern and general public documents remain valid general Authorities concerned and general former documents remain valid. Authority
remain valid. Authority concerned and
public should please take note authority concerned to please take note concerned and General public take note.
to note public should please take note. General public take note.

I was formerly known as AKIY I formally known as IBRAHIM I formerly known as AUDU FATIMA: Formerly known DALHAT : I formerly known and ADDITION OF NAME IDOWU:
MAIJIDDA ABUBAKAR now wish to SALIHU now wish to be known HABIBA / HABIBA AUDU now wish as FATIMA ALIYU now wish to addressed as ADOMUSA NAZIFAT I, formerly known and addressed as
be called and addressed as ABUBAKAR to be called and addressed as HABIBA DALHAT now wish to be known and IDOWU ESTHER , now wish to be known
addressed as, IBRAHIM ISMAIL be addressed as FATIMA ALIYU
MAIJIDDA ALIYU. All former AUDU ADAMU All former documents addressed as DALHAT NAZIFAT and addressed as IDOWU ESTHER
NZHIMANI All former documents SABON BIRNI. All former ABOLAJI. All former documents remain
documents remain valid Authorities remain valid. Authorities concerned and MUSA. All former documents remain
remain valid general public should documents remain valid. General valid. General public to please take note. valid. Authority concerned and General
concern and general public to note general public should please take note
please take note. public take note public take note.

I was formerly known as SAMSON : I formerly known and I formerly known as HALIMA NUSAIBA: I was formally known I, formerly known and addressed OLATUNDE: I, formerly known and
KABIR IMAM ISAH now wish called ISHAYA PEACE YUSUF now wish ABDULHAMID 1/1/1980 now wish as MISS SUNAIBA MUHAMMAD,now as ISMAILA SAADAT OMENEKE. addressed as OBI GOODNESS NKECHI
to be known and addressed as JONAH to be called and addressed as SADIYA wish to be known as MRS NUSAIBA Now wish to be known and addressed and ISAIAH GOODNESS NKECHI , now
to be called and addressed as wish to be known and addressed as Mrs
PEACE SAMSON. All former documents ABDULLAHI 1/1/1978 All former MUHAMMAD. All former documents
KABIRU KASIM IMAM . All former as ISMAILA SAADAT EYIOZI. OLATUNDE GOODNESS NKECHI. All
remain valid. Concerned authorities and documents remain valid. Authorities remain valid.General public and
documents remain valid Authorities the general public to please take note. concerned and general public should authorities concerned should take note
All former documents remain valid, former documents remain valid. Authority
concern and general public to note please take note please. General public kindly take note. concerned and General public take note.

ISHAYA:I Formerly known as HARUNA : I formerly known BAYU:I Formerly known as MUBARAK: I formerly known as ALOWOSUNA: I, formerly known I FORMERLY KNOWN AND
and called SANI ABBA now wish to SANI RAMATU USMAN now wish to as ABDULKAREEM OMOWUNMI ADDRESSED AS SALAMI AMINAT ARIKE.
PHILIBUS SANITA Now wish to be ABDULLAHI MALAM UMARU Now NOW WISH TO BE KNOWN AND ADDRESSED
known and addressed as PHILICUS be known and addressed as HARUNA wish to be known and addressed as be called and addressed as MUBARAK AISHAT, now wish to be known and
AS TIAMIYU AMINAT FOLASADE. ALL
MUHAMMAD SANI. All former RAMATU all former documents remain addressed as ALOWOSUNA OMOWUNMI
SANITA ISHAYA All former documents remain valid. Concerned MOHAMMED BAYU All former AISHAT. All former documents remain
FORMER DOCUMENTS REMAIN VALID.
documents remain valid General documents remain valid General valid. Any authority concern and CONCERN AUTHORITY AND GENERAL
authorities and the general public to valid. NYSC, Banks and general public
public should please take note public should please take note general public should please take note. PUBLIC SHOULD TAKE NOTE.
please take note. take note.

ZAKARIYYA I was formerly known MOHAMMED, I formerly known I formally know IBRAHIM ZAINAB: I formerly known CONFIRMATION OF NAME I, CHRISTOPHER: I, formerly known
and called ZAKARIYYA MUHAMMAD as SABO MUHAMMED now wish to be USMAN, now wish to be known and as ZAINAB ISAH now wish to be JOHN ALUKO GBENGA, JOHN and addressed as BAMBE OYINDAMOLA
USMAN now wish to be called and called and addressed as MOHAMMED addressed as IBRAHIM USMAN called and addressed as ZAINAB ALUKO and ALUKO JOHN refers to CHIOMA , now wish to be known
addressed as ZAKARIYYA MUHAMMAD one and same person, now wish to be and addressed as CHRISTOPHER
SABO. All former documents remain YUSUF. All former documents remain ABDULLAHI all former documents
YAKASAI. All former documents remain addressed as ALUKO JOHN. All former OYINDAMOLA CHIOMA. All former
valid. Authorities concerned and general valid, Authorities concerned and remain valid. Any authority concern and documents remain valid. Authority
valid.Authorities concerned and general public should please take note. documents remain valid. Banks and
general public should please take note. general public should please take note. concerned and General public take note.
public should please take note general public take note.

ADAMU : I formerly known and I was formerly known as I formally know BUKHARI MUSTAPHA: I, formerly known CORRECTION OF NAME My AROWOSEGBE: I, formerly
called ADAMU HAMISU now wish ABUBAKAR, now wish to be known and as MUSTAPHA AMRA ISA, now wish name was wrongly written as AFOLABI known and addressed as ADEGBITE
Suwaiba Aliyu now wish to be called ADEDOYINSOLA MORENIKEJI , now wish
to be known and addressed as ADAM addressed as BUHARI ABUBAKAR to be known and called MUSTAPHA MODUPE MARY instead of FASIKU
and addressed as Suwaiba Hussaini. to be known and addressed as AROWOSEGBE
HAMISU ADAMU. All former documents RABO. All former documents remain AMRAH ISAH.All former documents MODUPE MARY, now wish to be
remain valid. Concerned authorities and
All former documents remain valid addressed as FASIKU MODUPE MARY.
ADEDOYINSOLA MORENIKEJI. All former
valid, Authorities concerned and remain valid.The general public and any documents remain valid. Authority concerned
the general public to please take note. Authorities concern and general All former documents remain valid.
general public should please take note. authority concerned to please take note and General public take note.
public to note General public take note.

MIKAIL : I formerly known and I formerly known as HASSAN SIMON: I Formerly known CHRISTIAN: I formerly known as CORRECTION OF NAME My I Formerly known and addressed as
called KABIR MIKALU now wish to be CHRISTIAN EMMANUEL CHIGOZIE name was wrongly written as AKINREMI AMUSA OLUFUNKE OLUTULA and AMUSA
TANIMU GWANI now wish to be as BLESSING SIMON, Now wish OLUSOLA AGNES instead of OLUTOLA OLUFUNKE now wish to be known
known and addressed as MUHAMMAD ONWUEGBU now wish to be called as
called as a. HASSAN TANIMU to be known and addressed as OGUNTIMILEHIN MOPESOLA AGNES, and addressed as AMUSA MARY OLUFUNKE.
KABIR MIKAIL. All former documents CHRISTIAN CHIGOZIEM ONWUEGBU
GWANKI All former documents BLESSING GODWILL. All former all former documents remain valid general
now wish to be addressed as OGUNTIMILEHIN My correct date of birth is 28th February, 1967.
remain valid. Concerned authorities and MOPESOLA AGNES. All former documents All former documents remain valid. Authorities
the general public to please take note. remain valid authority concerned documents remain valid General public all authority concern should please remain valid. General public take note. concerned and general public note.
and general public take note public should please take note take note

I formerly known and addressed as I formerly known as RABI USMAN: I Formerly known HABIBA: Formerly known as ODODO: I, formerly known I, Ogunyemi Israel Oguns,
TALATU IBRAHIM, now wish to be known, UZAIRU now wish to be called as as USMAN DALHATU ALTINE. as MISS BALOGUN RASHIDAT my name was wrongly written as
Called and addressed as HAJARA IBRAHIM
HABIBA IBRAHIM now wish to
MUHAMMAD AJIYA DALHATU, Now MORONKE, now wish to be known Ogunyemi Israel Ifeoluwa on my
and my correct and proper date of birth is ADAMA ABUBAKAR All former be addressed as HABIBA USMAN.
wish to be known and addressed as and addressed as MRS. ODODO International passport, I wish to be
28-01-1985, all former documents remain documents remain valid authority USMAN DALHATU AJIYA. All former All former documents remain valid. RASHIDAT MORONKE. All former
valid, All authorities concerned and General known and addressed as Ogunyemi
concerned and general public take documents remain valid General public General public take note documents remain valid. General public
public please take note. Israel Oguns. General Public take note.
note should please take note take note.

ZAINAB: I, formerly known as I formerly known as HABIBA MUSA: I Formerly known as My Name was wrongly capture as ADEKOYA: I, formerly known I, Mr Ayodele Wonuola
ZAINAB JOHNSON , now wish to ADAMU now wish to be called MUSA RABIU, Now wish to be NDAK GODIYA in My Account instead as MISS ADEYEMI OLUWASEUN Emmanuel, was born on the 10th
be called and addressed as ZAINAB of NDACK GODIYA Now wish to be OMOLOLA, now wish to be known May, 2001, but my date of birth was
as HABIBA SHEHU All former known and addressed as MUSA
called and addressed as NDAK GODIYA and addressed as MRS. ADEKOYA mistakenly written as 5th Oct.,2001 on my
ZAKARI . All former documents documents remain valid authority NAFI,U. All former documents All Former documents remain valid UBA OLUWASEUN OMOLOLA. All former International passport. That my correct
remain valid. Authorities concerned concerned and general public take remain valid General public should BANK Plc Any Authority concern and the documents remain valid. General public date of birth is 10th May, 2001.Gen public
and the general public to take NOTE. note please take note General public to please take note take note. take note

GAMBO : I, formerly known I formerly known as HALADU . I formally know MUSTAPHA KAFAYAT: I formerly known as I formerly known as OLABODE I Formerly known and addressed as
as UMAR GAMBO BALA , now wish SHUAIBU MAKERI 23 06 1960 ADAMU MUHAMMAD, now wish to be KAFAYAT ENIAYEWU Now wish to OLATUNDE AJAYI now wish to be OLOWOYEYE LATIFAT OLUWASEUN
to be called and addressed as GAMBO now wish to be known and addresses. known and addressed as MUSTAPHA be called and addressed as KAFAYAT now wish to be known and addressed as
known and addressed as OLABODE
HALADU SHUAIBU with new DOB 01 ADAMU. All former documents remain ABIMBOLA ENIAYEWU All Former AWOBOLA LATIFAT OLUWASEUN.
UMAR BALA . All former documents BABATUNDE AJAYI. All former
01 1955 all former documents remain valid, Authorities concerned and documents remain valid Any Authority All former documents remain valid.
remain valid. Authorities concerned valid FCMB Plc , authority concerned and concern and the General public to please documents remain valid. General Authorities concerned and general public
and the general public to take NOTE. general public should please take note.
general public should take note take note public should please take note. take note.

USMAN: I, formerly known as I formerly known ADAMU :I formerly known as ABUBAKAR MZEMBA; I, formerly called THAT I FORMERLY KNOWN, I was formerly known and addressed
USMAN AMINU YAKASAI D O B ABDULJABBAR I now wish to and addressed as IEREN WILSON CALLED AND ADDRESSED AS MONILOLA as MISS AFOLABI FLORENCE IDOWU
A DANBAYARO now wish to be called OYINKANSOLA ODEBOWALE, NOW WISH
19/4/1955, now wish to be called and MZEMBA now wish to be addressed as now wish to be known, called and addressed
be known ADAMU YUNUSA and addressed as ABUBAKAR UMAR TO BE KNOWN AND ADDRESSED AS
addressed as USMAN MUHAMMAD D IEREN MZEMBA. All former documents as MRS. ABIODUN FLORENCE
ABDULJABBAR All former documents All former documents remain valid OYINKANSOLA MONILOLA ODEBOWALE. IDOWU. All former documents remain valid
O B 19/4/1962. All former documents remain valid. Union Bank PLC and
remain valid Authority concerned and Authority concerned and the general ALL FORMER DOCUMENTS REMAIN VALID. concerned authorities and general public
remain valid. Authorities concerned and general public should take note GENERAL PUBLIC TAKE NOTE.
the general public to take NOTE. general public should please take note public should please take note. should take note.
28 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust
Thursday, February 8, 2024

Classifieds made easy PUBLIC NOTICE Page 3


This is to certify and con¿rm that; AJAYI VERONICA: I, formerly known ESTHER : I formerly known ABDULAZIZU I formely known *MRS. JOSHUA*= I ,formally I, formerly known as
ABIGAEL BOLATITO, AJAYI ABIGAIL known as *MISS. EKE PATIENCE
as JAHANIS GEOFRY, now wish to as ESTHER ROTIMI now wish as ABDULAZIZU ADAMU ADAMU ITEGBOJE FAITH now wants to
BOLATITO , and ORIPELOYE ABIGAEL
BOLATITO refer to one and the same person now be known and addressed VERONICA to be known as ESTHER SEUN now wish to be know and addressed UKPAI* now want to be known and be known and addressed as EGUYE
AUGUSTINE. All former documents as ABDULAZIZU MOHAMMED All address as *MRS. JOSHUA PATIENCE
wish to be known, called, and addressed as MRS. ROTIMI. All former document FAITH. All documents bearing
ORIPELOYE ABIGAEL BOLATITO. All former remain valid. Authorities concerned and former documemt remain valid General IFEOMA*. All former documents remain
remain valid. General public should valid. General public take note. former names remain valid. General
documents remain valid concerned authorities and the general public should please take note. public should please take note.
general public should take note. take note. public take note.

GADZAMA : I formerly known SAMUEL: I formerly known MARTHA : I formerly known SAFRATU: I, formerly known as *UGBE:* *I WAS FORMERLY KNOWN *AKPENE* I, formerly known
and addressed as MARYAMU ISAH SAFRATU J with DOB 01/01/1958, AND CALLED AS UGBE PAUL ORJIHGJIHG as *AKPENE JAMES JULIET*. Now
as SAMUEL SAUL HAWAINIYA as MARTHA SAMAILA MAIDOKI NOW WISH TO BE KNOWN, CALLED AND
WAZIRI now wishe to be known and now wish to be known and addressed wish to be known called and addressed as
now wish to be known and addressed now wish to be known as MARTHA ADDRESSED AS UGBE PAUL JIGHJIGH.
addressed as TSUKUNDA GADZAMA. as IBRAHIM SAFRATU. All former *AKPENE JULIET BARISEREDUM*.
All for document remain valid, constitute as SAMUEL SAUL. All former ALI IZANG. All former document documents remain valid with DOB
ALL FORMER DOCUMENTS REMAIN VALID.
All documents bearing my former name
GENERAL PUBLIC AND OTHER AUTHORITIES
authorities concern and the general public documents remain valid. General remain valid. General public should 02/04/1958. Authorities concerned and remain valid. The general public should
CONCERNED SHOULD PLEASE TAKE NOTE.*
should please take note. public should please take note take note. general public should please take note. please take note.

FATIMA: I, formerly known SUNUSI: I formerly known MAMUDA: I, formerly known as ABDULLAHI : I formerly known *CHANGE OF NAME:* *MRS. TAOFEEK:* *MRS. SUCCESS*= I ,formally
MAMUDA DANJUMA, now wish to as ABDULLAHI MOHAMMED now *I WAS FORMERLY KNOWN AND CALLED AS known as *MISS. ANYANWU
as FADIMATU UMARU, now wish to as SUNUSI YUNUS, now wish to be MISS. OKANDEJI BADIRAT FOLASHADE NOW
be known and addressed as FATIMA known and addressed as SUNUSI be known and addressed MAMUDA wish to be known as ABDULLAHI PRECIOUS ONYEDIKACHI* now
WISH TO BE KNOWN, CALLED AND ADDRESSED
UMAR BAKO. All former documents MUHAMMED DANJUMA. All former MUHAMMAD. with D O B 01/01/2002 want to be known and address as
YUNUS ABUBAKAR. All former documents remain valid. Authorities to 25/10/2003. All former document
AS MRS TAOFEEK BADIRAT FOLASADE. ALL
*MRS. SUCCESS PRECIOUS
remain valid. Authorities concerned and documents remain valid. General FORMER DOCUMENTS REMAIN VALID. GENERAL
concerned and general public should remain valid. General public should take ONYEDIKACHI*. All former documents
general public should please take note. public should please take note.
PUBLIC AND OTHER AUTHORITIES CONCERNED
please take note. note. SHOULD PLEASE TAKE NOTE.* remain valid. General public take note.

WAZIRI: I formerly known ABBAGANA: I formerly IDIRISU: I, formerly known as AZEEZAT : I formerly known *CORRECTION OF NAME:* *MY NAME *AMARACHI* I, formerly known
as WAZIRI BURA, now wish to be WAS MISTAKENLY CAPTURED AS OMO-ALADEE as *AMARACHI EDNA IGWE*. Now
known as ABBA ALI GANA, now IDRISA ABDULLAHI, now wish to as AZIZAT JADESOLA SALAMI ADEWOLE MUIDEEN BUT NOW WISH TO BE
known as WAZIRI BURA KONDUGU. be known and addressed IDIRISU wish to be known, called and addressed
wish to be known and addressed now wish to be known as AZEEZAT KNOWN, CALLED AND ADDRESSED AS ALADE
All former documents remain valid. ABDULLAHI. All former documents as *AMARACHI EDNA ELVIS-WALI*.
With correct DOB 11/09/1965 NOT as ABBAGANA GONIMI. All former OPEYEMI SALAMI . All former MUIDEEN ISHOLA WHICH IS MY CORRECT NAME.
All documents bearing my former name
remain valid. First bank Plc and general ALL FORMER DOCUMENTS REMAIN VALID.
22/08/1975 The general public should documents remain valid. General document remain valid. General remain valid. The general public should
public should please take note. GENERAL PUBLIC AND OTHER AUTHORITIES
take note. public should please take note. public should take note CONCERNED SHOULD PLEASE TAKE NOTE.* please take note.

PATIENCE I formally known TOBA : I formerly known as LEMBOYE: I formerly known as TIJJANI: I formerly known *AGBER:* *I WAS FORMERLY *BLESSING* I, formerly known
LEMBOYE AISHA OLARONKE now KNOWN AND CALLED AS AGBER HANNAH as *EHIOMA BLESSING NJOKU*.
as ESTER RAYMOND, now TOBA NDALNAM TOBA now wish as TIJANI SULEIMAN, now wish MBAWUESE NOW WISH TO BE KNOWN,
wish to be known and addressed as Now wish to be known, called and
wish to be known and addressed to be known as TOBA NDALNAM AYODELE AISHA OLARONKE with
to be known and addressed as CALLED AND ADDRESSED AS AGBER HANNAH.
addressed as *BLESSING CHIDINMA
as PATIENCE ALI All former ZIBDAM. All former document D.O.B 22/12/1995 all documents SULEIMAN TIJJANI. All former ALL FORMER DOCUMENTS REMAIN VALID.
NJOKU*. All documents bearing my
GENERAL PUBLIC AND OTHER AUTHORITIES
documents remain valid. General remain valid. General public should remain valid. With D. O.B 22/12/1995. documents remain valid. General CONCERNED SHOULD PLEASE TAKE NOTE.* former name remain valid. The general
public should please take note. take note. General public should please take note. public should please take note. public should please take note.

FELICIA I formally known as SARAYA I formerly known HANNATU: I was formerly AISHATU: I formerly known *OLUEBUBE* I, formerly I, formerly known as *MR OTO
FELICIA IDRIS now wish to be as SARAH JOHN SARAYA now known as HANNATU DIOH CHAN. as AISHA USMAN KINGIN, now known as *MIRACLE COLLINS*. BRIGHT OBIONG*. Now wish to be
now wish to be known and addressed Now wish to be known, called and known called and addressed as *MR
known and addressed as FELICIA wish to be known and addressed wish to be known and addressed
as HANNATU CHAN-DIOH PAUL. addressed as *OLUEBUBE MIRACLE OTOBONG BRIGHT*. All documents
IDRIS MALGWI All former as SARAYA DANIEL All former as AISHATU USMAN. All former OGOCHUKWU*. All documents bearing bearing my former name remain valid.
documents remain valid. General documents remain valid General All former documents remain valid. documents remain valid. General my former name remain valid. The The general public should please take
public should please take note. public should please take note. general public should please take note public should please take note. general public should please take note. note.

MOHAMMED I formerly known I, KADI PULKA IBRAHIM do solemnly ALHAJI:I was formerly known as BABAGANA: I formerly known I FORMERLY KNOWN AS MRS. ALLISON: I, formerly known
and addressed as MOHAMMED HABU declare that: The names KADI IBRAHIM ALH-MODU MUHAMMAD-AJI, now as BABAGANA MUHAMMAD, now and addressed as MISS CHARITY EZE,
PULKA and KADI PULKA IBRAHIM are referred
EDOGIAWIERE MICHEAL EHI.
ALI now wish to be known and addressed wish to be known and addressed as wish to be known and addressed as now wish to be known and addressed
to me, as I used to bear either of the names. NOW WISH TO BE KNOWN AS
as MOHAMMED ABUBAKAR All former ALHAJI MODU MOHAMMED. All former BABAGANA MOHAMMED. All former as MRS CHARITY CHIMAMANDA
documents remain valid All concern and
Now I wish to be known and called KADI
documents remain valid. With correct KAYODE MICHAEL. FORMER ALLISON. All former documents remain
PULKA IBRAHIM. All former documents remain documents remain valid. General DOCUMENTS REMAIN VALID
authority General public should please valid. Authorities concerned and public to note. 01/01/1997 NOT 01/10/1994, The valid. General public take note
take note general public should please take note public should please take note. GENERAL PUBLIC TAKE NOTE

BALA I formerly known and , MODU NASAR do solemnly declare YOHANNA: I, formerly known as ZUBAIRU I formally known I FORMERLY KNOWN AS *MRS. NYOBANA* = I ,formally
addressed as BALA ABDULLAHI that: The names MODU NASAR and MODU YOHANNA SIMON KURANA with DOB MISS. NDAM BLESSING. NOW known as *MISS. BERESIRI VIVIAN
as ZUBAIRU I. DAKINGARI now
GASMA now wish to be known and NASIR are referred to me, as I used to 01/01/1987, now wish to be known WISH TO BE KNOWN AS MRS. OHUE DAWARI* now want to be known and
bear either of the names. Now I wish to be wish to be known and Addressed
addressed as BALA ABDULLAHI All and addressed as YOHANNA SIMON. All BLESSING EMMANUEL. FORMER address as **MRS. NYOBANA VIVIAN
former documents remain valid All known and called MODU NASAR. All former former documents remain valid with DOB as ZUBAIRU IBRAHIM All former DAWARI* All former documents remain
documents and remain valid. Authorities DOCUMENTS REMAIN VALID
concern and authority General public 07/06/1989. Authorities concerned and documents remain valid general GENERAL PUBLIC TAKE NOTE valid. General public take note.
concerned and public to note.
should please take note. general public should please take note. public should please take note.

MOHAMMED: I, formerly known DAHIRU: I formally known as: EJAINA: I, formerly known as DIJA I formerly known and I FORMERLY KNOWN AS *MRS. MOSIERI*= I ,formally
as MOHAMMED ABDULKADIR with DOB JOY SAMAILA, now wish to be known addressed as DIJA SAIDU now wish MISS. OBASUYI GLORY OWEN .DUE known as *MISS. AGBUGBA FAITH
07/04/1993, now wish to be known and
DAHIRU M BUBA, now wish to be
known and addressed as DAHIRU and addressed as EJAINA SAMAILA. to be known and addressed as DIJA TO MARRIAGE NOW WISH TO BE OKWUKWECHI* now want to be known
addressed as MOHAMMED ABDULKADIRI KNOWN AS MRS. ROBERT GLORY and address as *MRS. MOSIERI FAITH
ULEA. All former documents remain valid with MALLAM BUBA, All former All former documents remain valid. MOHAMMED All former documents
DOB 02/07/1995. Authorities concerned Authorities concerned and general remain valid All concern and authority OWEN. FORMER DOCUMENTS OKWUKWECHI*. All former documents
documents remain valid general REMAIN VALID GENERAL PUBLIC remain valid. General public take note.
and general public should please take note. public should please take note. General public should please take note.
public should please take note. TAKE NOTE
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 29
Classifieds made easy PUBLIC NOTICE QPC
*MRS. OZUA*= I ,formally I, formerly known as ADAMU I, formerly known as UMAR
known as *MISS. NWACHUKWU SANI now wish to be known and and ABDULLAHI now wish to be known
JOY ODINAKA* now want to be addressed as ADAMU BALA GALADIMA. and addressed as UMAR MUHAMMAD
known and address as *MRS. OZUA All former documents remain valid. YABO. All former documents remain
JOY ODINAKA*. All former documents General public and authorities concerned valid. General public and authorities
remain valid. General public take note. should please take note.
concerned should please take note. )('(5$/1(85236<&+,$75,&+263,7$/(18*8
*MRS. DOROTHY*= I ,formally I, formerly known as MUSTAPHA I, formerly known as AMADU
$'0,66,21 ,172 7+( 6&+22/ 2) 3267 %$6,& 36<&+,$75,&
known as * MISS. DOROTHY OPUDA SHEHUN JAJI, SHEHU ALMUSTSPHA MURTALA with D.O.B 10/03/2007 now $1'0(17$/+($/7+1856,1*)('(5$/1(85236<&+,$75,&
ABALI* now want to be known and JAJI now wish to be known and address wish to be known and address as AHMAD
address as *MRS. DOROTHY LUCKY as MUSTAPHA JAJI SHEHU. All former MURTALA with D.O.B 11/02/2005. All +263,7$/(18*8)25$35,/$&$'(0,&6(66,21
documents remain valid. General public former document remain valid. General
MARK*. All former documents remain
and authorities concerned should please public and authorities concerned should
valid. General public take note. please take note. $SSOLFDWLRQVDUHLQYLWHGIURPVXLWDEO\TXDOL¿HGFDQGLGDWHVIRUDGPLVVLRQLQWRWKH
take note.

*MRS. NWACHUKWU*= I I, formerly known NANA . I, formerly known as MOSES


PRQWKV 3RVW %DVLF 3V\FKLDWULF 1XUVLQJ 3URJUDPPH RI WKH 6FKRRO RI 3RVW %DVLF
,formally known as *MISS. EBGE FIRDAUSI ABUBAKAR GARBA ANA CHIFE now wish to be addressed 3V\FKLDWULFDQG0HQWDO+HDOWK1XUVLQJ)HGHUDO1HXURSV\FKLDWULF+RVSLWDO(QXJX
VERONICA OLUCHUKWU* now now wish to be known and address as as MUSA IDRIS ABDULLAHI.
want to be known and address as FIRDAUSI ABUBAKAR. All former Alll former documents remain valid.
*MRS. NWACHUKWU VERONICA documents remain Valid. General public
OLUCHUKWU*. All former documents and authorities concerned should please
General public and authorities (175<5(48,5(0(176
remain valid. General public take note. take note. concerned should please take note.
5HJLVWHUHG1XUVH 51 ZLWKFXUUHQWSUDFWLFLQJ/LFHQVH
Correction of name and date of birth: . I, formerly known as OGUNDARE I, formerly known as NURADEEN )LYH   FUHGLWV LQ :$6&66&(*&( RU 1(&2 WR LQFOXGH (QJOLVK /DQJXDJH
My name was wrongly written as SHEDRACK SEYI SUNDAY now wish to be known BAWA now wish to be known and
DAVID, instead of SHADRACH DAVID, now and addressed as MUHAMMAD SANUSI addressed as NURADEEN BAWA
0DWKHPDWLFV%LRORJ\&KHPLVWU\DQG3K\VLFVDWQRWPRUHWKDQWZRVLWWLQJV$OVR
wish to be known and addressed as SHADRACH
SEYI. All former document remain TSAFE. All former documents remain LQGLYLGXDOVZLWK%DFKHORURI1XUVLQJ6FLHQFHV %16& FDQDSSO\IRUVSHFLDOW\LQWKLV
DAVID and my correct date of birth is
11/9/1974, and not 9/11/1974 , All former
valid. General republic and authorities valid. General public and authorities
documents remain valid, general public take note. concerned should please take note. concerned should please take note. ¿HOG
$WOHDVWRQH\HDU3RVW4XDOL¿FDWLRQ5HJLVWUDWLRQFRJQDWHH[SHULHQFH
I formerly known and addressed as I, formerly known as MUDASSIRU . I formerly known as MISS 5HFRPPHQGDWLRQIURPWZR  UHIHUHHVRQHPXVWEHIURPWKHODVW6FKRRORI1XUVLQJ
Okorie Euphemia Ngozi now wish to be ABUBAKAR now wish to be known and SAFIYYA ABUBAKAR RAHAMA now
known and addressed as Offor Euphemia addressed as MUDASSIRU MUKHTAR. wish to be called and addressed as MRS DWWHQGHG
Ngozi. imo state Secondary Education All former document remain valid. SAFIYYA MUAWUYA RAHAMA. All
Management Board, Embasies in Nigeria General public and authorities concerned fomer document remain valid. NYSC, (QFORVHG WZR   UHFHQWSDVVSRUW VL]HSKRWRJUDSKV DQG SKRWRFRSLHV RI UHOHYDQW
and the general public should pls take should please take note. general public and authorities concerned
note. All former documents remain valid should please take note.
FUHGHQWLDOV
I, formerly known as IBRAHIM I, formerly known as AMINU I, formerly known and addressed
HALIRU with D.O.B 01/01/1987 LAWAL YELDU , LAWAL YELDU as MISS AZIZA ISMAIL now wish 0(7+2'2)$33/,&$7,21
now wish to be known and address as AMINU and AMINU LAWAL now wish to be called and addressed as MRS
ABUBAKAR LABARAN ALIYU with D:O.B to be known and addressed as AMINU AZIZA SANUSI. All former document
$OODSSOLFDQWVVKRXOGSD\DSSOLFDWLRQIHHRI 1  )LIWHHQWKRXVDQGQDLUD 
01/01/1988. All former document remain
valid. General republic and authorities
LAWAL . All former document remain remain valid. NYSC, general public and RQO\LQWRWKH+RVSLWDODFFRXQWLQDQ\FRPPHUFLDOEDQNWKURXJKWKHUHPLWWDSODWIRUP
valid. General public and authorities authorities concerned should please take
concerned should please take note. concerned should please take note. note. IRUFROOHFWLRQRIIRUPLQWKHVFKRROZLWKWKHSD\PHQWVOLSDWWDFKHG
I, formerly known as ABDULLAHI I, formerly known as HAFIZ I, formerly known as MUHAMMAD
UMAR with D.O.B 27-06-1984 now BELLO now wish to be known and DAUDA MUSA with D.O.B 06-03-1998 $OVRDSSOLFDQWFDQFRPHWRWKH$FFRXQW2໥FHRIWKH6FKRROWRJHQHUDWH555IRU
wish to be known and addressed as now wish to be known and addressed as
address as HAFIZ BELLO IBRAHIM.
ABDULLAHI UMAR YABO with D.O.B
All former document remain valid.
MUHAQMMAD DAUDA MUSA with D.O.B RQZDUGSD\PHQWWRDQ\FRPPHUFLDOEDQN7KHVOLSRIWKHSD\PHQWZLOOEHSUHVHQWHG
27-11-1987. All former document remain 31-12-2001. All former document remainI
valid . General public and authorities General public and authorities valid. General public and authorities WR WKH VDPH $FFRXQWV 2໥FH IRU FROOHFWLRQ RI RULJLQDO UHFHLSW DQG VXEVHTXHQW
concerned should please take note. concerned should please take note. concerned should please take note.
FROOHFWLRQRIIRUPLQWKH6FKRRO
. I, formerly known as AHMED I, formerly known as AMINU
ALMUSTAPHA now wish to be SHEHU now wish to be known
known and addressed as AHMAD Requirement for
/DVWGD\IRUVXEPLVVLRQRIDSSOLFDWLRQIRUPLVQG0DUFKZKLOHHQWUDQFH
and addressed as ALIYU SANI.
ALMUSTAPHA. All former document H[DPLQDWLRQZLOOWDNHSODFHRQ6DWXUGD\UG0DUFKE\DPDWWKH6FKRRO
All former document remain valid.
remain valid . General public and Change of Name
authorities concerned should please take General public and authorities $XGLWRULXPIRUWKHVKRUWOLVWHGFDQGLGDWHVRQO\
note. concerned should please take note.
Women: Marriage
I, formerly known as IDAYAT I, formerly known as ABUBAKAR Certificate or Court
IDAYA BOLA, ABDUL WAHEED IDAYA ALHAJI SULAIMAN now wish to be
BOLA AND BOLA I ABDUL WAHEED called and addressed as ABUBAKAR
6LJQHG
now wish to be known and addressed as SULEIMAN with D.O.B 02-01-1978.
Affidavit; Men: Court
IDAYATU JAYEOLA. All former document All fomer document remain valid. General
Affidavit 'U1JR]LFKXNZX1QHND8QDRJX 0U9LWXV1ZDQJZX
remain valid. General public and authorities public and authorities concerned should
concerned should please take note. please take note.
>$J0HGLFDO'LUHFWRU)1+(@ >$J3ULQFLSDO&RRUGLQDWRU6230+1@
30 Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust Thursday, February 8, 2024

SPORT
Cricket League
Super: Pathfinders
talk tough ahead
of Idia Royals clash
The Port Harcourt-based Female
Cricket Club, Pathfinders has
promised to disrupt Idia Royals’
expectations when the two
teams clash as Nigeria’s only
female cricket league gets to the
business end from 9th to 11th
February 2024.
“We are Pathfinders, we look
for a way to come out as the best
in everything we do. We have
been training very well for this
competition. We will win this
match against Idia Royals.”
The Team Manager of
 Members of Team Nigeria contigent at the Commonwealth Youth Games FILE : PHOTO Pathfinder, Coach Florence

Ghana 2024: Team Nigeria gears up


was talking tough not minding
if Idia paraded the best set of
players in the female league.
The game against Idia Royals

as 5 states host pre-games camp


would be a tough one. We may
have upcoming cricketers but
we will have ‘help’ to conquer
them this weekend.
Although Idia Royals did
... Nigeria to participate in 25 sports, eight Olympic qualifiers not reach the Super Four in
the last edition of the South-
By Jide Olusola the upcoming event. presidents to strive for a superior rugby, swimming, taekwondo, south Female Cricket League,
Nigeria’s participation will performance compared to the tennis, weightlifting, and the team is so formidable that

T
eam Nigeria’s contingent span 25 sports, with eight serving previous African Games held in volleyball. Pathfinders who have played in
to the 2024 African as Olympic qualifiers including Morocco. Lagos will serve as the the last two Super Four editions
Games will open camp athletics, badminton, cycling, “I urge you all to give your campsite for beach volleyball, look intimidated. However,
on February 15, 2024, in five swimming, table tennis, triathlon, utmost effort and guide your cricket, handball, table tennis, Coach Florence has assured
states across the Federation, as and wrestling. Additionally, federations towards achieving mixed martial arts, and triathlon. with God on their side and the
preparation hits second gear for the country will compete in 15 exceptional results in Ghana. Ibadan will host boxing, chess, girls disciplined in all areas
the Games, which will take place non-Olympic qualifying sports We bear the responsibility of scrabble, judo, and karate. of cricket, the result may turn
in Accra, Ghana from March 8 to such as arm wrestling, basketball upholding our nation’s flag and Bayelsa will cater to the wrestling favourable.
23, 2023. (3x3), beach volleyball, boxing, bringing pride to our people.” team, while Gombe will provide Pathfinders finished third in
During a meeting with chess, cricket, football, and The camping sites have been facilities for the cycling team. the second edition of the league.
presidents of various sports handball. Furthermore, two designated in Abuja, Lagos, Nigeria remains the second- However, Idia Royals after the
federations, the Minister of sports, mixed martial arts, and Ibadan, Gombe, and Bayelsa. most successful nation in the team was rejigged was training
Sports Development, Senator scrabble, will be demonstrated Abuja will accommodate history of the Games with a total with lots of confidence. “The
John Owan, addressed critical by Nigerian athletes. athletes participating in athletics, of 1326 medals won across 12 first 11 players can win any
issues pertaining to the nation’s Senator Enoh, during the arm wrestling, badminton, editions of the games held every match” Captain Favour Eseigbe
preparation and participation in meeting, urged federation basketball, football, hockey, four years. boasts.

Bendel Insurance declare Vincent Rivers Int’ Marathon, a catalyst for


Augustus AWOL positive change - Fubara
By Jide Olusola is unprofessional and that it By Jide Olusola emphasized the ripple effect of
amounts to gross indiscipline talent discovery that the event
Nigeria Premier Football which attracts appropriate Rivers State governor, promises, foreseeing a surge in
League (NPFL) side, Bendel sanctions. Similanayi Fubara has local talent development as a
Insurance has declared “One would have affirmed that the upcoming direct result of participation.
one of its finest players, expected the player to Rivers State International The governor highlighted
17-year-old Vincent officially inform the club Marathon is poised to the myriad opportunities
Augustus Absent Without of his intentions if he has captivate the global spotlight that will emerge for local
Official Leave (AWOL). reasons to leave so that and shine a positive light on businesses during the
The player, according to both parties can explore the the state. marathon’s preparation phase
the club, failed to return to means of mutual agreement on He made this declaration and on the event day itself.
the Benin Arsenals after the one- contract termination,” he added in during a press conference in Port Anticipating brisk commercial activity,
week mid-season break according to a his statement. Harcourt, River State which was aimed at Barrister Green envisaged a boost to the
statement issued by the club’s secretary, “Nobody wants to tie him down updating the media on the extensive lineup state’s economy, with local enterprises
Charles Ihimekpen. here and we have never received any
Ihimekpen wondered why a complaints from him on any issues of activities slated for the international poised to thrive amidst the influx of
professional football player who has a affecting his well-being in Benin,” the marathon, set to take place on May 18, participants and spectators.
running contract with the club would statement said. 2024. Echoing the governor’s sentiments,
stay away without permission from the Augustus became the youngest goal Represented by the esteemed project consultant, Femi Abegunde of Arch
management or the head coach. scorer for Bendel Insurance in a CAF Commissioner for Youth and Sports, Raphael Limited lauded the marathon
He stated that the club does not competition, after finding the net in their Barrister Christopher Green elaborated as a trailblazing endeavour that sets a
know his whereabouts and he has clash against RS Berkene last year. on the multifaceted benefits of the benchmark for future athletic endeavours
not communicated with the club Meanwhile, the NPFL has announced a international marathon. in Nigeria and beyond. Abegunde went
on happenings around him and his new date for the matchday 13 rescheduled He underscored its pivotal role in further by revealing the plan for local
whereabouts. fixture involving Sporting Lagos and combating social vices, particularly athletes saying the introduction of the
Ihimekpen expressed the club’s Rivers United. among the youth, citing the allure of cash Nigerian elite prize tag underscores the
disappointment in him, adding that his The game which was initially scheduled prizes as a compelling incentive for young commitment to fostering local talent and
act of dereliction of duty and refusal to to take place on Wednesday, February 7, participants. elevating the country’s standing in the
open the line of communication with 2024, will now be played on Thursday, Furthermore, the commissioner global marathon community.
Bendel Insurance on his whereabouts February 8, 2024.
Thursday, February 8, 2024
Like us on Facebook.com/dailytrust
follow us on Twitter: @daily_trust 31
SPORT 2023 AFCON
Nigeria beat S/Africa to set up Enoh secures N200m support from
AFCON final with Cote d’ Ivoire APC Governors for Super Eagles
By Jide Olusola to the players by the Progressive
Governors’ Forum .
The Minister of Sports “I want to thank the
Development, Senator John Progressive Governors’
Owan Enoh has secured the Forum under the leadership
sum of Two hundred million of Governor Hope Uzodimma
naira (N200m) for the Super of Imo state for galvanizing
Eagles playing at the Africa and redeeming the sum of two
Cup of Nations 2023. hundred million Naira only to
Senator John Enoh the Super Eagles of Nigeria who
commended the enthusiasm are currently in Cote D’Ivoire
of Governor Hope Uzodimma for AFCON 2023.”
of Imo State, Chairman of the “The Super eagles have
Progressive Governors’ Forum shown immense commitment
and all members of the Forum and tenacity through every
for the swift action taken match ,this shows that they
immediately he spoke with the are on the path to conquer
Forum Chairman on the need the continent again and bring
for the Governors to motivate home the coveted Cup of
the team prior to the semi- Nations.
final match against the South “Therefore, we must rally
 Vice President Sen. Kashim Shettima (right) celebrates with the Super Eagle of Nigeria at the end of the Africans. support for them because
Africa Cup of Nations match in Côte d’Ivoire yesterday The Minister of Sports upon their shoulders lie the
By David Ngobua & Jide Olu- Bafana’s well-organised rearguard. setback when Grant Kekana was Development has further enormous responsibility to
sola Meanwhile, the South Africans sent off in the 115th minute of confirmed that the complete make Nigeria our great Nation
continued to target the spaces extra-time. sum has already been redeemed proud,” he said in a statement.

T
hree-time African behind the Nigerian defence, and In the resultant penalty
champions, the Super on one occasion, forced Nwabali shootout, Ola Aina missed
Eagles of Nigeria soared
into the final of the 2023 Africa
into a top drawer save to keep the
Super Eagles in the match.
Nigeria’s third penalty but
Mokoena, Evidence Makgopa Tinubu lauds Super Eagles
Cup of Nations (AFCON) after The first half ended goalless and Mothobi also missed South
a hard-fought 4-2 victory over
arch rivals, the Bafana Bafana of
but on resumption, the Super
Eagles piled more pressure on
Africa’s first, third and fourth as
Kelechi Iheancho’s clinical kick
after win over S’ Africa
South Africa who fought back to the South African defence line sent the Super Eagles into the By Jide Olusola the Nigerian spirit is a winning
take yesterday’s semi-final clash and their persistence paid off final. spirit. You are conquering the
to penalties after a 1-1 draw in when reigning African Footballer Yesterday’s semi-final clash President Bola Ahmed Tinubu continent one match at a time.
regulation time at Stade Bouake. of the year, Victor Osimhen was with the Bafana Bafana of South has lauded the Super Eagles for Bravo, heroes of our time!
The Super Eagles will slug it out brought down in the box for the Africa was Super Eagles 16th qualifying for the finals of the “You have set your goals high
with Cote d’ Ivoire in Sunday’s resultant penalty that was coolly appearance in the semi-finals, in 2023 Africa Cup of Nations. and you have not stopped. Keep
finals after the host pipped Congo converted by on-field captain, what is their 20th appearance at He congratulated through soaring and bring home the
DR 1-0 in the second semi-final William Troost-Ekong in the 67th the competition. his official X account (formerly Africa Cup of Nations. Unto
match. minute. In 15 semi-final appearances known as Twitter). the Finals. Congratulations,” he
In the dramatic shoot-out that Then, on 85 minutes, the Super before the 16th against South “From the Southernmost said.
ensued, Super Eagles new number Eagles thought they had sealed Africa, the Super Eagles had lost cape of Africa to the Plains of It will be recalled that Nigeria
one goalkeeper, Stanley Nwabali, the game, with Victor Osimhen eight times in 1976, 1978, 1992, Mauritania and the coast of had not been involved in a
was the hero as he followed up his finishing a terrific counter attack 2002, 2004, 2006, 2010 and 2019 West Africa. You have made us penalty shootout since 2010
excellent goalkeeping in normal move to double their lead. while emerging victorious seven all Proud to be Nigerians. Go… when they they triumphed over
and extra-time of the match with However, VAR brought play times in 1980, 1994, 1988, 1990, Soar in the AFCON Finals. Well Zambia.
two brilliant saves to send South back to the start of the move, 1994, 2000 and 2013 against done, boys,” he tweeted. They had previously
Africa out of the 34th edition of finding that Alhassan Yusuf had Guinea in South Africa. In the same vein, the sports triumphed in a penalty shootout
the continental championship. fouled Percy Tau, and as the In addition, yesterday’s win minister, John Enoh urged the at the Bouake Stadium 40 years
At the start of the feisty clocked ticked over the 90-minute makes it the second time the team to bring the trophy home. ago. Incidentally, it was also a
encounter witnessed by Vice mark, Teboho Mokoena scored Super Eagles are beating the “My dear Super Eagles, today semi-final match with Egypt.
President Kashim Shettima and from the spot to level scores and Bafana Bafana at this stage of the you have given every Nigerian Other penalty shootouts
other officials, the Super Eagles take the evenly contested match AFCON with the first coming in Compatriot a reason to rejoice. involving Nigeria in the semi-
dominated the proceedings to extra-time. 2000 when Nigeria co-hosted the We all doff our hats to you. finals are those of 1988 and
but struggled to breach Bafana South Africa suffered a major tournament with Ghana. “You have shown us all that 1994.

AFCON 2023 has exceeded expectations on the field – CAF


The CAF Technical Study “We are experiencing a The CAF Technical Study
Group (TSG) has delivered wonderful competition. This Group comprises of highly
the preliminary verdict on the AFCON is the best in history experienced football analysts
on-going CAF Africa Cup of on so many aspects,” said CAF from across the continent who
Nations Cote d’Ivoire 2023 Director of Technical and have served the African game in
and said the 2023 event has Development Raul Chipenda. various technical capacities.
exceeded expectations on the “The gap between the so In his closing remarks,
field. called small and big teams has Chipenda called for the
With the competition now been substantially reduced. The continued investment into
entering the exciting final coaches are displaying good football development by
stage, a total of 50 matches have quality in how they read the African countries, adding that if
officially been played, allowing game before, during and after. all countries play an active role
for comprehensive data to be Teams are tactically disciplined in investing in development,
collected and analysed by the in different formations which African football would grow
team of experts comprising shows the evolution of the even stronger and Africa would
of data analysts, technical African game. This tournament produce world-class players
directors, former footballers has over-delivered, it has without relying too much on
and coaches. exceeded expectations.” players abroad.  Members of CAF Technical Study Group
SPORT
REPORT
Thursday, February 8, 2024
Rajab 27, 1445 AH www.dailytrust.com
N250
Vol. 60, No. 15
Halep doping ban
appeal begins in

[ [
an allegation of it. People intervene in rare
with cases.
top sports court
LINE OF SIGHT Abubakar Adam Ibrahim It is remarkable, though, that in this
age, lynchings have remained popular in
abubakaradam@dailytrust.com Nigeria. While one could draw corollaries
Twitter: @Abbakar_himself between the act and the savagery of
the actors, it would be disingenuous to

How the bystander effect is overlook the failure of the justice system
as an enabler of these crimes. Make no

killing Nigeria
mistake, lynchings are crimes. But how
often have reports of lynchings included
the presence of police officers at the scene,

I
have recently found myself reminiscing A random woman would have wrapped floating about to see what was about to
about an incident I witnessed on the an arm around her shoulders and told happen before melting away. Through
New York subway in the summer of her, “Oya, e don do. No cry, eh!” Someone these appearances and disappearances,
2018. This reminiscence was triggered by would have offered to pray for her. If they relinquish the state’s monopoly  Simona Halep

T
a conversation with one of my doctoral there is anything you can give Nigerians on violence, which conflict theorists he top court in global sport began
professors about the crazy things he too credit for, it is that it used to be incredibly argue is essential for state-building, and hearing former Wimbledon
had witnessed on the same subway while hard to be lonely in this country. Used to. democratise carnage. Violence is the one and French Open champion
he lived and worked in the Big Apple. New People looked out for each other. Strangers thing you don’t want to democratise. The Simona Halep’s appeal against a doping
York is crazy, but the drama on that subway would knock or salaam at your door, and premise for lynching in the first instance is suspension that could end her career.
is on a completely different level. you would offer them water. In the past, the mistrust of law enforcement because of The 32-year-old Romanian arrived
So, what happened that day? Well, I was especially in the North, people would the habitual collusion between lawmen and yesterday at the Court of Arbitration for
on the train. I don’t remember the specific spread out their dinner on their house lawbreakers. Sport (CAS) in Lausanne for three-day
route, but that detail is of no relevance to façade so passers-by could join them for a But lynching aside, we have often seen proceedings that she hopes will see her
the story. I had been in meetings most of meal. When your neighbours noticed the people in pain due to ill health allowed to provisional suspension lifted.
the day and felt like standing. There were absence of smoke in your kitchen and the roll in the dust and die from their pains, or Halep has been provisionally
other passengers on the train, and one non-rattling of pots and pans, they would the numerous times people whip out their suspended since October 2022 after
of them was a young woman sitting and knock on your door with a bowl of food, a phones to record the slow and agonising testing positive for roxadustat, a banned
typing enthusiastically into her phone. She smile, and a joke. death of an accident victim. Bystander drug that stimulates the production of
seemed to be smiling one moment and effect. red blood cells, at the US Open that year.
then, without warning or even a preamble, Driving on the Abuja-Keffi expressway, Tennis anti-doping authorities also
she started weeping, heaving with such The bystander effect, I once came upon an accident where a car charged Halep with another doping
heartfelt hurt. I was almost convinced, had burst a tyre, lost control and severed
the leg of a Gala hawker standing in the
offence last year due to irregularities in
her athlete biological passport (ABP).
My natural inclination was to ask
what happened, if she needed help. But was not a Nigerian raised street median. I parked and got out,
I noticed that the other passengers in the problem. That was until I and there was the boy, moaning in pain, Brentford condemn
train, mostly males, had pretended as if realised that the premises his foot cut clean by the car’s hubcap, lying
they hadn’t noticed. It was impossible to
miss because this was no silent cry. They
of my assumptions are
among the scattered Gala on the street. The
police were already there, three of them.
‘vile’ online racist
looked into their phones or at the walls of isolated and nostalgic. One stood some distance away from the
abuse of Toney
the train, or out the window into the dark And instances of this boy, directing traffic away from the foot;
the other two stood over the offending
and dank underbelly of this city. Anywhere
but at this girl. Hesitation crept into my
scenario, maybe even car, whose driver had slunk away into the
mind. If the locals are turning away, what worse, started flooding night. What were they waiting for? For
am I, a stranger in this weird and bizarre my mind of an afflicted the driver to return. Since the police were
city, supposed to do? Is there a cultural cue man, struck by an illness, there, I believed the boy would be taken
care of and proceeded on my journey.
I am missing or misreading? Besides, it was
the era of #MeToo, and I feared my good falling to the ground in The next day, upon my return, I stopped
intentions could be misconstrued. When pain at the scene to inquire about the victim and
I reached my stop, I wondered if I should was informed that he was not taken to the
have said something to her, something to The bystander effect, I was almost hospital until almost two hours after the
soothe or assure her, but I couldn’t. Long convinced, was not a Nigerian problem. incident. The police waited for the driver
after the train zipped away, I wondered if That was until I realised that the premises of who never showed up, and, in the end,
 Ivan Toney
I had just been foolish or overly cautious. my assumptions are isolated and nostalgic. the other hawkers carried the victim on

B
rentford have condemned the
I have never forgotten that non- And instances of this scenario, maybe even their backs to a nearby hospital. The police
“vile harassment” of Ivan Toney
encounter and the impressions it made on worse, started flooding my mind of an looked away.
after the England striker was the
me. The realisation of how lonely people afflicted man, struck by an illness, falling And here is the point of this column:
target of online racist abuse, labelling
can feel in the midst of a crowd, in the heart to the ground in pain. Unlike in these in a way, there is no country more greatly
the response of social media companies
of a bustling city like New York, struck me cities where people turned their faces away afflicted by the bystander effect than
“underwhelming”.
with unwavering clarity. and walked past, Nigerians would crowd Nigeria. Nigeria is that boy with a severed
Toney, 27, has previously received
Today, quite by accident, I came across around the victim to watch. Some would leg, rolling in the median, surrounded by
racist comments on Instagram posts
the name of this phenomenon where a mumble “Allah ya kyauta.” On occasions, a dozen people, including police officers,
and Brentford are now calling for more
suffering person or someone being mugged a courageous person would intervene. waiting for someone to help, to lift a finger,
to be done after another case occurred.
or victimised in the midst of a crowd is Of course, one cannot overlook how to do something, the right thing. In our
“We are angered and frustrated
often ignored. The Bystander Effect it is authorities have disincentivised helping thrill, we do not realise that we are one
to report that Ivan Toney has been
called. I became fascinated by this theory by promptly turning accusatory lenses on with the boy and the boy is part of us. In
subjected to racist abuse on Instagram
and its implications for our humanity. the helper who brings an accident or crime the end, we are all bystanders watching the
once more,” the Premier League club
I have been thinking a lot about my victim to a hospital or how they stress your country bleed out from corruption, from
said in a statement yesterday.
country, Nigeria, recently in the midst of life for it. mismanagement, from insecurity, and all
“We have initiated investigations into
economic gloom and a security quagmire, In 2014, SB Morgen Intelligence the things afflicting this nation. Even when
this vile harassment, which we condemn
while looking for positive things to say and said that 43 per cent of Nigerians have we agree that something needs to be done,
in the strongest terms.
write about it. I know that if this scenario witnessed lynchings. Every time videos of we cannot agree on what should be done or
Brentford called for prompt
had played out on the Mararaba-Berger lynchings have trended, they would always how. So, we stand, or whip out our phones
investigations and criminal
Bus or the Kaduna-Abuja train, someone feature dozens of bystanders watching the to record the life force, drain from our
prosecutions.
would have asked, “Sista, wetin happen?” spectacle of a brutal killing for a crime or beloved country into the dust.
NEWSROOM 08077383812
Printed and published by Media Trust Limited. Corporate Office: 20 P.O.W Mafemi Crescent, off Solomon Lar Way, Utako District, Abuja. Tel: 09033477994. ADVERT 08100491948
Lagos office:10 Acme Road, (Textile Labour House), Agidingbi - Ikeja, Tel: 09033103802. Kaduna Office: Abdussalam Ziza House, A9 Mogadishu City Center, 07035134441
Kaduna. Tel: 09033044691. Kano Regional Office: Plot 56 behind Kano International Trade Fair complex, off Zoo Road, P.O Box 2277, Kano. Tel: 09033442116. MARKETING 08037873505 - Abuja
Port Harcourt Office: No. 50 Ikwerre Road Mile 1 Diobu, Beside Diamond Bank, Port Harcourt. All correspondence to P.O Box 6873, Wuse, Abuja. 08065495196 - Kano
email: news@dailytrust.com A member of the Newspaper Proprietors’ Association of Nigeria. ISSN119-1732 08032114748 - Lagos

You might also like