Professional Documents
Culture Documents
Chapter 3
Chapter 3
Chapter 3
net/publication/378877536
CITATIONS READS
0 71
3 authors, including:
Shalini Mohan
Kalasalingam University
12 PUBLICATIONS 9 CITATIONS
SEE PROFILE
All content following this page was uploaded by Sheik Asraf S. on 12 March 2024.
CHAPTER 3
Artificial Intelligence and Bioinformatics Promise
Smart and Secure Healthcare: A COVID-19
Perspective
S. Sheik Asraf1,*, Jins K. Abraham1 and Shalini Mohan1
1
Department of Biotechnology, School of Bio, Chemical and Processing Engineering,
Kalasalingam Academy of Research and Education (deemed to be) University, Anand Nagar,
Krishnankoil, Tamil Nadu, India
Arvind K. Sharma, Dalip Kamboj, Savita Wadhawan, Gousia Habib, Samiya Khan and Valentina Emilia Balas
(Eds.)
All rights reserved-© 2024 Bentham Science Publishers
Bioinformatics Promise Smart Advances in Computing Communications and Informatics, Vol. 7 51
and medical data to enable personalized treatment. After analyzing the complete
human genome sequences, researchers can explore online biological databases
and utilize the knowledge in their medical practices. The healthcare industry will
be able to improve practice guidelines by making better use of the enormous
amount of biological data generated by these tools [11]. Here are some
perspectives on how bioinformatics is impacting healthcare. Cancer diagnosis and
prognosis are significantly impacted by computational approaches like Bayesian
networks, incoherent rationality, ANN, genetic algorithms, data mining, ML, etc
[12].
Role of Artificial Intelligence in Healthcare
AI and bioinformatics may hold great promise for use in the healthcare industry,
according to a recent report [13]. The informatics methods used in the virtual
branch range from active physician treatment assistance to deep learning
information management. The best example of the physical branch is a robot that
assists an old patient or a surgeon in the operating room. Additional consideration,
proof of their medical utility, economic worth, and societal worth are required
before they are widely deployed [14]. One early possibility for AI technology is in
the healthcare industry, where it could be used to improve patientcare and reduce
costs [15]. There is a need for sophisticated human-machine interaction. The
ability of medical practitioners to effectively use new medical information in
practice will depend on technology like AI. The new technology, its advantages
and drawbacks must be effectively explained to medical practitioners [16]. AI
aims to imitate cognitive processes in humans and can analyze many kinds of
healthcare data. Processing for unstructured data and structured data involves the
use of NLP and ML. Three significant illness areas that employ AI technologies
are cancer, neurology, and cardiology [17]. As healthcare data becomes more
widely available and analysis techniques advance quickly, it is providing a new
approach to healthcare. The most revolutionary technology of the twenty-first
century, AI has been considered as a promising early prospect to revolutionize the
healthcare industry [18]. There is a lot of anticipation that AI may soon
outperform humans in the healthcare industry. Better disease prevention,
detection, diagnosis, and treatment might be made possible by AI. Malignancy,
nervous system-related diseases, circulatory system-related diseases, and diabetes
are the major diseases for which AI tools are used. As AI has improved human
lives in numerous ways, it is becoming a well-known discipline in computer
science [19]. In the field of cancer research, AI algorithms now execute at an
expert level. Only a small number of AI-based apps have been approved for usage
in actual settings [20]. Massive amounts of recently made data offer a chance to
use AI and ML to advance the field of drug safety science [21]. Big data is
frequently used in many applications using deep machine learning and AI. For
54 Advances in Computing Communications and Informatics, Vol. 7 Asraf et al.
Numerous studies on the viral ecology in bats conducted up until this point have
shown that the animals are home to thousands of viral species from at least 28
families. The ability of the virus to remain in bat cells bat immunological
responses, and bat resistance factors are only a few of the distinctive
characteristics of bats that make them a special viral host. The potential for
diversity in viral niches is increased by the diversity of bats. Bats are frequently
utilized as model systems to quantify viral diversity since they have more
zoonotic viral infections per species than rodents do. The enhanced developments
in metagenomics research have provided a wealth of knowledge on the bat
virome.
Bioinformatics Study of SARS-COV-2
One of the most vital tools for sequence annotation of SARS-COV-2 is pairwise
sequence alignment. To match sequences end to end and find the best score,
global alignment is used. The global alignment method is the Needleman-Wunsch
algorithm. The Smith-Waterman technique is used for local alignment to find the
conserved areas between the sequences. The conserved sequence pattern of
SARS-COV-2 that can result from evolution or ancestry relationships can be
discovered utilizing multiple sequence alignment. The development of
phylogenetic trees could be used to analyze the evolutionary and taxonomic links
of SARS-COV-2 between organisms. Additionally, the pattern and process of
evolutionary changes may be shown through phylogenetic analysis of RNA
viruses like SARS-COV-2. The distribution of mutations and their co-occurrence
could be further examined to better understand the SARS-COV-2 viral evolution.
ARTIFICIAL INTELLIGENCE AND BIOINFORMATICS PROMISE
SMART AND SECURE HEALTHCARE AMIDST COVID-19 OUTBREAK
The number of COVID-19 infection-related fatalities has been rising rapidly day
after day, prompting numerous countries to take action to stop the sickness from
spreading. There is a global health and healthcare crisis due to COVID-19.
Rapidly identifying and monitoring patients so that decisions about their care,
monitoring, and management may be made promptly is one of the biggest issues
[36]. SARS-CoV-2 was the primary cause of the first significant outbreak in the
modern time. Computational methods have been widely used to handle the
resulting global health catastrophe [37]. The pandemic of COVID-19 has
illustrated the need for international cooperation and consensual decisions to solve
the most serious issues and dangers to humanity. One of the most difficult
elements of accessing and sharing the full and accurate clinical data collected by
Electronic Health Records is doing so despite its crucial relevance [38]. The
diagnosis of COVID-19 primarily depends on MRI and other cutting-edge
Bioinformatics Promise Smart Advances in Computing Communications and Informatics, Vol. 7 57
Global and Local Pairwise Alignment of the Genomes of SARS-CoV2 and the
Study Species from Bat Virome
The genome and the RNA-dependent RNA polymerase sequences of SARS-CoV2
and the study species were obtained from the NCBI database for genome and
protein respectively. Both the genome and protein sequences were downloaded in
FASTA format. Sequence alignments including both the pairwise and multiple
sequence analysis were performed using Emboss Needle (for global
alignment), Emboss Water (for local alignment), and Clustal Omega (for multiple
sequence alignment) with the default parameters. The results of the global and
pairwise sequence alignments are given as follows (Table 2).
Table 2. Global and local pairwise alignment of the genomes of SARS-CoV2 and the study species from
bat virome.
JAPANESE 23 38.1
% SIMILARITY
Global alignment Local alignment
Fig. (1). Global and local pairwise alignment of SARS-CoV2 and the study species from bat virome.
60 Advances in Computing Communications and Informatics, Vol. 7 Asraf et al.
The sequence alignment was performed with online tools using the Needle-
Wunsch and Smith-Waterman algorithm with an emphasis on AI. These
algorithms could enhance the sequence alignment with increased computational
speed. Online tools like EMBOSS-NEEDLE and EMBOSS-WATER were used
for global and local alignment of the bat virome and SARS-CoV2.
A comparison of the viral species present in the bat virome with the SARS-CoV2
virus, which is responsible for the COVID-19 pandemic, is necessary because bats
are also a potential natural reservoir host of many viral species and there are
numerous indications that there could be many viral spillovers from bats. The
examination of the SARS-CoV2 genome and proteome, as well as that of other
viral species from the bat virome, is the main emphasis of this study. Bat
coronaviruses exhibited a higher degree of similarity to SARS-CoV2 than other
species, according to pairwise sequence alignment of the genomes and proteomes
of SARS-CoV2 and a few research species (Table 2, Fig. 1). From Table 2 and
Fig. 1, it is found that Bat coronavirus and SARS-CoV2 had more sequence
similarity of genome compared to other viral study species.
Phylogenetic Tree Analysis
The evolutionary analysis of the genome and protein sequences was performed
using MegaX software by constructing a phylogenetic tree using the neighbor-
joining method with 500 bootstrapping. The phylogenetic tree constructed for the
genomes of SARS-COV2 and the study species from bat virome with 500
bootstrapping is as follows (Fig. 2). The genomes of SARS-COV2, Hepatitis E
Virus, Bat Astrovirus, and RdRp Sequences of SARS-COV2 and Human
Enterovirus are more evolutionarily related, according to phylogenetic research.
The viral proteome’s NSP 12 is the RNA-dependent RNA polymerase. The
structure has a right-hand RdRp domain, an N-terminal domain that is unique to
nidoviruses, and it frequently forms a complex with other proteins. Since
replication and transcription of this molecule can be blocked, it may be utilized as
a possible therapeutic target to stop the spread of RNA viruses. From Fig. (2), it is
observed that the genome of SARS-CoV2 is more related to the genomes of
Hepatitis E virus and Astrovirus.
From the global and local alignment of the SARS-CoV2 genome, it was found
that the bat coronavirus had increased similarity compared to other viruses in the
bat virome. In the viruses considered, the similarity in local alignment is more
compared to global alignment showing the presence of coding regions in the
genome dispersedly.
Bioinformatics Promise Smart Advances in Computing Communications and Informatics, Vol. 7 61
Fig. (2). Neighbor-joining phylogenetic tree of the genomes of SARS-CoV2 and the viral study species with
500 bootstrapping.
Table 3. Global and local pairwise alignment of the genomes of SARS-CoV2 and the study species from
bat virome.
Fig. (3). Global/local alignment of the RNA depend., RNA polymerase seq., of SARS-CoV2.
the connections between SARS-COV2 and the viral research species from bat
virome, recombination experiments could be carried out. The multiple sequence
alignments of RdRp sequences of SARS-CoV2 and the study species from bat
virome had the conserved amino acids.
Fig. (4). Multiple sequence alignment of RNA dependent RNA polymerase seq., of SARS-CoV2.
SARS-COV-2 A ADPAMHA SGT LLD 393 SARS-COV-2 RYNLPTMCDIRQLLFIWEV VDKY FDCYD 487
Coronavirus 0 Coronavirus 0
Enterovirus 0 Enterovirus 0
Parechovirus K SDPRLE 46 Parechovirus FREIFGINGI VDM K 96
Astrovirus 8 Astrovirus 30
Norovirus 0 Norovirus 0
Yellow GSQEAEFTGYGRATLECQVQTAVDF SNT IAEMEKESWIVOKQWAQDLTLP 501 Yellow PEDPVKLASIVKAS LEGKCGLNSVDSL EHEMWRSRADEINAILEENE 861
Dengue 0 Dengue 0
Japanese 0 Japanese 0
Zika 0
Zika 0 West 0
West 0 Hepatitis 0
Hepatitis 0 Chikungunya 0
Chikungunya 0 Eastern MCLKV HEICTEVYHKSISRRCTKTVTAIVSTLFYDKRMRTVNPCSD 870
Eastern P--APIITEADVAHLKGMQEEAEAVAEAEAVRA LP LPEVERETV EADIDLI 527 Western MCLKVHDICTEVYHKSISRRCTQTVTAIVSTLFYDKRMKTVNPCAD 870
Western P--APAITHADVEHLRGLOQEAEEVAAEEIRE LPS LPEIEKETV EAEVDLI 527 Venezuelan MCLKV HEICTQVFHKSISRRCTKSVTSVVSTLFYDKKMRTTNPKET 872
Venezuelan P--SPLITAEDVQEAKCAADEAKEVREAEELRA LP AADVEEPTL EADVDLM 529 Babanki 0
Babanki 0 Sindbis 0
Sindbis 0
SARS-COV-2 YPKCORAMPNMLRIMA SLVLARKHTTC 648
SARS-COV-2 NWAFQT 413 Coronavirus CORALPNMIRMIS AMILGSKHVTC 24
Coronavirus 0 Enterovirus YSGYDASLSPVWFRAL E LV L R E I 77
Enterovirus 0 Parechovirus YSQYDGSLSSMLLWEA VEVLAYCH 264
Parechovirus 58 Astrovirus 30
Astrovirus 25
Norovirus Norovirus 0
0
Yellow APCRIPVNVADOLTA AVNKGILV TVNPIASTNDDEVLIEVNPPFGDSYI 663
Yellow YKECEWPLTHTIGTSVEESDMFMPRSIGGPVSSHNHIP GYKVQTNGPWMQVPLEVKREAC 1058
Dengue 0 Dengue 0
Japanese 0 Japanese 0
Zika 0 Zika 0
West 0 West 0
Hepatitis 0
Chikungunya
Hepatitis 0
0
Eastern TAIPIPDFQALSESATIVYNERE FUNRYLHHIAINGGAINTDEEY YKV 656
Chikungunya 0
Western TAVPVQOFQALSESATIVFNEREFVNRYLHHIAINGGALNTDEEY YKT 656 Eastern YP GEFSATLEEWQAEHDAIMERILETPASSDV YQNKVRVCWAKALEPVLATAN 1023
Venezuelan HAIPVQOFQALSESATIVYNEREFVNRYLHHIATHGGALNTDEEY YKT 658 Western YS GDFTASLDDWQREHDAIMARVLDKPQTADV FQNKVNVCWAKALEPVLATAN 1023
Babanki 0 Venezuelan YP GNFTATIEEWQAEHDAIMRHILERPDPTDV FQNKANVCWAKALVPVLKTAG 1025
Sindbis 0 Babanki 0
Sindbis 0
Fig. (5). Multiple sequence alignment of RNA-dependent RNA polymerase seq.,of SARS-CoV2.
From Fig. (4 and 5), the conserved regions in the protein sequence could be found
and were represented by highlighting them in red color.
64 Advances in Computing Communications and Informatics, Vol. 7 Asraf et al.
Phylogenetic Analysis
The phylogenetic tree constructed for the RNA-dependent RNA polymerase
sequences of SARS-CoV2 and the study species from bat virome with 500
bootstrapping is shown in Fig. (6).
Fig. (6). Neighbor-joining phylogenetic tree of the RNA-dependent RNA polymerase sequences of SARS-
CoV2 and the viral study species with 500 bootstrapping.
From the global and local alignment of the RNA-dependent RNA polymerase of
the SARS-CoV2, it was found that the similarity in local alignment is more
compared to global alignment showing the presence of coding region in the
genome dispersedly. Among the study viruses, bat coronavirus and hepatitis E
virus had increased similarity upon aligning locally showing the dominance of the
RNA-dependent RNA polymerase region in the genes of other viruses.
From Fig. (6), it is observed that the RdRp sequences of SARS-CoV2 and
Enterovirus are more related compared to other study strains. The genome of
SARS-CoV2 shows increased similarity with Bat coronavirus compared to other
study species. The genome of SARS-CoV2 seems to be closely related to the
Hepatitis E virus and Bat astrovirus. The RdRp of SARS-CoV2 was more similar
to Bat coronavirus compared to other study species. The phylogenetic analysis of
the RdRp of SARS-COV2 revealed that SARS-CoV2 was closely related to
Enterovirus. From the multiple sequence alignment of the RdRp, it was found that
Asp760, Asp761, and Phe812 in the active site were conserved in almost half of
the study species. Hence the conserved regions of the RdRp could be analyzed for
characteristics of a potential drug target.
Bioinformatics Promise Smart Advances in Computing Communications and Informatics, Vol. 7 65
analytics: An imperative for improved healthcare system", Int. J. Appl. Inf. Syst., vol. 8, no. 5, pp. 1-6,
2015.
[http://dx.doi.org/10.5120/ijais15-451318]
[10] A. Al Kawam, A. Sen, A. Datta, and N. Dickey, "Understanding the bioinformatics challenges of
integrating genomics into healthcare", IEEE J. Biomed. Health Inform., vol. 22, no. 5, pp. 1672-1683,
2018.
[http://dx.doi.org/10.1109/JBHI.2017.2778263] [PMID: 29990071]
[11] P.L. Chang, "Clinical bioinformatics", Chang Gung Med. J., vol. 28, no. 4, pp. 201-211, 2005.
[PMID: 16013339]
[12] A. Beg, and R. Parveen, "Role of bioinformatics in cancer research and drug development", In:
Translational bioinformatics in healthcare and medicine Academic Press, 2021, pp. 141-148.
[13] L.I.T. Lee, S. Kanthasamy, R.S. Ayyalaraju, and R. Ganatra, "The current state of artificial
intelligence in medical imaging and nuclear medicine", BJR|Open, vol. 1, no. 1, p. 20190037, 2019.
[http://dx.doi.org/10.1259/bjro.20190037] [PMID: 33178956]
[14] P. Hamet, and J. Tremblay, "Artificial intelligence in medicine", Metabolism, vol. 69, pp. S36-S40,
2017.
[http://dx.doi.org/10.1016/j.metabol.2017.01.011] [PMID: 28126242]
[15] D. Schonberger, "Artificial intelligence in healthcare: a critical analysis of the legal and ethical
implications", Int. J. Law Inf. Technol., vol. 27, no. 2, pp. 171-203, 2019.
[16] K. Paranjape, M. Schinkel, R. Nannan Panday, J. Car, and P. Nanayakkara, "Introducing artificial
intelligence training in medical education", JMIR Med. Educ., vol. 5, no. 2, p. e16048, 2019.
[http://dx.doi.org/10.2196/16048] [PMID: 31793895]
[17] F. Jiang, Y. Jiang, H. Zhi, Y. Dong, H. Li, S. Ma, Y. Wang, Q. Dong, H. Shen, and Y. Wang,
"Artificial intelligence in healthcare: Past, present and future", Stroke Vasc. Neurol., vol. 2, no. 4, pp.
230-243, 2017.
[http://dx.doi.org/10.1136/svn-2017-000101] [PMID: 29507784]
[18] G.V.K.S. Abhinav, and S. Naga Subrahmanyam, "Artificial intelligence in healthcare", J. Drug Deliv.
Ther., vol. 9, no. 5-s, pp. 164-166, 2019.
[http://dx.doi.org/10.22270/jddt.v9i5-s.3634]
[19] N. Murali, and N. Sivakumaran, "Artificial intelligence in healthcare : A review (2018)",
[20] W. Shao, J. Cheng, L. Sun, Z. Han, Q. Feng, D. Zhang, and K. Huang, "Ordinal multi-modal feature
selection for survival analysis of early-stage renal cancer", International Conference on Medical
Image Computing and Computer-Assisted Intervention, 2018pp. 648-656
[http://dx.doi.org/10.1007/978-3-030-00934-2_72]
[21] A.O. Basile, A. Yahi, and N.P. Tatonetti, "Artificial intelligence for drug toxicity and safety", Trends
Pharmacol. Sci., vol. 40, no. 9, pp. 624-635, 2019.
[http://dx.doi.org/10.1016/j.tips.2019.07.005] [PMID: 31383376]
[22] G. Yang, H. Zhang, D. Firmin, and S. Li, "Recent advances in artificial intelligence for cardiac
imaging", Computerized medical imaging and graphics: the official journal of the Computerized
Medical Imaging Society, vol. 90, p. 101928, 2021.
[23] M. Chen, and M. Decary, "Artificial intelligence in healthcare: An essential guide for health leaders",
Healthc. Manage. Forum, vol. 33, no. 1, pp. 10-18, 2020.
[http://dx.doi.org/10.1177/0840470419873123] [PMID: 31550922]
[24] R. Manne, and S.C. Kantheti, "Application of artificial intelligence in healthcare: Chances and
challenges", Curr. J. Appl. Sci. Technol., vol. 40, no. 6, pp. 78-89, 2021.
[http://dx.doi.org/10.9734/cjast/2021/v40i631320]
[25] S. Ellahham, N. Ellahham, and M.C.E. Simsekler, "Application of artificial intelligence in the health
Bioinformatics Promise Smart Advances in Computing Communications and Informatics, Vol. 7 67
care safety context: Opportunities and challenges", Am. J. Med. Qual., vol. 35, no. 4, pp. 341-348,
2020.
[http://dx.doi.org/10.1177/1062860619878515] [PMID: 31581790]
[26] T. Davenport, and R. Kalakota, "The potential for artificial intelligence in healthcare", Future Healthc.
J., vol. 6, no. 2, pp. 94-98, 2019.
[http://dx.doi.org/10.7861/futurehosp.6-2-94] [PMID: 31363513]
[27] D. Khanna, "Use of artificial intelligence in healthcare and medicine", Int. J. innov. Eng. Res. technol.,
2018.
[28] S.H. Khan, "Artificial intelligence in healthcare setups: Pros and cons and way for ward to manage",
Pak. Armed Forces Med. J., no. 2, p. 634, 2020.
[29] Z. Dlamini, F.Z. Francies, R. Hull, and R. Marima, "Artificial intelligence (AI) and big data in cancer
and precision oncology", Comput. Struct. Biotechnol. J., vol. 18, pp. 2300-2311, 2020.
[http://dx.doi.org/10.1016/j.csbj.2020.08.019] [PMID: 32994889]
[30] M.J. Iqbal, Z. Javed, H. Sadia, I.A. Qureshi, A. Irshad, R. Ahmed, K. Malik, S. Raza, A. Abbas, R.
Pezzani, and J. Sharifi-Rad, "Clinical applications of artificial intelligence and machine learning in
cancer diagnosis: Looking into the future", Cancer Cell Int., vol. 21, no. 1, p. 270, 2021.
[http://dx.doi.org/10.1186/s12935-021-01981-1] [PMID: 34020642]
[31] Y. Xin, W. Man, and Z. Yi, "The development trend of artificial intelligence in medical: A
patentometric analysis", Artif. Intell. Life. Sci., vol. 1, p. 100006, 2021.
[http://dx.doi.org/10.1016/j.ailsci.2021.100006]
[32] R.R. Ray, Z. Agar, P. Dutta, S. Ganguly, P. Sah, and D. Roy, "MenGO: A novel cloud-based digital
healthcare platform for andrology powered by artificial intelligence, data science & analytics, bio-
informatics and blockchain", Biomed. Sci. Instrum., vol. 57, no. 4, pp. 476-485, 2021.
[http://dx.doi.org/10.34107/KSZV7781.10476]
[33] F. Chiappelli, N. Balenton, and A. Khakshooy, "Future innovations in viral immune surveillance: a
novel place for bioinformation and artificial intelligence in the administration of health care",
Bioinformation, vol. 14, no. 5, pp. 201-205, 2018.
[http://dx.doi.org/10.6026/97320630014201] [PMID: 30108416]
[34] R.D. Bülow, D. Dimitrov, P. Boor, and J. Saez-Rodriguez, "How will artificial intelligence and
bioinformatics change our understanding of IgA Nephropathy in the next decade?", Semin.
Immunopathol., vol. 43, no. 5, pp. 739-752, 2021.
[http://dx.doi.org/10.1007/s00281-021-00847-y] [PMID: 33835214]
[35] Z. Ahmed, K. Mohamed, S. Zeeshan, and X. Dong, "Artificial intelligence with multi-functional
machine learning platform development for better healthcare and precision medicine", Database, vol.
2020, p. baaa010, 2020.
[http://dx.doi.org/10.1093/database/baaa010] [PMID: 32185396]
[36] A. Sharma, S. Rani, and D. Gupta, "Artificial intelligence-based classification of chest X-ray images
into COVID-19 and other infectious diseases", Int. J. Biomed. Imaging, vol. 2020, pp. 1-10, 2020.
[http://dx.doi.org/10.1155/2020/8889023] [PMID: 33061946]
[37] F. Napolitano, X. Xu, and X. Gao, "Impact of computational approaches in the fight against COVID-
19: an AI guided review of 17000 studies", Brief. Bioinform., vol. 23, no. 1, p. bbab456, 2022.
[http://dx.doi.org/10.1093/bib/bbab456] [PMID: 34788381]
[38] A. Dagliati, A. Malovini, V. Tibollo, and R. Bellazzi, "Health informatics and EHR to support clinical
research in the COVID-19 pandemic: An overview", Brief. Bioinform., vol. 22, no. 2, pp. 812-822,
2021.
[http://dx.doi.org/10.1093/bib/bbaa418] [PMID: 33454728]
[39] A. Sharma, P. Singh, and G. Dar, "Artificial intelligence and machine learning for healthcare
solutions", Data Analytics in Bioinformatics: A Machine Learning Perspective, pp. 281-291, 2021.
68 Advances in Computing Communications and Informatics, Vol. 7 Asraf et al.
[40] A.K. Kaushik, J.S. Dhau, H. Gohel, Y.K. Mishra, B. Kateb, N.Y. Kim, and D.Y. Goswami,
"Electrochemical SARS-CoV-2 sensing at point-of-care and artificial intelligence for intelligent
COVID-19 management", ACS Appl. Bio Mater., vol. 3, no. 11, pp. 7306-7325, 2020.
[http://dx.doi.org/10.1021/acsabm.0c01004] [PMID: 35019473]
[41] V.V. Khanna, K. Chadaga, N. Sampathila, S. Prabhu, R. Chadaga, and S. Umakanth, "Diagnosing
COVID-19 using artificial intelligence: A comprehensive review", Netw. Model. Anal. Health Inform.
Bioinform., vol. 11, no. 1, p. 25, 2022.
[http://dx.doi.org/10.1007/s13721-022-00367-1] [PMID: 34849327]
[42] N. Noorbakhsh-Sabet, R. Zand, Y. Zhang, and V. Abedi, "Artificial intelligence transforms the future
of health care", Am. J. Med., vol. 132, no. 7, pp. 795-801, 2019.
[http://dx.doi.org/10.1016/j.amjmed.2019.01.017] [PMID: 30710543]
[43] S. Gaikwad, "Study on artificial intelligence in healthcare", 2021 7th International Conference on
Advanced Computing and Communication Systems (ICACCS), Vol. 1, pp. 1165-1169, 2021.
[44] Z.S.Y. Wong, J. Zhou, and Q. Zhang, "Artificial intelligence for infectious disease big data analytics",
Infect. Dis. Health, vol. 24, no. 1, pp. 44-48, 2019.
[http://dx.doi.org/10.1016/j.idh.2018.10.002] [PMID: 30541697]