Dear Sirs,

Having read, understood and agreed to the contents and terms and conditions of Indian Railway Finance Corporation Limited's Shelf andTranche-1 Prospectus dated January 19, 2012, ("Prospectus") I/We hereby apply for allotment to me/us; of the under mentioned Bonds out of the Issue. The amount payable on application for the belowmentioned
Bonds is remitted herewith. I/We hereby agree to accept the Bonds applied for or such lesser number as may be allotted to me/us in accordance with the contents of the Prospectus subject to applicable statutory and/or regulatory requirements. I/We irrevocably give my/our authority and consent to Indian Bank to act as my/our trustees and for doing such
acts and signing such documents as are necessary to carry out their duties in such capacity. I/We acknowledge that the Applications made by me/us do not exceed the investment limit on the maximum number of Series Bonds which may be held by me/us under applicable statutory and /or regulatory requirements. By making this application, I/We
acknowledge that I/We have understood the terms and conditions of the Tranche-1 issue of Series Bonds of the Company as disclosed in the Prospectus. Notwithstanding anything contained in this form and the attachments hereto, by making this application: In case of applicants other than NRIs: I/We confirm that I am/We are Indian
National(s)/registered in India, resident in India and I am/ we are not applying for the said Bonds as nominee(s) of any person resident outside India and/or Foreign National(s). In case of NRI applicants: I/we confirmthat I am/ we are a NRI(s) as per Foreign Exchange Management Act, 1999, as amended and rules, regulations, notifications and circulars
issued, and I am/ we are not applying for the said Bonds as nominee(s) of any person resident outside India (other than an NRI applicant eligible to apply under the Issue) and/or Foreign National(s). Notwithstanding anything contained in this formand the attachments hereto, I/we confirmthat I/we have carefully read and understood the contents, terms
and conditions of the Prospectus, in their entirety and further confirmthat in making my/our investment decision, (i) I/We have relied on my/our own examination of the Company and the terms of the Issue, including the merits and risks involved, (ii) my/our decision to make this application is solely based on the disclosures contained in the Prospectus, (iii)
my/our application for Bonds under the Issue is subject to the applicable statutory and/or regulatory requirements in connection with the subscription to Indian securities by me/us, (iv) In case of applicants other than NRIs: I am/We are not persons resident outside India and/or foreign nationals within the meaning thereof under the Foreign Exchange
Management Act, 1999, as amended and rules, regulations, notifications and circulars issued thereunder; is case of NRI applicants: I am/ We are a NRI(s) within the meaning thereof under the Foreign Exchange Managment Act. 1999, as amended and rules, regulations, notifications and ciruclars issued thereunder and am/are eligible to apply under the
issue and (v) I/We have obtained the necessary statutory and/or regulatory permissions/consents/approvals in connection withapplying for, subscribing to, or seeking allotment of Bonds pursuant to the Issue.
Please Note : Cheque / DDshould be drawn in favour of IRFCTax Free Bonds-EscrowAccount-Tranche I by non-NRI and non-FII applicants and in favour of IRFCTax Free Bonds-NRI EscrowAccount-Tranche I by NRI applicants. Cheques should be crossed A/c Payee only. Please write
the sole/first Applicants name, phone no. and Application no. on the reverse of Cheque/DD. Demographic details for purpose of refunds, if any, shall be taken from (i) Bank details as mentioned above for applicants who select the option to hold he Bonds in Physical Form; or (ii) the records of the
Depositories otherwise.
PUBLICISSUEBYINDIANRAILWAYFINANCECORPORATIONLIMITED(COMPANYORIRFCORISSUER) OFTAXFREE, SECURED, REDEEMABLE, NON-CONVERTIBLEBONDSOF FACEVALUEOF ` 1,000 EACHINTHENATUREOF DEBENTURESHAVINGTAX
BENEFITS UNDER SECTION 10(15)(iv)(h) OFTHE INCOMETAX ACT, 1961, AS AMENDED, (BONDS), AGGREGATING UPTO ` 6,30,000 LAKHS (THEISSUE) INTHE FISCALYEAR 2012 (THESHELF LIMIT). THETRANCHE ISSUE BYTHE ISSUER IS OF BONDS
AGGREGATINGTO` 3,00,000 LAKHSWITHANOPTIONTORETAINOVERSUBSCRIPTIONUPTOTHESHELFLIMIT(I.E. UPTO` 6,30,000 LAKHS) (TRANCHE 1 ISSUE) ANDISBEINGOFFEREDBYWAYOFTHEPROSPECTUSTRANCHE 1 CONTAINING, INTERALIA,
THETERMSANDCONDITIONSOFTHETRANCHE 1 (THEPROSPECTUSTRANCHE 1),WHICHSHOULDBEREADTOGETHERWITHTHESHELF PROSPECTUSDATEDJANUARY19, 2012 FILEDWITHTHEDESIGNATEDSTOCKEXCHANGEANDSEBI.THESHELF
PROSPECTUSTOGETHERWITHTHEPROSPECTUSTRANCHE 1 CONSTITUTESTHEPROSPECTUS.
INDIAN RAILWAY FINANCE CORPORATION LIMITED
A GOVERNMENT OF INDIA ENTERPRISE
I
N
D
I
A
N

R
A
I
L
W
A
Y

F
I
N
A
N
C
E

C
O
R
P
O
R
A
T
I
O
N

L
I
M
I
T
E
D

-

P
U
B
L
I
C

I
S
S
U
E

O
F

T
A
X

F
R
E
E

B
O
N
D
S

-
T
R
A
N
C
H
E

1

I
S
S
U
E
To, The Board of Directors, INDIAN RAILWAY FINANCE CORPORATION LIMITED, UG Floor, East Tower, NBCC Place, Pragati Vihar, Lodhi Road, New Delhi-110 003, India.
APPLICANTS DETAILS (for Applicants applying in Demat Mode name(s) should be in the same order as it appears in the demat account)
CREDIT RATING : CRISIL AAA/Stable (pronounced as "CRISIL Triple A with stable outlook"), [ICRA] AAA (Pronounced as ICRATriple A), CARE AAA (Pronounced as Triple A)
All future communication in connection with this application should be addressed to the Registrar to the
Issue KARVY COMPUTERSHARE PRIVATE LIMITED, Plot No. 17 to 24 Vittal Rao Nagar, Madhapur,
Hyderabad 500 081, Toll Free No.1-800-3454001, Tel: +91 40 4465 5000, Fax: +91 40 2343 1551, E-mail
ID: irfc.bonds@karvy.com, Investor Grievance Email: einward.ris@karvy.com, Website:
http:\\karisma.karvy.com Contact Person: Mr. M. Murali Krishna, SEBI Registration Number:
INR000000221. Please quote full name of Sole/First Applicant, Application No., Type of options applied
for, Number of Bonds applied for, Date, Bank and Branch where the application was submitted and
Cheque/Demand Draft Number and name of the Issuing bank.
Category I - Companies; bodies corporate and societies; Registered trusts; Scientific and/or industrial research organisations; Partnership firms in the name of the partners; Limited liability partnerships
Category II - oResident Indian individuals; oHindu Undivided Families through the Karta; and oNon Resident Indians on repatriation as well as non-repatriation basis (*applying for an amount aggregating to above 5 lakhs across all series in each tranche)
Category III - oResident Indian individuals; oHindu Undivided Families through the Karta; and oNon Resident Indians on repatriation as well as non-repatriation basis (*applying for an amount aggregating to upto and including 5 lakhs )
o o o o o
`
` across all series in each tranche
INDIAN RAILWAY FINANCE CORPORATION LIMITED
(Incorporated on December 12, 1986 in the name of "Indian Railway Finance Corporation Limited" under the CompaniesAct, 1956 ("CompaniesAct") as a public limited company)
RegisteredOffice: UGFloor, East Tower, NBCCPlace, Pragati Vihar, Lodhi Road, NewDelhi-110 003, India. Tel: +91 (11) 2436 9766/69; Fax: +91 (11) 2436 6710
CompanySecretary: Mr SKAjmani, Tel: +91 (11) 2436 9766/69; Fax: +91 (11) 2436 6710
Compliance Officer: Mr. T. Behera, General Manager (Bonds) Tel: +91 (11) 2436 9766/69; Fax: +91 (11) 2436 6710 Website: www.irfc.nic.in; E-mail: gma@irfc.nic.in
A GOVERNMENT OF INDIA ENTERPRISE ISSUE OPENS ON : FRIDAY, JANUARY 27, 2012
ISSUE CLOSES ON : FRIDAY, FEBRUARY 10, 2012^
Lead Managers / Consortium Members
Name & Code
Sub-Consortium Members /
Brokers Name & Code
( Please see General Instructions No. 22 to 34 & 43)
Power of Attorney Partnership Deed PIO Card
General Instruction No. 41 *
The claims of the Bondholders shall be superior to the claims of any unsecured creditors of the Company and subject to
applicable statutory and/or regulatory requirements, rank pari passu inter se to the claims of creditors of the Company
secured against charge on the movable assets comprising of rolling stock such as wagons, locomotives and coaches.
Coupon Rate (%) per annumfor Category I, II and III 8.00% 8.10%
Additional Coupon Rate*** (%) per annum for Category III 0.15% 0.20%
Aggregate Coupon Rate (%) per annum for Category III
At the end of 10 Years from the Deemed Date of Allotment At the end of 15 Years from the Deemed Date of Allotment
8.15% 8.30%
* The Company wouldallot Tranche1 Series II Bonds to all valid applications, wherein the Applicants have not indicated their choice of the relevant series of Bonds in their Application Form.
**For various modes of interest payment, see General Instruction No. 11.
*** For further details, seeTerms of the Issue Interest in General Instruction No. 8.
46.
COMMONTERMSOFTHEISSUE:
MinimumApplicationsize Theminimumnumber of Bondsper applicationformwill becalculatedonthebasisof thetotal number
of Bondsappliedfor under eachsuchApplicationFormand not onthebasisof anyspecificoption.
Ratings CRISIL AAA/Stable (pronounced as "CRISIL Triple A" with stable outlook), [ICRA] AAA
(Pronounced "ICRATriple A") andCAREAAA(Pronounced asTriple A)".
StockExchangesproposedforlisting National Stock Exchange of India Limited and BSELimited
DebentureTrustee Trustee for the Bondholders in this case being Indian Bank
Depositories NSDL and CDSL
Securities The Bonds issued by the Company will be secured by creating a charge on the movable assets of
the Company comprising of rolling stock such as wagons, locomotives and coaches by a first/pari
passu charge, present and future, as may be agreed between the Company and the Debenture
Trustee, pursuant to the terms of the DebentureTrust Deed.
Issuance In dematerialisedformand physical form
Trading In dematerialisedformonly
Market Lot/TradingLot One Bond
DeemedDate of Allotment Deemed Date of Allotment shall be the date on which the Board of Directors/or any committee
thereof approves the Allotment of the Bonds for each Tranche Issue. All benefits relating to the
Bonds including interest on Bonds (as specified for each tranche by way of Tranche Prospectus)
shall be available to the Bondholders fromthe Deemed Date of Allotment. The actual allotment of
Bonds may take place on a date other than the Deemed Date of Allotment.
Submission of Application Forms: All Application Forms duly completed and accompanied by account payee cheques or drafts shall
be submitted to the designated collection banks during the Issue Period. No separate receipts shall be issued for the money payable on
the submission of Application Form. However, the collection banks will acknowledge the receipt of the Application Forms by stamping
and returning to the Applicants the acknowledgement slip. This acknowledgement slip will serve as the duplicate of the Application Form
for the records of the Applicant. Applications shall be deemed to have been received by us only when submitted to Bankers to the Issue at
their designated branches as detailed above and not otherwise.
Additional/Multiple Applications: An applicant is allowed to make one or more applications for the Bonds for the same or other series
of Bonds, subject to a minimumapplication size of 10 Bonds and in multiples of 5 Bonds there after, for each application. Any application
for an amount below the aforesaid minimum application size will be deemed as an invalid application and shall be rejected. For further
details please refer General Instruction No. 49.
Basis of Allotment: I. Applicants belonging to the Category I, in the first instance, will be allocated Bonds upto 45%of the Overall Issue
Size on first come first serve basis (determined on the basis of date of receipt of each application duly acknowledged by the Bankers to
the Issue); ii. Applicants belonging to the Category II, in the first instance, will be allocated Bonds upto 25% of the Overall Issue Size on
first come first serve basis (determined on the basis of date of receipt of each application duly acknowledged by the Bankers to the Issue);
and iii. Applicants belonging to the Category III, in the first instance, will be allocated Bonds upto 30% of the Overall Issue Size on first
come first serve basis (determined on the basis of date of receipt of each application duly acknowledged by the Bankers to the Issue);
Allotments, in consultation with the Designated Stock Exchange, shall be made on a first-come first-serve basis, based on the date of
presentation of each application to the Bankers to the Issue, in each Portion subject to the Allocation Ratio. Minimum allotments of 10
Bonds and in multiples of 1 Bond thereafter would be made in case of each valid application. For further details please refer General
Instruction No. 54.
For additional details, refer General Instruction No. 39)
^The subscription list for the Issue shall remain open for subscription at the commencement of banking hours and close at the close of banking hours, with an option for early closure (subject to the Issue being open for a minimumperiod of 3 days) or extension by such period, upto a period of 30 days fromthe date of opening of
the Issue, as may be decided by the Board of Directors/ Committee of the Company subject to necessary approvals, if any. In the event of such early closure of the subscription list of the Issue, our Company shall ensure that public notice of such early closure is published on or before the day of such early date of closure
through advertisement(s) in a leading national daily newspaper.
(Incorporatedon December 12, 1986 in the name of "Indian Railway Finance CorporationLimited" under the Companies Act, 1956 ("Companies Act") as a public limitedcompany)
RegisteredOffice: UGFloor, East Tower, NBCCPlace, Pragati Vihar, Lodhi Road, NewDelhi-110 003, India.
Tel: +91 (11) 2436 9766/69; Fax: +91 (11) 2436 6710
CompanySecretary: Mr SKAjmani, Tel: +91 (11) 2436 9766/69; Fax: +91 (11) 2436 6710
ComplianceOfficer: Mr. T. Behera, General Manager (Bonds) Tel: +91 (11) 2436 9766/69; Fax: +91 (11) 2436 6710 ;Website: www.irfc.nic.in; E-mail: gma@irfc.nic.in
Relationship, if any, with sole/First Applicant:
AK Stockmart
23/12695-32
KARVY STOCK BROKING LTD
23/07701-38
KARVY STOCK BROKING
LTD
23/07701-38
76356752
76356752
310109
2 INDIAN RAILWAY FINANCE CORPORATION LIMITED
INDIAN RAILWAY FINANCE CORPORATION LIMITED : APPLICATION FORMS AVAILABLE AT FOLLOWING LOCATIONS
LEAD MANAGERS TO THE ISSUE / CONSORTIUM MEMBERS TO THE ISSUE
SBICAP SECURITIES LIMITED
Agra: Bajaj Capital Ltd Shop No. 110, Ground Floor, Block No. 27/2/4, Sanjay Palace, Near Hotel Panchrattan,282002,6457307. Kotak Securities Ltd 2/220, GloryPlaza, Suer Sadan Crossing, M.G Road,5538760. RR Equity Brokers Private Ltd 9, Sbi Colony, 1st Floor, Opp. Subhash Park, M.G.Road,282002,9319087289. SBICAP Securities Ltd C/O Sbi Main Branch, Chipitola,282001,2252079.Ahmedabad: Bajaj Capital Ltd 2-
L, Akik OppLions Hall, Mithakhali Six Raod, Near Nalanda Hotel, Ellisbridge,380006,64500171. Eureka Stock & Share Broking Services Ltd. Shiwalik Corporate Park,B-Block,R.No.405-A,Near 10-C,Petrol Pump,Shivrangani Cross Road, Satellite,380015,9428792938. IDBI Capital Market Services Ltd 314, 3rd Floor Crystal Arcade, Beside Bsnl Complex, Near Girish Cold Drink Cross Road, C G Road,380006,40075054. JM Financial
Services Pvt Ltd G-10 Chinubhai Centre, Gr. Flr,Nehru Bridge Corner,Ashram Road,380009,26576666. Kalyanbhai Mayabhai Stock Brokers Pvt. Ltd 705, Sakar 1, Opp. GandhigramRailway Station,Navrangpura,380009,. Kotak Securities Ltd 207, 2nd Floor, Sakar-Ii, Ellisbridge Corner, Ashram Road,26587276. Kotak Securities Ltd 201/A, Amruta Arcade, Nr Maningr Char Rasta, Maningr,. Kotak SecuritiesLtd B/104, 1st Floor, Premium
House, Opp Gandhigram Rly Stn,26579567. Kotak Securities LtdB-46, Kamdhenu Complex, Opp.Sahajanand College, Panjara Pole, Ambawadi,26308035. Motilal Oswal Securities Ltd Bearing No. G-6/7/8/9 & 10,Citypride Complex, Near Nalanda Hotel, Mithakali Circle, Navrangpura,0,30078120. Nirmal Bang Securities Pvt. Ltd 1st Flr,ShoppersPlaza-2 , Opp Telephone Exchange, CG Road,Navarangpura,380009,33000033. Religare
Securities Ltd 201,202,203,2nd Floor,Dev Complex, Opp Parimal Garden, C.G. Road,380006,9727746713. Religare Securities Ltd Dev Complex, 2nd Floor, Opp Parimal Garden, C.G. Road,380006,26422250. RR Equity Brokers Private Ltd 401, Abhijit-1, Opp. Bhuj Mercantile Bank, Mithakhali, 6 Road, Navrangpura,390009,40211888. SBICAPSecurities Ltd 4, Nishka Avenue, Opp Pizza Hut, Navrangpura,380009,26561450. SBICAP
Securities Ltd 2nd Floor, Nirman, Besides Jyoti Plaza, Nr. Shyamal Cross Road, Satellite,380015,26764456. SBICAPSecurities Ltd C/O State Bank Of India, 1st Floor, Modi Arcade, Near Rly Station, Maninagar (West),380008,25469205. Standard Chartered Securities(India) Ltd. 101, Popular House, Ashram Road,380009,26582817.Allahabad: Bajaj Capital Ltd Shop No. F-5 , Indira Bhawan, Civil Lines,211001,6452481. Kotak
Securities Ltd M-4, Mezzanine Floor, Lda Center, 2, SardarPatel Marg, Civil Line,2651451.Amritsar: Kotak Securities LtdUnit No.Fuf-7, Central Mall, 32, Mall Road,. SBICAPSecuritiesLtd C/O, StateBank Of India, MainBranch, Town Hall,143001,5030146.Anand: Kotak SecuritiesLtd 3rd Floor, Sanket, Near Grid,2573311. RREquity Brokers Private Ltd G-1, Silver Oaks,Opp. Swayambar Party Plot V.V.Road,388001,9377306968.Asansol:
SBICAPSecurities Ltd C/O State Bank Of India,Asansol Main Branch,Bijoy Pal Sarani,713301,9641611679.Aurangabad: Religare Securities Ltd1st Floor, Bhaskar Meridian, Opp. SwatantraSainik Colony, Nageshwarwadi,431001,7126638098.Bangalore: Bajaj Capital Ltd Unit 104-107, First Floor, A Wing, Mittal Towers, M.G. Road,560001,65471121. Bajaj Capital Ltd 343/6, Ground Floor, Sampige Plaza, 11Th Cross, Sampige
Road, Maleswaram,560003,9731011331. EnamSecurities Pvt Ltd 10/3, Ground Floor,No.29, Empire Infantry,Infantry Road,560001,40333222. IDBI Capital Market Services Ltd No. 63, Right Wing, 1st Floor, K. H. Road, (Double Road), Opp. Bmrtc Big Bazaar, Above Vodaphone Store,560027,22117869. JM Financial Services Pvt Ltd 97/4 Residency Rd,560025,30912400. Kotak SecuritiesLtd Umiya LandmarkIi Flr., No:10/7 -Lavelle
Rd,66203601. Kotak Securities Ltd No 201, Soundrya Sampige Complex, Sampige Road, No 412, 8th Cross, Malleswaram,9900133758. RR Equity Brokers Private Ltd S-111,Manipal Centre,47,Deckenson Road,42477177. SBICAPSecurities Ltd Sbi Lho Campus Behind Spb Branch St. Marks Road,560001,32905247. SBICAPSecurities Ltd Pb No-483, No-73 K R Road. Sbm Building 1st Flr, Basavangudi,560004,42103575.
SBICAPSecurities Ltd 1st Floor, C/O Sbi Koramangala Pbb Branch, No.472, Avs Complex, 4th Block, Koramangala,560034,49074203. Standard Chartered Securities(India) Ltd. J.R. Complex, No.21/1, Hosur Main Road, Nanjappa Layout, Adugodi,560030,22108140. Standard Chartered Securities(India) Ltd. Ground Floor, Sri Bhavana Thilaka, 4/2 Millers Road,560052,22354391.Belgaum: Kotak Securities Ltd Shri Laxmi Sankul
Complex, T-01, 3rd Flr, Above Cosmos Bank, Maruti Galli,4203033.Bharuch: Kotak Securities Ltd 235-236, Harihar Complex, Zadeshwar Road,570569.Bhavnagar: IDBI Capital Market Services Ltd 108 1st Floor, ShopperS Point, Parimal Chowk, Waghawadi Road,364002,9374840644. RR EquityBrokers Private Ltd 251 Madhav Darshan,Waghawadi Road,364001,9426235681. SBICAP Securities Ltd C/O State Bank Of Saurashtra
- Kalanala Branch, Kalanala,364001,2520009.Bhilai: SBICAPSecurities Ltd Sbi Main Branch,Sector 1,490001,0.Bhopal: Bajaj Capital Ltd Shop No. 6, First Floor, Jyoti Cinema Complex, M.P. Nagar, Zone1,462011,6459550. IDBI Capital Market Services Ltd Harisons House, Upper Ground Floor, 6 Malviya Nagar,462003,2760010. Kotak Securities Ltd Third Floor, Alankar Palace, 10-11, Mp Nagar, Zone 2,5248133. SBICAP
Securities Ltd State Bank Of Indore Paanchanan T T Nagar,462003,6549108. Standard Chartered Securities (India) Ltd. K.K. Plaza, Plot No. 1, Zone 2, Maharana Pratap Nagar,462011,4056521.Bhubaneshwar: Bajaj Capital Ltd Plot No. 1/A, Ground Floor, Station Square, Kharvel Nagar,751001,6451257. IDBI Capital Market Services Ltd Idbi House, Janpath, Unit Ix,751022,3208801. Kotak Securities Ltd Plot No 24, 2nd Flr.,
Scr, Nr Bazaar Kolkata, Bapuji Nagar, Janpath,2597871. Religare Securities Ltd Plot No - 24 , Scr Bapu Ji Nagar , Janpath,751009,6122200485. Standard Chartered Securities (India) Ltd. 5, Janpath, Unit - 3, Kharavel Nagar,751001,3209981.Bokaro: RR Equity BrokersPrivate Ltd Ga-18,City Center Sector-4 Bakaro Steel City,827004,9835139765.Chandigarh: Bajaj Capital Ltd Sco 341- 342, First Floor, Sector 35B,160036,6451612.
IDBI Capital Market Services Ltd Sco 86, 1st Floor, Sector 44 C,160044,3242449. Kotak Securities Ltd Sco-14-15, 2nd Floor, Madhya Marg, Sector-8C,5065301. Religare Securities Ltd Sco 56 - 58 2nd Floor Sector 9 D,44181818. RR Equity Brokers Private Ltd Sco-222-223,Gr. Floor,Sector-34A,2624896. SBICAP Securities Ltd C/O State Bank Of India, Main Branch, Sco 43-48, 1st Flr, Sector 17 B,160017,5079240. Standard
Chartered Securities (India) Ltd. Sco-35-F.F,Sec-21-C,160021,5025501.Chennai: Bajaj Capital Ltd Wellington Plaza, 3rd Floor, 90, Anna Salai,600002,23451207. EnamSecurities Pvt Ltd EnamSecurities Direct Pvt Ltd 11, Vijay DeluxApts., 7/4 First Main Road, Cit Colony, Mylapore,600004,39184335. Eureka Stock& Share Broking ServicesLtd. Karnani Archieves,154,Pycroft Road,Near Roypettah Clock Tower,600014,9884710122.
IDBI Capital Market Services Ltd Flat No. D, 1st Floor, Deve Regency, No. 6/11, 1st Main Road, Gandhi Nagar, Adyar,600020,32935830. JM Financial Services Pvt Ltd Gee Gee Crystal - 5th Floor,91-92. Dr.Radhakrishnan Salai,Mylapore,600004,42255666. Kotak Securities Ltd Grr Business Cneter, No.21, VaidyaramanStreet, T Nagar,66462000. Nirmal Bang Securities Pvt. Ltd NewNo.51, CP Ramasamy Road,C PManor Building
Alwarpet,600018,42912650. Religare Securities Ltd 4th Floor, City Tower, No. 117, Theagaraya Road, T. Nagar,600017,43546592. Religare Securities Ltd 4th Floor, City Tower, No. 117, Theagaraya Road, T. Nagar,600017,43900600. RR Equity Brokers Private Ltd 3rd Flr.,Percision Plaza,New -397, Teynampet, Anna Salai,600018,42077370. SBICAPSecurities Ltd Sbi Main Branch New No.84, 22 Rajaji Salai,600001,42065997.
SBICAP Securities Ltd Sbi Building No 2 APrakasam Road Panagal Park T Nagar,600017,42606204. SBICAP Securities Ltd Sbi Spb Branch,Plot No.4, Teachers Colony,Indiranagar, Adyar,600020,42607565. Standard Chartered Securities (India) Ltd. Jamals Santhini, 1/1, Ii Nd Main Road, Seethammal Colony, Alwarpet,600018,24328944. Standard Chartered Securities (India) Ltd. W-123, 1st Floor, 3rd Avenue, Anna
Nagar,600040,26264500.Coimbatore: Bajaj Capital Ltd No. 575, D.B. Road, First Floor, (Near Head Post Office) R.S. Puram,641002,6470136. IDBI Capital Market Services Ltd 2nd Floor, 16, Sathya Moorthy Road, Opp. Ayyapaseva Sangam, Ramnagar,641009,3208226. Kotak Securities Ltd 1st Floor, Red Rose Chamber, 1437,Trichy Road,6699666. SBICAP Securities Ltd Sbi Main Branch,State Bank Road.,641018,2395711.
SBICAP Securities Ltd Sbi Premises - First Floor, 451, D.B. Road, R.S.Puram,641018,4355527.Dehradun: Bajaj Capital Ltd 15, Rohini Plaza, 11-E Rajpur Road,248001,6452648. Kotak Securities Ltd 1st Floor, Swaraj Complex, 72, Rajpur Road, Opp Hotel Madhuban,2745870. RR Equity Brokers Private Ltd 56, 1st Floor, Rajpur Road,Opp. Madhuban,248001,3258181. SBICAP Securities Ltd Sbi Main Branch, 4th Convent
Road,248001,2651156.Dhanbad: Bajaj Capital Ltd Ozone Plaza, 1st Floor, Bank More,826001,2300576. Kotak Securities Ltd 1st Floor, Commerce House - 2, Above Ashoka Bajaj Showroom, Shastri Nagar,2308482. RR Equity Brokers Private Ltd 218,Sri Ram Plaza2nd,Floor Bank More,826000,9431721838.Durgapur: Eureka Stock & Share BrokingServices Ltd. Acharjee Market,Ground Floor,Benachitty,713213,3290491. SBICAP
Securities Ltd C/O. State Bank India, Durgapur Branch, Dsp Maingate, Po Durgapur-3,713203,2588289.Erode: SBICAPSecurities Ltd C/O. Sbi Main Branch, D-48,State Bank Road,638003,4270818.Faridabad: Bajaj Capital Ltd 5R/1 Ground Floor, B.K. Chowk, Near Hdfc Bank,121001,6466566. RR EquityBrokers Private Ltd Shop No. 55, 1st Floor, Near Flyover,Neelam Chowk,Niit,121001,2427361. SBICAPSecurities Ltd
State Bank Of India, 1st Flr, Neelam Chowk, N.I.T,121001,2420209.Ghaziabad: Bajaj Capital Ltd G-5, Ansals Satyam Building, Raj Nagar, District Centre,201002,6493211. RR Equity Brokers Private Ltd 114, Satyam Complex, Raj Nagar Dc, Raj Nagar,201002,2828090. SBICAP Securities Ltd C/O, State Bank Of India,Navyug Marget,201001,2798891.Gorakhpur: Bajaj Capital Ltd Ground Floor, AD Towers, Bank Road,
Gorakhpur,273001,6453025. RR Equity Brokers Private Ltd 1st Floor, Ram Govind Complex, Opp. Raj Cinema, Sumer Sagar Road,273005,9936590296.Guntur: SBICAPSecurities Ltd Shop No-13, Second Floor, Raghu Mansion, 4/1, Brodipet,522002,3244001.Gurgaon: Bajaj Capital Ltd Super Mart B-201, Super Mart - 1, Dlf City Phase - Iv,122002,6469991. Bajaj Capital Ltd Sec 14 102, Akd Tower, Upper GroundFloor, Near
Huda Office, Sector-14,122001,6468101. Kotak Securities Ltd O - 107Arjun Shopping Mall ; Arjun Nagar ; Dlf Phase1,. RR Equity Brokers Private Ltd 101,Apna Bazaar,122001,9899947108. SBICAPSecurities Ltd Sbicap Securites, Sbi Sushant Lok 1, B/05, Unitech Trade Centre,12209,2385365.Guwahati: Bajaj Capital Ltd Room No.102, 1st Floor, Dunfur Apartment, R G Baruah Road,781024,9207045530. IDBI Capital Market
Services Ltd C/O Idbi Ltd Idbi House, 4th Floor, North Eastern Zonal Office, G. S. Road,781005,9864259980. Kotak SecuritiesLtd Akshay Tower , 4th Floor, Opp. Rupayan Arcade, Fancy Bazar, S.S. Road,2732243. SBICAPSecuritiesLtd C/OState Bank Of India, Dispur Branch, OppositeAssam Sachibalaya, Dispur,781006,2237594.Gwalior: SBICAPSecuritiesLtd C/OState Bank Of India,Basement, Main Branch ,Jiwaji Chowk,
Lashkar,474001,2620727.Hubli: Kotak Securities Ltd V AKalburgi Complex, Ground Floor, Besides Vivekanand Corner, Desai Cross, Deshpandenagar,2357512.Hyderabad: Bajaj Capital Ltd 3-6-522, 2nd & 3rdFloor, Archies Showroom, Opp. Kfc, Himayath Nagar,500029,44555555. Bajaj Capital Ltd Shop No.10, First Floor, Minerva Complex, 94, S.D. Road,500003,64631428. Edelweiss Broking Ltd 2nd Floor, Mb Tower, Plot No.
5, Road No. 2, Banjara Hills,500034,40316911. Enam Securities Pvt Ltd Enam Securities Direct Pvt Ltd 6-3-650/217B & C, Maheshwari Chambers, 2nd Flr.,Somajiguda,500082,39893626. IDBI Capital Market Services Ltd C/O Idbi Ltd 3rd Floor, Idbi House, D. No. 5-9-89 / 1 & 2, Chapel Road, P. B. No. 370,500001,66747540. JM Financial Services Pvt Ltd 9-10 Uma Chambers,3rdFloor, Banjara Hills,500034,39875900. JM Financial
Services Pvt Ltd 3R Flr, 305 Jade Arcade, Opp Paradise Hotel, M G Road, Secundrabad,500003,39825200. Kotak Securities Ltd 9-1-777, 4th Flr, Beside Itc Bldg, S D Rd, (Lane Opp To Dbr Diagnosis),65326394. Motilal Oswal Securities Ltd 201, Lumbini Amrutha Chambers,Near Nagarjuna Circle, Road No.3, Banjara Hills,500082,30624444. Nirmal Bang Securities Pvt. Ltd H No.7-1-22/8-C, 1st Floor,Near Green Lands
Flyover,Begumpet,500016,42407049. Religare Securities Ltd 2nd Floor,7-1-59/2&59/6, Mandhana Towers,Ameerpet,500016,40180612. SBICAPSecurities Ltd StateBank Of Hyderabad Ground Floor, Gunfoundry,500001,23321875. SBICAP Securities Ltd Room 4, 1st Flr H.No 10-2-199, Nehrunagar, Entrenchment Rd, Marred Pally, Secunderabad,500026,27700135. SBICAPSecurities Ltd 1st Floor, Dmc Center, Above State
Bank Of India, St. JohnS Road, East Marredpally, Secunderabad,500026,40137725. Standard Chartered Securities (India) Ltd. Ug - 13, Mekins Maheshwari Mayank Plaza, 6-3-866 / 1 / A, Greenlands, Ameerpet,500016,23417032. Standard Chartered Securities (India) Ltd. 103/402, Mahavir House, Basheer Bagh Square,500029,23223222.Indore: Bajaj Capital Ltd Shop No. 3, City Plaza, M.G. Road Near Regal
Cinema,452001,6452014. Edelweiss Broking Ltd 312, D. M. Tower, Race Course Road,452001,4061164. IDBI Capital Market Services Ltd Plot No. 11A/ A, 1st Scheme No. 54, Opp. Satya Sai School, Vijay Nagar, A. B. Road,452010,2554229. JM Financial Services Pvt Ltd Ug-7 &8, Ground Floor, D M Tower, ,21/1, Race Course Road,452004,3072111. Kotak SecuritiesLtd 314, Citi Centre, 570, M.G. Road,2537336. RR Equity Brokers
Private Ltd 206 GoldArcade, 1/3 New Palasia,452001,9826062666. SBICAPSecuritiesLtd State Bank Of Indore 5,Yashwant Niwas Road,452003,2547517. SBICAPSecurities Ltd State Bank Of India Gpo Main Branch,452001,4036625. Standard Chartered Securities (India) Ltd. Ug - 4,5 & 6, Royal Diamond, Y.N. Road, Opp. State Bank Of Indore (Ho),452001,4200521.Jabalpur: Kotak Securities Ltd Jain Tower, 3rdFloor, Ruseel
Chowk,4085850. RR Equity Brokers Private Ltd Shop No. 5, Unique Tower, Shashtri Bridge Chowk,Opp. Icici Bank,482002,9827066823. SBICAPSecurities Ltd C/O. Sbi Main Branch, Civil Lines,482001,4218261.Jaipur: Bajaj Capital Ltd G-3, Anukampa Tower, Opp. Sangamtower, Church Road (M. I. Road),302001,6503342. Edelweiss Broking Ltd Green House 601 & 602; 6th Floor, Ashok Marg,0,4045167. Eureka Stock & Share
Broking Services Ltd. 213/214,Jaipur Towers,MI Road,Opposite AI R,302001,3918040. IDBI Capital Market Services Ltd 314 3rd Floor, Ganpati Plaza, M. I. Road,302001,3208276. JM Financial Services Pvt Ltd G-7 & G-8,Brij Anukamba,Plot No.K-13, Ashoka Marg,C-Scheme,302001,3984400. Kotak Securities Ltd 305-308, 3rd Floor, Green House, O-15,Ashok Marg, C-Scheme,. Nirmal Bang Securities Pvt. Ltd 201,2nd Floor,Sangam
Tower Church Road,302001,3093700. Religare Securities Ltd No.501& 605, 5th & 6th Floor Luhadia Tower, K-11, Ashok Marg Near Ahinsa Circle, C Scheme,302001,4066023. RR Equity Brokers Private Ltd 7,Katewa Bhawan,Opp. Ganapati Plaza, Mi Road,302001,3235456. SBICAPSecurities Ltd C/O Sbi Special Branch, Ground Floor, Sangeneri Gate,302003,4006483. SBICAP Securities Ltd 128 , A- Block , First Floor, Opp.
Sbbj Bank,Ganpati Plaza, M I Road,302001,3221945. Standard Chartered Securities (India) Ltd. 8, KatewaBhawan, 1st Floor, Opp. Ganpati Plaza, M.I. Road,302001,4026575.Jalandhar: Kotak Securities Ltd 2nd Floor, 465, Lajpat Nagar Market,. SBICAPSecurities Ltd C/O. State Bank Ofindia, Civil Lines,144001,4636317.Jammu: SBICAPSecurities Ltd C/O State Bank Of India, Railway Road Branch,180001,2471118.Jamnagar:
Kotak Securities Ltd701, 5th Floor, City Point, StationRoad, Near Town Hall,5540355. SBICAPSecurities Ltd G-3, Ground Flr, Madhav Darshan Complex, Opposite Cricket Bungalow Near Limda Line,361001,2555170.Jamshedpur: Bajaj Capital Ltd Shop No. 53, 2nd Floor, Kamani Business Centre Bishtupur,831001,6457603. Eureka Stock& Share Broking Services Ltd. 1st Floor,RjsBuilding,Diagonal Road,Bistupur,Jamshedpur,2428777.
Kotak Securities Ltd Bharat Business Centre, Ho No.2, 2nd Flr, Rm No. 8, Ram Mandir Area Bistupur,3090856. SBICAP Securities Ltd Sbi, Jamshedpur Bistupur,831001,3206515.Jodhpur: Kotak Securities Ltd 1st Floor, Gulab Bhawan, Chopasani Road,5101956. RR Equity Brokers Private Ltd Inside Keshav Bhawan Near Hdfc Bank 9Th Chopasni Road Jodhpur 342003,342003,9928388322. SBICAPSecurities LtdC/OSbi,
Special Branch, High Court Campus, Kachauri,342001,2546546.Kanpur: Bajaj Capital Ltd 106, Ratan Esquire, 14/144, Chunni Ganj,208001,6451763. Kotak Securities Ltd 312-315, 3rd Floor, 14/113, Kan Chambers, Civil Lines, Near Up Stock Exchange,3018114. RR Equity Brokers Private Ltd 26 L.G.F. Roland Tower 17/5 The Mall,208001,9336219040. SBICAPSecurities Ltd Sbi, Main Branch Campus, Zonal Office,16/101 Civil
Line Mall Road,208001,2333571. Standard Chartered Securities (India) Ltd. 15 / 59, O Civil Lines,208001,3268394.Kochi: Bajaj Capital Ltd Rubicon Building, S.A. Road, South Over Bridge, Valanjambalam,682016,6452566. IDBI Capital Market Services Ltd 2nd Floor, Pavana House, K. P. Vallon K. P. Vallon Road, Kadavanthra,682020,3210712. Kotak Securities Ltd 40/1400, 11Th Floor, Ensign Enclave, Jos Junction, M.G.
Road,2377386. Nirmal Bang SecuritiesPvt. Ltd Shop No.39/2122 B-First Floor,Jomer Aracade, Chittoor Road,South Junction - Cochin Kerala,682016,4117971. Religare Securities Ltd 35/65-D,3rd Floor, Thadikaran Centre, Palarivattom,682025,4954025771. SBICAPSecurities Ltd Sbi Shanmugham Rd. Branch 2nd Floor, Ktdc Bldg, Ernakulam,682031,3248745. Standard Chartered Securities (India) Ltd. 1st Floor, Sana Tower,
39/2579C, M.G. Road, Ernakulam,682016,2372669.Kolhapur: Bajaj Capital Ltd Ground Floor, Damodar Enclave Apartment, 10Th Lane, Rajaram-Puri,416001,6450529.Kolkata: Bajaj Capital Ltd Martin Burn House, Ground Floor, 1, Room. No. 15, R.N. Mukherjee Road,700001,40053282. Bajaj Capital Ltd Ground Floor, 10-C, Hungerford Street,700017,30295200. Bajaj Capital Ltd 9, Ezra Street,700001,64578545. Edelweiss Broking
Ltd 2nd Floor, Savitri Tower, 3A, Upper Wood,0,40104635. Enam Securities Pvt Ltd EnamSecurities Direct Pvt Ltd S-205, Ideal Plaza, 11/1,Sarat Bose Road,700020,32426310. Eureka Stock & Share Broking Services Ltd. B3/5,Gillander House,8,N.S.Road,700001,39180300. Eureka Stock & Share Broking Services Ltd. 9B,Wood Street,1st Floor,700016,39180380. Eureka Stock & Share Broking Services Ltd. 7, Lyons Range, 2nd
Floor,700001,. IDBI Capital Market Services Ltd Suit No 2 B, 228 A, Landmark Bldg - Seconf Floor , Mintopark ,Ajc Bose Road,700020,32502896. JM Financial Services Pvt Ltd Kankaria Estate, 8th Flr,6th Little Russell Street,700071,39870330. Kotak Securities Ltd 7th Floor, Apeejay House, Block C, 15, Park Street,22273999. Kotak Securities Ltd Govind Bhavan, Ground Floor, 2, Biplabi Trilokya Maharaj Sarani(Brabourne
Road),22358105. Motilal Oswal Securities Ltd 3rd Floor, Constantia Building,Dr. U. N. Bramachari Street,0,9748640024. Nirmal Bang Securities Pvt. Ltd Ac Market Complex,8th Floor, 1 Shakespeare Sarani,700071,30584292. Religare Securities Ltd Unit No. 410, North Block, 4th Floor, Ideal Plaza, 11/1,Sarat Bose Road,700020,9874262628. RR Equity Brokers Private Ltd 704,Krishna Bldg.,224,Ajc Bose Road,700017,22802963.
SBICAPSecurities Ltd Sbi Main Branch Sammriddi Bhavan 3rd Floor, 1- Strand Road,700001,22481729. SBICAPSecurities Ltd State Bank Of India Jeevandeep Bldg,Ground Floor Middleton Street,700071,22886604. SBICAPSecurities Ltd C/O Sbi, 50A, Gariahat Road, Ballygunge,700019,24619561. Standard Chartered Securities(India) Ltd. Shree Manjiri, 1st Floor, 8/1, Sir William Jones Sarani,700071,22276521. Standard
Chartered Securities (India) Ltd. Premises No 152 First Floor, S.P Mukherjee Road,700026,24634044. Standard Chartered Securities(India) Ltd. Mangalam Bldg., 24 &26, Gr Floor, Hemanta Basu Sarani, Dalhousie,700001,22137028.Kota: Kotak SecuritiesLtd D-8 First Floor, Shri Ram Complex, Opposite Multipurpose School, Gumanpura,. SBICAP SecuritiesLtd Kota Main Branch, Chhawani Chouraha,324007,2390147.Lucknow:
Bajaj Capital Ltd 5, Commerce House, Habibullah Compound, 11, M.G. Marg, Hazratganj,226001,6565568. Bajaj Capital Ltd C-204, Ugf, Sahara Plaza, Patrakar Puram, Gomti Nagar,226010,4060909. IDBI Capital Market Services Ltd 1st Floor, Halwasiya House, 11 M. G. Marg,Hazratganj,226001,3250987. Kotak Securities Ltd 1-2 Ground Floor, Commerce House, Habibullah Estate,11 M.G. Marg,3232285. Kotak Securities Ltd
A-1 ; Ashish Palace,Sector E,Aliganj,3232285. Religare Securities Ltd Ground Floor, Riz Building, 5 Park Road,226001,9935344009. RR Equity Brokers Private Ltd G-32,Shriram Tower,13- A,Ashok Marg,226001,4057612. SBICAPSecurities Ltd C/O State Bank Of India, 2/103 Vijay Khand First Flr, Gomti Nagar,226010,2303261. SBICAPSecurities Ltd C/O Sbi Govt.Business Branch Moti Mahal Marg Behind K.D.Singh Babu
Stadium Hajrath Ganj,226001,3202184.Ludhiana: Bajaj Capital Ltd M-3, Abc Services, Sco-137, Feroze Gandhi Market,1,2412287. Kotak Securities Ltd Sco-122, 2nd Floor, Firoz Gandhi Market,5047214. Nirmal Bang Securities Pvt. Ltd Office No.301& 302,Sco No.15, Scan Plaza,Feroze Gandhi Marg,141001,4020000. SBICAP Securities Ltd Sbi, 1st Floor Fountain Chowk Civil Lines,141001,5025634.Madurai: Bajaj Capital Ltd
Suriya Towers, No.5, First Floor, 272/273, Good Shed Street,625001,6461023. Kotak Securities Ltd ShopAFirst Floor, KrvArcade, Ar Plaza 16 & 17, North Velli Street,2341225. SBICAPSecuritiesLtd C/O State Bank Of India, Number - 7A, West Veli Street, Opposite Railway Station,625001,4506404.Mangalore: Bajaj Capital Ltd Essel Towers, Bs 4, Bunts Hostel Circle,575003,6451218. IDBI Capital Market Services Ltd 1st Floor,
Bridge Square, Balmatta Road,575001,4278032. Kotak Securities Ltd No.4, 3rd Floor, The Trade Centre, Jyoti Centre, Bunts Hostel Road, Near Jyoti Circle,424180. Kotak Securities Ltd No.4, 3rd Floor, The Trade Centre, Jyoti Centre, Bunts Hostel Road, Near Jyoti Circle,424180. RR EquityBrokers Private Ltd F 2 1st FloorAdithi Arcade Karangalpay,575003,9845288557. SBICAP Securities Ltd C/O Sbi, Mangalore Main Branch,
Port Road, P.B.No-90,575011,4265361.Meerut: Bajaj Capital Ltd G-43, Ganga Plaza, Near Begam Bridge,250001,6451510.Mumbai: Bajaj Capital LtdAgra Bldg, Gr. Floor, 7/9 Oak Lane, Fort,400023,66376999. Edelweiss Broking Ltd 104, 1st Floor, P J Tower, Bse Bldg., Dalal Street, Fort,400001,67471345. Enam Securities Pvt Ltd Khatau Building, 2nd Floor, 44 Bank Street, Off Shahid Bhagatsing Road, Fort,400023,22677901.
Enam Securities Pvt Ltd Enam Securities Direct Pvt Ltd 201-A, Laxmi Towers, Bandra Kurla Compex, Bandra (E),400051,66803600. Enam Securities Pvt Ltd Hari Chamber, Ground Floor, 58/64, Shahid Bhagat Singh Road, Fort,400001,22677901. Eureka Stock & Share Broking Services Ltd. Raheja Chambers,R.No.909,9Th Floor,213,Nariman Point,400021,32583020. IDBI Capital Market Services Ltd Mafatlal Centre , 3rd Flr ,
Nariman Point,400021,43221212. IDBI Capital Market Services Ltd Shop No. B 4, E Wing, Crystal Plaza, Opp. Infinity Mall, Off New Link Road, Adarsh Nagar,Andheri (W),400053,32468346. IDBI Capital Market Services Ltd Shop No.3, Vikas Palm Village Pachpakhadi,400601,25444441. IDBI Capital Market Services Ltd Shop No. 8, Thacker Tower Premises Co-Op Society Ltd Plot No. 86, Sector 17, Vashi,400705,27893262. JM
Financial Services Pvt Ltd 1st Floor, Patel House, Next To Bank Of Baroda,M G Road, Vileparle (E),400057,26135202. JM Financial Services Pvt Ltd Palm Court, M- Wing, 4th Floor, Goregaon Link Road,Malad West,400064,30877000. JM Financial Services Pvt Ltd Ground Floor, Anushka, New Link Rd,Andheri West,400053,66191600. JM Financial Services Pvt Ltd Shop No 6, Dattani Trade Center,Chandra Varkar Road, Borivali
(W),400092,30215400. JM Financial Services Pvt Ltd 424/425 Kalidas Plaza, V B Lane,Ghatkopar East,400075,30978700. JM Financial Services Pvt Ltd 2,3,4 Kamanwala Chambers, P M Road, Fort,400001,3021500. Keynote Capitals Ltd 4th Floor, BalmerLawrie Building,5, J. N. Heredia Marg,Ballard Estate,400001,22694322. Kotak Securities Ltd 32, Gr Flr., Raja Bahadur Compound, Opp Bank Of Maharashtra, Fort,22655074.
Kotak Securities Ltd 6th Floor, Kotak Towers, BuildingNo. 21, Infinity Park, Off Western Express Highway, Goregaon Mulund Link, Road, Malad (E),66056825. Kotak Securities Ltd Nirlon House, 3rd Floor, Dr Anie Besant Road, Near Passport Office, Worli,66529191. LKP Securities Ltd Bank Of Maharashtra Bldg,45 / 47, B S Marg, Fort,400001,22663963. Motilal Oswal Securities Ltd Queens Mansion,2nd Floor, 44, A. K. Naik Marg,
Behaind Khadi Gramodyog,0,30278090. Nirmal Bang Securities Pvt. Ltd B - 201,Khandelwal House, Poddar Road, Near Poddar Park, Malad (East),400097,39269139. Religare Securities Ltd301/302, Viraj Tower, Gundavali, Western Express Highway, Near Landmark Building, Andheri (East),400093,9654460744. Religare Securities Ltd 301/302, Viraj Tower, Gundavali, Western Express Hightway,Near Landmark Building, Andheri
(East),400093,67288000. RR Equity BrokersPrivate Ltd 18 First Floor,105 Bombay Samachar Marg.,Fort,400023,40544201. RR Equity BrokersPrivate Ltd 133A, Mittal Tower, AWing, 13Th Floor, Nariman Point,400021,9324804084. SBICAPSecuritiesLtd State Bank Of India M.G.Road Ghatkopar East,400077,25020964. SBICAPSecuritiesLtd 1st Floor, Tulsiani Chembers, Nariman Point,400021,32660218. SBICAP Securities
Ltd Sbi Admin Building Compound, Madam Cama Rd., Nariman Point,400021,22023214. SBICAP Securities Ltd C/O Sbi Spb Branch, Mumbai Samachar Marg, Gate No 7, Horniman Circle, Fort,400001,32660216. SBICAP Securities Ltd 2nd Flr, C Wing, Mafatlal Chambers, N.M Joshi Marg, Lower Parel,400013,42273451. SBICAP Securities Ltd C/O Sbi Jvlr Branch, Ground Floor,Juhu Versova Link Road, Andheri
(W),400053,26707887. Standard Chartered Securities (India) Ltd. Shop No. 1&2, Shroff Towers, Sodawala Cross Lane, Borivali (West),400092,66982772. Standard Chartered Securities (India) Ltd. Work Station - 1016, Standard CharteredTower, 201-B/1,1st Floor, Western Express Highway,Goregaon (East),400063,67559626. Standard Chartered Securities(India) Ltd. Sai Plaza, Ground Floor, Jawahar Road, Opp. Railway Station,
Ghatkopar (East),400077,25028540. Standard Chartered Securities (India) Ltd. 6, Sanghrajka House, 1st Floor, 431, Dr. D.B. Marg, Opera House,400004,65177950. Standard Chartered Securities (India) Ltd. Ground Floor, Anand Commercial Centre, NearAsha Parekh Hospital, S.V. Road, Santacruz (West),400054,26004633.Mysore: Kotak Securities Ltd No: 646 - Kiran Mansion - 2 Nd Floor, Above Reliance Fresh, Chamaraja
Double Road,4000861. SBICAP SecuritiesLtd C/OState Bank Of India, Mysore Main Branch,P.B.No-204, Motikhana Building, New Sayaji Rao Road,570024,2435866.Nagpur: Bajaj Capital Ltd Shop No. 5, Pushpakunja Commercial Complex, Central Bazar Road, Ramdas Peth,440010,6618577. IDBI Capital Market Services Ltd Unit No. 104, Ashish Annexe, Plot J-13 A, Whc Road, Laxmi Nagar,440022,2230005. Kotak Securities
Ltd Plot No. 5, 3rd Floor, Lotus Gorepeth Layout Whc Road , Dharampeth,6620278. SBICAPSecuritiesLtd C/OSbi Seva Sadan Branch, 75 Moti Mohan Complex Seva Sadan Chowk, C.A.Road,440018,3257729. Standard Chartered Securities (India) Ltd. 101/102, Shriram Shyam Towers, 1st Floor, Kingsway, Sadar,440001,3243681.Nashik: Bajaj Capital Ltd G 18 & 19 , Suyojit Sankul, Tilak Wadi, Sharanpur Road,422002,6629011.
Kotak Securities Ltd G-5, Suyojit Avdhoot Tower, Old Gangapur Naka, Gangapur Rd,6609804. SBICAPSecurities Ltd C/O Sbi Spbb Br., Plot No. 56 ,Opp. Wadnagare Bhavan, Thatte Wadi, College Road,422005,2232152.NewDelhi: Bajaj Capital Ltd Bajaj House, 97, Nehru Place,110019,41693000. Bajaj Capital Ltd United India Life Building, F-Block, Middle Circle, Connaught Place,110001,41790444. Enam Securities Pvt Ltd
M-39, Iind Floor, Outer Circle,Opp.Super Bazar, Connaught Place,110001,49811200. IDBI Capital Market Services Ltd Office No. 216-217-218, Second Floor, VardhmanTower, Preet Vihar,110092,32472133. IDBI Capital Market Services Ltd C-1/103-104,Lajpat Nagar -1, New Delhi,110024,9810316643. IDBI Capital Market Services Ltd 114, 1st Floor, Aggarwal City Plaza,Plot No. 17, Manglam Palace, Sector 3, Rohini,9810533146.
JM Financial Services Pvt Ltd114 Himalya House,23,K G Marg,110001,41305000. Kotak Securities Ltd 202-217, 2nd Floor, Ambadeep Building, 14, Kasturba Gandhi Marg,66313131. Motilal Oswal Securities Ltd 801-806,8th Floor, Prakash Deep Building, 7 Tolstoy Marg, Connaught Place,0,43671859. Nirmal Bang Securities Pvt. Ltd Flat No.120, New Delhi House, 27 Barakhamba Road,110001,43603961. Religare Securities Ltd
G 36 Marina Arcade Inner Circle Connaught Place,110001,66201412. Religare Securities Ltd Religare Securities Limited, 4th Floor, D3, P3B, District Center, Saket,1100017,39125410. Religare Securities Ltd G - 16, Marina Arcade, Opp. Shivaji Stedium, Connaught Place,110001,66154195. RR Equity Brokers Private Ltd 47, M.M. Road, Rani Jhansi Marg, Jhandewalan,110055,9312940483. RR Equity Brokers Private Ltd 105, Anchal
Plaza,Nelson Mandela Road Vasant Kunj,110070,26891262. RR Equity Brokers Private Ltd 105, Pratap Bhawan , Bahadur Shah Zafar Marg,110001,49505500. RR Equity Brokers Private Ltd 118, Gagandeep Building, Rajendra Place,110008,25764872. RR Equity Brokers Private Ltd 106, Pankaj Chambers, Preet Vihar Community Centre,110092,42421238. RR Equity Brokers Private Ltd Shop No. 24, Fd Market, Near Madhuban
Chowk, Pitampura,110034,27311419. RR Equity Brokers Private Ltd N-24 - 25, Connaught Place,110001,41523306. RR Equity Brokers Private Ltd 111, Jyotishikhar, 8 Distt. Centre , Janakpuri,110018,25617654. SBICAP SecuritiesLtd Sbi Spb Branch11, Parliament Street,110001,23744235. SBICAPSecuritiesLtd State Bank Of India Personal Banking Branch, A-15 Hauz Khas,110016,26511104. SBICAPSecurities Ltd9, New
Rajdhani Enclave, Swasthya Vihar,NrPreet Vihar Metro Station,110092,45108482. SBICAPSecuritiesLtd C/O, State Bank Of India, E-2/28, Sector-7, Rohini,110085,27055815. Standard Chartered Securities (India) Ltd. 159, Aggarwal Citi Plaza, Plot No. 17, Manngalam Place, Sector 3, Rohini,110085,47090181. Standard Chartered Securities (India) Ltd. 52-53, Malviya Smriti Bhawan, Deen Dayal Upadhyay Marg,110002,41514821.
Standard Chartered Securities (India) Ltd. E-2/27,Ground Floor, Main Link Road, Jhandewalan, Near Jhandewalan Metro Station, Gate No.2,110055,43293200.Noida: Bajaj Capital Ltd Sector -29 A-2, Brahmputra Commercial Complex, Near Rail Reservation Centre, Sec. 29,201301,6494074. Bajaj Capital Ltd Sec-41 C-20, C Block Market, Sector-41,201301,2570410. Kotak Securities Ltd 2nd Floor, Above Kotak Mahindra Bank,
G-31-32, Atta Market, Sector-18,4606911. Religare Securities Ltd Gys Global Religare SecuritiesLimited , A3/4/5 Sector 125,201301,3394178. RR Equity Brokers Private Ltd P-5,Sector - 18,201301,4336902. SBICAPSecuritiesLtd C/OStateBank Of India, Sector-26,201301,2532133.Panjim: Bajaj Capital LtdF2, 1st Floor, AlfranPlaza, Near Don Bosco School, Panaji, Goa,403001,2356869. Kotak SecuritiesLtd 2nd Floor,Gurusai
Plaza,Isidoria Baptista Road,Margao,6624833. SBICAPSecurities Ltd Sbi, Panaji Main Branch Dayanand Bandodkar Marg Near Hotel Mandovi,403001,3253886. Standard Chartered Securities(India) Ltd. 15, 16& 17, Haroons Arcade, Magnum Center, 1st Floor, M. G. Road, Panaji,403001,2232173.Patiala: SBICAPSecurities Ltd State Bank Of Patiala Mall Road, The Mall Near SherawalaGate, Demat Section,147001,5013356.Patna:
Bajaj Capital LtdFlat No. 108, 1st Floor, Ashiana, Plaza, Budha Marg,800001,6451056. IDBI Capital Market Services Ltd Patna BranchOffice, 205, 2nd Floor, Grand Plaza, Fraser Road,800001,3200687. Kotak Securities Ltd Office No.7, Twin Tower Hathwa, South Gandhi Maidan,2224620. RR Equity BrokersPrivate Ltd 422-23, 4th Floor,Ashiyana Harniwas Complex,NewDak Bunglow Road,800001,9334114868. SBICAP Securities
Ltd C/OState Bank Of India ,Spb Gandhi Maidan,Biscoman Bhavan,800001,3260943.Pondicherry: Bajaj Capital Ltd No. 127/A, 100 Ft. Road,Natesan Tower, 1st Floor, Natesan Nagar,605001,6452334. SBICAP SecuritiesLtd 164, Kamraj Salai, 1st Flr, Above Sbi Adb Branch,605013,4304236.Pune: Bajaj Capital Ltd Shop No 6, Sanas Plaza, 1302, Subhash Nagar, Bazirao Road,411002,65009460. Bajaj Capital Ltd Suyash Plaza,
Office No.08, 3rd Floor, Opp-Selene Building, Bhandarkar Road, Near Kamla Nehru Park,411004,65009463. Enam Securities Pvt Ltd 1248A, Asmani Plaza, Goodluck Chowk, Deccan Gymkhana, Shivaji Nagar,411004,25521606. Enam Securities Pvt Ltd Enam Securities Direct Pvt Ltd 101 & 102, Silver Prestige, 1st Floor, Opp. Mccia, Tilak Road, Swargate,411002,30205492. IDBI Capital Market Services Ltd Office No. 32 / 33, 2nd
Floor, Building B, Wing C, Shrinath Plaza, Modern College, Shivagi Nagar,411004,32913133. JM Financial Services Pvt Ltd 205 Business Guild ,Opp. Krishna Dining Hall,Law College Road, Erandawane,411001,39871600. Kotak Securities Ltd2 Nd Floor, Kumar Business Center,Bund Garden Road,Opp. Bund Graden,66066129. Religare Securities LtdAmar Calibre, Ground Floor, C.T.S No. 911,Bmc Collage Road, Opp. Hotel Hill
View, Deccan Gymkhana,411004,9167216617. Religare Securities Ltd Religare Securities Ltd., Vascon Matrix, Ground Floor, Near Shoppers Stop,Wakdewadi,Shivaji Nagar,411005,0. SBICAPSecuritiesLtd State BankOf India Deccan Gymkhana BranchJ.M.Road, Deccan Gymkhana,411004,25539399. SBICAPSecuritiesLtd C/OSbi Bund Garden Branch, Grale 171/B, 1st Floor, Dp Road,411001,30221091. StandardChartered
Securities (India) Ltd. A/2, 1st Floor, Deccan Chambers, C.T. Survey No. 33/40, Erandwane, Karve Road,411004,25453436.Raipur: Kotak Securities Ltd Menzanine Fllor, Chawla Complex, Near Vanijya Bhawan,Devendra Nagar Road,251555. SBICAP Securities Ltd C/O State Bank Of India,Kutchery Branch,Kutchey Chowk,492001,4075329.Rajkot: Bajaj Capital Ltd Prathibha Complex, Near Jayesh Publicity, Moti Tanki
Chowk,360001,6450135. Enam Securities Pvt Ltd Enam Securities Direct Pvt Ltd 308, 3rd Floor, Towar Commercial Complex,Jawahar Complex,Near Galaxy Hotel,360001,2226383. IDBI Capital Market Services Ltd 1st Floor, Ankur Bldg Dr. Radhakrishan Road, Near Moti Tanki,360001,3056091. JM Financial Services Pvt Ltd 202 Solitaire, 2nd Floor, Swami Vivekanand Marg, Near Municipal Commissioner Bunglow, Ramkrishna
Nagar,360007,3984000. Kotak Securities Ltd Nath Complex, 2nd Floor, Opp. Jilla Panchayat, Above Kotak Mahindra Bank, Yagnik Road,2459436. SBICAPSecurities Ltd 608, Dhanrajni Complex, 6th Flr, Near Imperial Palace Hotel, Dr Yagnik Road,360001,3043328.Ranchi: Eureka Stock & Share Broking Services Ltd. G-2,Qtr,Shree Gopal Complex,Court Road,834001,2200230. Kotak Securities Ltd Shop No. 24 &25, 2nd Floor,
A.C. Market, G.E.L. Church Complex, Main Road,2200860.Salem: Bajaj Capital Ltd 22, Gf, Omalur Main Road,636009,6452565. Kotak SecuritiesLtd 5/241, F RathnaArcade Five Road,Meyyanur,2335476. SBICAPSecurities Ltd Sbi Siruthozhil Branch Bank House,No. 68 Cherry Road,636007,4031780.Shimla: SBICAPSecuritiesLtd C/O State Bank Of India, New Building, 2nd Floor, The Mall,171003,2652726.Siliguri: Bajaj
Capital Ltd 3rd Floor, Jatin Das Sarani, (Near Jwel Club),Ashram Para,734001,9641831375. Eureka Stock & Share Broking Services Ltd. 2nd Floor,Metro Plaza,S.F.Road,Khalpara,734405,9832379189. Kotak Securities Ltd Nanak Complex, 2nd Floor, Sevok Road,. Standard Chartered Securities (India) Ltd. Pratap Market, 1st Floor, Sevoke Road, Near Payal Cinema,734401,2544894.Surat: Bajaj Capital Ltd L-4, Ground Floor,
Vishwakarma Chambers, Majura Gate Crossing Road, Ring Road,395002,6450421. JM Financial Services Pvt Ltd 407, 4th Floor, 21 Century Business Centre, Near Udhna Char Rasta, Ring Road,395002,3984000. Kotak Securities Ltd Kotak House, K G Point, 1st Floor, Nr.Ganga Palace, Opp.Idbi Bank, Ghoddod Road,2254553. RR Equity Brokers Private Ltd M 32-Center Point,Civel Char Rasta Ring Road,395002,9925233692.
SBICAP Securities Ltd 1/580, Pore Street, Nanpura, Opp Sbi,395001,2464888. Standard Chartered Securities (India) Ltd. U-18,Upper Ground Floor, Jolly Plaza, Athwagate,395001,2463101.Thiruvananthapuram: Bajaj Capital Ltd Edamala Plaza, Tc 14/999 Opposite Police Headquarters, Vellayambalam Road, Vazahuthacadu Sasthamangalam Post,695010,6450176. IDBI Capital Market Services Ltd Nh Road,
Killipalam,Trivandrum.,695002,4018482. Kotak Securities Ltd Mahesh Estates, 2nd Floor, T L-15/1805, Vazhuthacadu,2337423. SBICAP Securities Ltd First Floor, State Bank Of Travancore Building, Sasthamangalam,695010,6454296.Trichy: Bajaj Capital Ltd Swati Arcade, 73/1 - F 1st Floor SalaiaRoad, Thillai Nagar,620018,6452094. Kotak Securities Ltd C-56,1-24-4th Cross, Thillai Nagar,. SBICAPSecurities LtdC/O, State
Bank Of India, Micr Center, Ground Flr, Asha Arcade, 73 Promenade Road, Cantonment,620001,4002818.Udaipur: Kotak Securities Ltd 222/12, Ist Floor, Mumal Towers, Saheli Marg,513901. SBICAPSecuritiesLtd C/O Sbi, Main Branch, 23/C Madhuban,313001,2420150. Standard Chartered Securities (India) Ltd. Abhay Niwas, 5, 1st Floor, Residency Road,313001,3204889.Ujjain: SBICAPSecuritiesLtd C/OSbi Main Branch,
State Bank Building, Budhwariya,465001,4061476.Vadodara: Bajaj Capital Ltd 129 Siddharth Complex, R C Dutt Road,390007,3088162. Enam Securities Pvt Ltd Enam Securities Direct Pvt Ltd Gf 9, Silverline Towers, Opp Bbc Towers,Sayajiganj,390005,3026945. Enam Securities Pvt Ltd 642 FortuneTowers, Sayajiganj,390005,2225412. IDBI Capital Market Services Ltd G/24 Concorde Bldg R P Dutta Road, Near Idbi Bank, B/
H Idbi Bank, Alkapuri,390005,3201426. JM Financial Services Pvt Ltd G1Ground Floor, Shohan, 49Alkapuri Society, Opp. Hdfc Babk, Alkapuri,390007,3984311. Kotak Securities Ltd 216, Meghdhanush Complex, Race Course Road (South),2314455. Religare Securities Ltd 3rd Floor, Corner Square, B/S West Side Near Natu Bhai Circle, Race Course Circle,390007,9558816823. RR EquityBrokers Private Ltd 222Siddharth Complex,Rc
Dutta Road,390007,3256190. SBICAP Securities Ltd Sbi, Alkapuri, R.C.Dutt Road,390007,6535747. SBICAPSecurities Ltd C/O. Sbi Mandvi Main Branch, Opp Jamnabhai Hospital, Mandvi,390001,2516422. SBICAPSecurities Ltd C/O. Sbi Makarpura I.E. Branch, Vcci Building, Makarpura,390010,2632533. Standard Chartered Securities (India) Ltd. F-101, Savoy Complex, Old Padra Road,390020,2357160.Varanasi: Bajaj
Capital Ltd D-58/53-54, 1st Floor, Shiva Complex, Rath Yatra Crossing,221010,6450181. IDBI Capital Market Services Ltd D-58/12, A-7, Iiird Floor, Gandhi Nagar, Sigra,221010,9935397975. RR Equity BrokersPrivate Ltd D -64/127 C-H, Arihant Complex, Nagar Nigam Road, Sigra,221010,9415201997. SBICAPSecurities Ltd C/O State Bank Of India , Bhelupur Branch,221010,22277558.Vijayawada: Bajaj Capital Ltd Kalyan
Complex 39-1-89, 1st Floor, Beside Obc Bank, Temple Street, M.G. Road, Labbipet,520010,6450181. Kotak Securities Ltd 40-1-48/1, Labbipet, M.G.Road,6649061. SBICAP Securities Ltd Sbi ,Governorpet Branch Ali BeghStreet Governorpet,520002,2577887.Visakhapatnam: Bajaj Capital Ltd Door No.10-1-125, 1st Floor, Asilmetta Junction, BesidePrasad Labs,530003,6461773. IDBI Capital Market Services Ltd 10 / 1 / 44 3rd
Floor, T. L. N. Complex Opp. Idbi Bank, Siripuram,530003,3201715. JM Financial Services Pvt Ltd Door No 9-1-224/4/3, 1st Floor, Nandan Nirman,500003,3983800. Kotak Securities Ltd Door No.47-10-15, Vrc,. SBICAP Securities Ltd C/O Sbi Main Branch, Demat Section, Opposite Jail Road Junction, Near Redham Gardens,530002,9949324544. Standard Chartered Securities (India) Ltd. Vijayalakshami Nilayam, 1st Floor, 10-
50-81, Rock Dale Layout, Waltair Main Road,530002,2739420.
AGRA : Bajaj , Shop No. 110, Ground Floor, Block No. 27/2/4, Sanjay Palace, Tel - 0562-6457307; ICICI Sec ,Mr. SUSHANT BEJROI,13A, 1St Floor,Sadar Bazar,,AGRA- 282002; KARVY,F4, 1st FLOOR, DEEPAK WASAN PLAZA,SANJAY PLACE, (BEHIND HOLIDAY INN),AGRA,Tel - 2526660 / 63; Kotak Sec ., 2/220, Glory Plaza, M.G Road,P: 5538760; RR Equity, 9, Sbi Colony, 1st Floor, M.G.Road, Tel - 9319087289; SMC
,Mr. R N Gupta,F- 4, Block No 35, Surya Kiran Building ,Sanjay Place ,Tel - 7520787708; AHMEDABAD: Bajaj , 2-L, Akik ,Mithakhali Six Raod, Ellisbridge, Ph: 079-64500171, 72; Centrum ,Mr. Rajesh Subramanian,A/1, Narnarayn Complex,Swastik Char Rasta, Navrangpura, Ahmedabad - 380009,Tel - 079-40089176; Eureka , Block, R No. 405-A, Near 10 C, Petrol Pump, Satellite, Tel 09428792938/09376643939; ICICI Sec
,Mr. KRUNALNANAVATI,Shop no 6, Sun complex,C.G. Road,,AHMEDABAD - 380009;ICICI Sec ,Mr. ABHISHEKSHARMA,First Floor Shop No 119,Akshar Commercial Complex,Satellite Road; ICICI Sec ,Mr. RAVI SETHIA,Ground Floor, Shop No 4 & 5,Shilp Corner, Subhash Chowk,Gurukul Road, Memnagar,AHMEDABAD -380052;ICICI Sec ,Mr. HETALPATEL,First Floor, Shop No. 106/107,Krishnabaug Char Rasta,Kesharkunj
Complex Maninagar,AHMEDABAD - 380008;ICICI Sec ,Mr. AALAP SHAH,Ground Floor Shop No 39,40,41,42,Sarjan 2, 100 Feet Road,Sarjan 2,New C.G Road,Chandkheda,AHMEDABAD - 382424;ICICI Sec ,Mr. AKHILESH TIWARI,Sardar Centre, Grd Floor,Shop no. 31 to 35, Vastrapur,AHMEDABAD - 380015;ICICI Sec ,Mr. VRUNDASHASTRI,Shop No. 1,2,3,4,Suvas Complex, 1St Floor Shahibaug.,AHMEDABAD - 380004;
JM Financial , Mr Bhavesh Shah/Mr.Girish Shah, G-10 Chinubhai Centre,Gr. Flr, Nehru Bridge Corner,Ashram Road, Ph:079-2657 6666 70; KARVY,7 - 8, 2ND FLOOR, 3RD EYE BUILDING,PANCHVATI CIRCLE, C.G.ROAD,,AHMEDABAD,Tel - 079-26407543,44; KARVY,27, SUMAN TOWER, 1ST FLOOR,SECTOR NO.11,GANDHINAGAR,Tel -079-23240166; Kotak Sec ., 207, 2ndFloor, Sakar-II, Ellisbridge Corner, Ashram
Road.P:26587276; Kotak Sec Ltd., 201/A, Amruta Arcade, Nr Maningr Char Rasta, Maningr; Kotak Sec ., B/104, 1st Floor, Premium House, P:26579567; Kotak Sec ., B-46, Kamdhenu Complex, Panjara Pole, Ambawadi.P:26308035; Nitin Parikh, 101, Akash Ganga, Nr. Munshi Nursing Home,Gujarat College Road, Ellisbridge, Tel - 2640 4510-13/ 4020 6900; Pravin Ratilal, Sakar-I, 5
th
Floor, Navrangpura, Ahmedabad 380009,
Tel 26553700; RR Equity, 401, Abhijit-1, Mithakhali, 6 Road, Navrangpura, Ahmedabad-390009 079- 40211888; Standard Chartered ,Attn : Shainy Vani,101, Popular House, Ashram Road, Ahmedabad - 380009 ,Tel - 9974160266;Standard Chartered ,Attn : Dewal Dave ,101, Popular House, Ashram Road, Ahmedabad - 380009 ,Tel - 9825551124; SMC ,Mr. Jimeet Seth,10-A, Kalapurnam,C G Road , Ahmedabad 380003 ,Tel
- 9825612323;SMC ,Mr. Kartik Dave,3rd Floor, Sun City House, Besides Pantaloon, MithaKhali Six Road, Ahmedabad - 380009. ,Tel - 9427181917; Sharekhan Ltd,201/202/301,Dynamic House,Near Vijay Cross Road,Navrangpura,Ahmedabad,380009,Tel - 079- 66060141; ALLAHABAD : ICICI Sec ,Mr. VIKRAM SINGH,27/17, 1St Floor,Algin Road, Civil Lines,,ALLAHABAD - 211001; KARVY,2nd Floor, RSATower,57, Sardar Patel
Marg, Civil Lines,,ALLAHABAD,Tel - 2260291-92-93; Kotak Sec ., M-4, Mezzanine Floor, LDACenter, 2, Sardar Patel Marg, Civil Line.P: 2561451; AMRITSAR : ICICI Sec ,Mr. SAURAV GUPTA,3, Lawrence Road,AMRITSAR - 143002; KARVY,72-ATAYLORS ROAD,OPP.AGAHERITAGE GANDHI GROUND,AMRITSAR,Tel - 5053802/3/4/5; Kotak Sec ., Unit No.FUF-7, Central Mall, 32, Mall Road; AMBALA : KARVY,5509,
NICHOSON ROAD,ADJACENT KOS HOSPITALAMBALACANTONEMENT,AMBALA,Tel - 3200223 / 2640668; ASANSOL: KARVY,18 G T ROAD,3rd FLOOR,,ASANSOL,Tel - 2214623, 2214624, 2214625; ANAND : KARVY,F-6, Chitrangana Complex,Opp: Motikaka Chawl ; V V Nagar,ANAND,Tel - 248980/248873; Kotak Sec ., 3rd Floor, Sanket, Near Grid.P: 2573311; RR Equity, G-1, Silver Oaks, V.V.RoadAnand Gujarat 388001
9377306968; Sharekhan Ltd,F-5 Prathna Vihar,Anand Vidya Nagar Road,Anand,Gujarat,388001.,Tel - 02692-245614/15/16; AURANGABAD : ICICI Sec ,Mr. BHAVESH BHANUSHALI,Gr. Floor, Ghai Chambers,Jalna Road,,AURANGABAD- 431001; KARVY,SHOP NO.214/215,TAPADIYACITY CENTRE, NIRALABAZAR,AURANGABAD,Tel - 23635309665066500; BANGALORE: Bajaj , Unit 104-107, First Floor, A Wing, Mittal
Towers, M.G. Road, Bangalore 560001, Ph: 080-65471121, 65471123; Centrum ,Mr. Vikas Pathania,#194,Akruti Chambers, Binnamangala II, Double Road, Indaranagar, Bangalore 560038,Tel - 080-32218880/ 09686450949; Enam Sec, 10/3, Ground Floor, No.29, Empire Infantry, Infantry Road, Tel 40333222; ICICI Sec ,Mr. NAVEEN GOWDA,73/1-1, Krishna ,Infantry Road,BANGALORE - 560001;ICICI Sec ,Mr. RAVIKANTA
K,First Flr, CNN & Yashosha Complex,No.87 , HBCS Layout, Basweswar Nagar,,BANGALORE - 560079;ICICI Sec ,Mr. SRINIVASAN GOPALAKRISHNAN,First Floor, No. 9/1,Cambridge Road Layout, First Cross,,BANGALORE - 560008;ICICI Sec ,Mr. VIPINTRIVEDI,First Floor, No.778/A,Chinnaswamy Chambers, off CMH Road,Indira Nagar.,BANGALORE -560038;ICICI Sec ,Mr. SHASHIKANTH RAO,Sriranga Complex, No.
77, First Floor,Dr. Modi Road,2Nd Stage West of Chord Road,,BANGALORE - 560086;ICICI Sec ,Mr. PIYALI ROYCHOWDHURY,First Floor No.50 Little Plaza,CunninghamRoad,,BANGALORE - 560052;ICICI Sec ,Mr. PRAKASH SRIVASTAVA,First Floor,135/5, 15Th Cross,100 Ft Ring Road,3Rd Phase J P Nagar,BANGALORE - 560078;ICICI Sec ,Mr. MALLIKARJUN KUBSAD,First Floor, No 81/B 22Nd Cross,Jaya Nagar, 3Rd
Block,BANGALORE- 560041;ICICI Sec ,Mr. KULDEEP KALYANKUMAR,No:399 ,White Gold,1St Floor,24Th Cross, Bhanashankari II Stage,BANGALORE- 560070;ICICI Sec ,Mr. AMITABH KUMAR,Second Floor, No:4C-402 HRBR Layout Kamanahalli,II Block,BANGALORE -560043;ICICI Sec ,Mr. SATYAJEET SHARMA,First floor No. 209, New BEL Road,BANGALORE - 560054;ICICI Sec ,Mr. SUKESH KS,#105, A.E.C.S. Layout
2Nd Stage 5Th Main Post Officeroad,Sanjay Nagar Main Road,BANGALORE - 560094;ICICI Sec ,Mr. MANISH KUMAR,6/1, Ghandi Bazar First Floor,Basavanagudi,Main Road, Gandhi Bazar.,BANGALORE - 560004;ICICI Sec ,Mr. NARENDRA KUMAR,No.2, 100Ft Ring Road, Katriguppa Circle,Bhanashankari III Stage,BANGALORE - 560085;ICICI Sec ,Mr. DHANANJAY KUMAR,No 72/1-B,Kanakapura,Mani Road
Jarganahalli,BANGALORE - 560078;ICICI Sec ,Mr. MANISH KUMAR SINGH,290/1, 11Th Cross,WilsonGarden,BANGALORE - 560027;ICICI Sec,Mr. ,No.20, 1St Main,Gandhinagar,BANGALORE - 560009;ICICI Sec ,Mr. ,No. 46, 100 Feet Road,First Floor, Koramangala, 6th Block,,BANGALORE - 560095;ICICI Sec ,Mr. ,147, First Floor, Anjaneya Complex,Hal Airport Road,; JM Financial ,Mr Yeriswamy Reddy, 97/4 Residency
Rd, Ph:-080- 30912400/2299 8264/65/66/67; KARVY,NO.746, 1STFLOOR, KRISHNATEMPLE ROAD,INDIRANAGAR 1ST STAGE,INDIRANAGAR,Tel - 25264344 / 2930 ; KARVY,165 & 166, MANJUNATHACHAMBERS,SHANKARNAGARMAIN ROAD,BANGALORE,Tel - 23375292, 23471375;KARVY,SKANDA NO 59,PUTANAROAD, BASAVANAGUDI,BANGALORE,Tel - 26621192 / 93; Kotak Sec ., Umiya Landmark
II Flr., No:10/7 -Lavelle Rd.P: 66203601; Kotak Sec ., no 201, soundrya sampige complex, Sampige Road, No 412, 8th Cross, Malleswaram. P: 9900133758; RR Equity, S-111,Manipal Centre,47,Deckenson Road,Banglore-42 080-42477177; Standard Chartered ,Attn : P.V. Arvind Kumar,Ground Floor, Sri Bhavana Thilaka, 4/2 Millers Road, Bangalore - 560052. ,Tel - 9632200224;Standard Chartered ,Attn : Deepak R.S.,J.R. Complex,
No.21/1, Hosur Main Road, Nanjappa Layout, Adugodi, Bangalore - 560030. ,Tel - 080 - 22108140 / 41 / 42; SMC ,Mr. Parag Bisht,Premises # 7,8,9,10,Ground floor,Gold Tower,#50(old # 98),Residency Road,Bangalore 560025 ,Tel - 9739112254; Sharekhan Ltd,#2307, Swanlines Building, 12th Main Road, Jayanagar 3rd Block East, Bangalore - 560011,Tel - 080 - 42876666; BAREILLY : KARVY,1ST FLOOR, 165, CIVIL
LINES,NEAR RAILWAY STATION,BAREILLY,Tel - 2574238 TO 39; Sharekhan Ltd,148 Civil Lines,Bareilly,243001,(U.P.),Tel - O581-2510922 /925; BELGAUM : KARVY,FK-1, KHIMAJIBHAI COMPLEX,AMBEDKAR ROAD, OPP: CIVILHOSPITAL,BELGAUM,Tel - 2402544 / 722 / 880/ 3095262; Kotak Sec ., Shri Laxmi Sankul Complex, T-01, 3
rd
Flr, Maruti Galli, P: 4203033; BHARUCH: KARVY,FF 47/48, ADITYACOMPLEX,OPP:
KASAK FUWARA,BHARUCH,Tel - 225207, 225208,209; Kotak Sec ., 235-236, Harihar Complex, Zadeshwar Road.P:570569; BHATINADA: KARVY,2048, 1ST FLOOR,THE MALL ROAD,BHATINDA,Tel - 5006725 TO 727 ; BHILWARA : KARVY,27-28, 1ST FLOOR, HEERA-PANNACOMPLEX,PURROAD,BHILWARA,Tel - 246362 / 246364 / 512586; BHILAI : KARVY,NEWCIVIC CENTE SHOP NO 138,0,BHILAI,Tel - 2295329
/ 37 / 32; BHOPAL: Bajaj , Shop No. 6, First Floor, Jyoti Cinema Complex, M.P. Nagar, Zone1, Bhopal 462011, Ph: 0755-6459550; ICICI Sec ,Mr. VINIT KARMALEKAR,2, Malviya Nagar, BHOPAL- 462001; KARVY,KAY KAY BUSINESS CENTRE,133, ZONE 1, MP NAGAR,BHOPAL,Tel - 4092701 TO 704 ; Kotak Sec ., Third Floor, Alankar Palace, 10-11, MPNagar, Zone 2.P: 5248133; Standard Chartered ,Attn : Amit Malviya,K.K.
Plaza, Plot No. 1, Zone 2, Maharana Pratap Nagar, Bhopal - 462011. ,Tel - 9826321605; BHUBANESHWAR: Bajaj , Plot No. 1/A, Ground Floor, Station Square, Kharvel Nagar, Bhubneswar - 751001, Ph: 0674 - 6451257, 6451269; ICICI Sec ,Mr. ,GroundFloor,Plot No-99,Janpath,Unit-3,Kharbelnagar,BHUBANESHWAR - 751001; KARVY,624, SAHEED NAGAR, IST FLOOR,JANPATH,BHUBANESWAR,Tel - 2547532 / 33 / 2547334;
Kotak Sec ., Plot No 24, 2nd Flr., SCR, Nr Bazaar Kolkata, Bapuji Nagar, Janpath.P: 2597871; RR Equity, 3-4Anand Plaza, Laxmi Sagar ,Square Cuttack Road, Bhubaneshwar Orissa 751009 9861196880, 9861196880; Standard Chartered ,Attn : Navjot Kaur,5, Janpath, Unit - 3, Kharavel Nagar, Bhubaneswar - 751001 ,Tel - 9861727932; BURDWAN : KARVY,BIRHATA(HALDER COMPLEX),63, G T ROAD,BURDWAN,Tel
- 2550801; BHAVNAGAR : KARVY,301, 3RD FLOOR,SURABHI MALL,WAGHAWADI ROAD,BHAVNAGAR,Tel - 2567005, 06,3001004,05; RR Equity, 251 Madhav Darshan,Waghawadi Road Bhavnagar Gujarat 364001 0278-2522120, 9426235681; Sharekhan Ltd,Gangotri Plaza, 8A3rd Floor , Opp Dakshinamurti School , Waghawadi Road, Bhavnagar -364002.,Tel - 0278 - 2573938-39; BIKANER: ICICI Sec ,Mr. SANDEEP
JAIN,Gr. Floor, 44, Panchshati Circle,Sadulganj,,BIKANER - 334001;BOKARO : KARVY,B-1,FIRST FLOOR,CITY CENTRE,NEAR SONACHANDI, SECTOR-4,BOKARO STEELCITY,Tel - 233330/31/32; RR Equity, Ga-18,City Center Sector-4 Bakaro Steel City, Jharkhand-827004, 9835139765, 9835377584; CALICUT: KARVY,FIRST FLOOR, SAVITHRI BUILDING,OPP.FATIMAHOSPITAL, BANK ROAD,CALICUT,Tel - 2760882
/ 2760884 / 2760883; CHANDIGARH : Bajaj , SCO 341 - 342, First Floor, Sector 35B, Chandigarh 160036, Ph: (0172) , 6451612 13; ICICI Sec ,Mr. RAJIV GOYAL,SCO-181/182,1st floor, Next to British Library,Sector 9C,CHANDIGARH - 160017; ICICI Sec ,Mr. AMIT TYAGI,Sco 62,Sec - 47C,,CHANDIGARH - 160047; KARVY,SCO 32, 1ST FLOOR, PHASE 7,S AS NAGAR,,MOHALI,Tel - 5091800/1, 5091802 (D);KARVY,SCO
32, 1ST FLOOR, PHASE 7, ,S AS NAGAR,,MOHALI,Tel -5091800/1, 5091802; Kotak Sec ., SCO-14-15, 2nd Floor, Madhya Marg, Sector-8C.P: 5065301; RR Equity, SCO-222-223,Gr. Floor,Sector-34A, Chandigarh 0172-2624896; Standard Chartered ,Attn : Mukesh Singh,Sco-35-F.F,Sec-21-C,Chandigarh,Pin -160021 ,Tel - 9023488999; Sharekhan Ltd,SCO : 185,1st Floor, Sector 38-C, Chandigarh-160036 (Punjab),Tel - 0172-
4643000; CHENNAI : Bajaj , Wellington Plaza, 3rd Floor, 90, Anna Salai, Chennai 600002, Ph: 044-23451207, 08; Centrum ,Ms. A. Sangeetha,Ganesh Enclave, 39 Gopalapuram, 1st Street, Chennai 600 086,Tel - 044-49026006/ 9843707979; Eureka , Karnani Archieves, 154, Pycroft Road, Tel 9884710122; Enam Sec, 11, Vijay Delux Apts, 7/4, First Main Road, Cit Colony, Mylapore, Tel 39184335/4226; ICICI Sec ,Mr.
SHANMUGAM S,Shop No. 10 & 11Arihant Vaikunt, No 123,Brick Kiln Road,'Purasawalkkam ,,CHENNAI - 600007;ICICI Sec ,Mr. ,Ashok Sriranga, No.1,9Th Street,Nanganallur,CHENNAI - 600061;ICICI Sec ,Mr. KUMARESHJ,Ground Floor, Plot No. 1072Munusamy Salai, Next to Pondicherry Guest House,West K KNagar,CHENNAI - 600078;ICICI Sec ,Mr. SUNEESH EM,405, Tiruvalluvar Salai,Mogappair,Paneer Nagar,CHENNAI
- 600037;ICICI Sec ,Mr. ,First Floor T-1, Yesesi Supermarket Building,Annanagar,CHENNAI - 600040;ICICI Sec ,Mr. STENNY SEBASTIAN,Flat No 4, 70/27,North Mada Street Mylapore,CHENNAI - 600004;ICICI Sec ,Mr. PRIYADHARSINI G,475 Kilpauk Garden Road,Kilpauk,CHENNAI - 600010;ICICI Sec ,Mr. ,PVM Complex, Plot No 1& 2,VGPVimala Nagar, Velachery Main Road, Medavakkam,,CHENNAI - 600100;ICICI Sec
,Mr. ,1,3Rd Cross Street Kasturibai Nagar, Adyar,CHENNAI - 600020;ICICI Sec,Mr. SARAVANANB,Ground Floor, No. 17,Arunachalam Road Saligramam,CHENNAI - 600093;ICICI Sec ,Mr. PANCHAPAKESAN S,Shop No. 2,Century Plaza,560-562,Annasalai, Teynampet,CHENNAI - 600018;ICICI Sec ,Mr. SYED IBRAHIM,No. 228, Thambu Chetty Street, Parrys,CHENNAI - 600001; JM Financial ,Mr. Kalai Selvan, Gee Gee Crystal
- 5th Floor,91-92. Dr.Radhakrishnan Salai,Mylapore, Ph:044-4225 5666; KARVY,G-1, SWATI COURT, 22, VIJAYARAGHAVAROAD,T NAGAR,CHENNAI,Tel - 28151034 / 28153445 /42126406; KARVY,T-92, Ground Floor,3rd Avenue Main Road,Near Hotel Nalas Appa Kadai,Annanagar -CHENNAI,Tel - 26224482,42103538,39; Kotak Sec ., GRR Business Cneter, No.21, Vaidyaraman Street, T Nagar.P:66462000; RR Equity, 3rd
Flr.,Percision Plaza,New -397, Teynampet, anna Salai, Chennai- 600018 044-42077370/71; Standard Chartered ,Attn : Deva Rajulu,W-123, 1st floor, 3rd Avenue, Anna Nagar, Chennai - 600040,Tel - 9841019780;Standard Chartered ,Attn : Mohan K. S.,Jamals Santhini, 1/1, II nd Main Road, Seethammal Colony, Alwarpet, Chennai - 600018. ,Tel - 24328944 / 24329759 ; SMC ,Mr. L Padamanaban,2nd Floor, A Mookambika
Complex,No.4, Lady Desikachari Road,Mylapore, Chennai - 600004,Tel - 9884885541; Sharekhan Ltd,G-2,Salzburg Square,107-Harrington Road,Chetpet,Chennai,600031,Tel - 044-28362800; COIMBATORE: Bajaj , No. 575, D.B. Road, First Floor, R.S. Puram, Coimbatore 641002, Ph: 6470136, 38; ICICI Sec ,Mr. SARAVANAN .K,444, X-Cut Road,Gandhipuram,Coimbatore,COIMBATORE - 641012; KARVY,JAYAENCLAVE
ICICI SECURITIES LIMITED
A. K. STOCKMART PRIVATE LIMITED
Ahmedabad : Ashika Stock Broking Limited , Mr Rahul Mall , 9836106132 , 226/1, Trinity Bldg, Ajc Bose Road, 7th Floor, Minto Park, Kolkatta 700020 , Gujarat ; Edelweiss Broking Limited , , , Office No. 402, 4th Floor, 3rd Eye One, Opp. Havmore Restaurant, Panchvati 380006 , Gujarat ; Enam Securities Pvt Ltd , Branch Manager , , Shivdhara 7th Floor Cloth Commercial Centre Sakar Bazar Kalupur 380002 , Gujarat ; Ifci
Financial Services Ltd , Mr Sandip Kachhadiya , 40328915 , 303 Olive Archade Opp Samudra Annexe Off Cg Road 380009 , Gujarat ; Jm Financial Services Private Limited , Branch Manager , 26576666,70 , G-10 Chinubhai Centre Gr Floor Nehru Bridge Corner Ashram Road 380009 , Gujarat ; Karvy Stockbroking Ltd , , , 7 - 8, 2nd Floor, 3rd Eye Building Panchvati Circle, C.g.road Ahmedabad 380006 , Gujarat ; Kifs Securities
Ltd , Ajay Dave , 079-3000321, 9909930683 , B/81, Pariseema Complex C.g. Road, Navrangpura 380006 , Gujarat ; Kotak Securities Limited, , , , 2nd Floor, Sakar-ii, Ellisbridge Corner, Ashram Road , Gujarat ; Kunvarji Finstock Pvt Ltd , Daxit Mehta , 079-66147009 , Dakshit Shyamak Complex Nr Kamdhenu ComplexAmbawadi 380015 , Gujarat ; Marwadi Shares And Finance Limited , Raj Jivrajani , 9727724629 , Amazone
Corporate Park - Part 4 B/H Navrangpura Post Office Choice Restaurant Lane Off C.g.road 380009 , Gujarat ; Monarch Project & Finmarkets Ltd , Jignesh Nimbark , 9879523481 , Monarch House, Opp Ishwar Bhuvan, Commerce Six Road, Navrangpura 380014 , Gujarat ; Motilal Oswal Securities Limited , Sanket Jani , 30078120, 8121 , Bearing No. G-6/7/8/9 &10 Citypride Complex Near Nalanda Hotel Mithakali Circle Navrangpura
380009 , Gujarat ; Motilal Oswal Securities Limited , Tejas Shah , 9879056565, City Pride GroundFloor Mithakali Six Roads 380006 , Gujarat ; Nitin Parikh & Co , Rajendra Dlawadi , 9825024636 , 101 Akashganga Nr Dr MunshinursingHome Gujarat College Road Ellisbridge -380006 , Gujarat ; Nitin Parikh Brokerage Services Limited , Nitin Bhanukant Parikh , 9825014640 , 101, Akashganga, Gujarat College Road, Ellisbridge,
380006 , Gujarat ; Pravin Ratilal Share And Stock Brokers Ltd , P Sharedalal , 9327023684 , Sakr I, 5th Flr, Opp Gandhigram Rly Station, Navrangpura, 380009 , Gujarat ; Sharekhan Ltd , Mr.sanjay Patel , 079 - 66060141, 42 , 43 , 6606 0150. 98250 36398, 98791 11960- , 201/202, Dynamic House Near Vijay Cross Rd Navrangpura380009 , Gujarat ; Tata Securities Limited , Chirag Pawar , 9974313420 , 1st Floor, Shanti Arcade,
1 Ktan Soctiety Nr.b.d.patel House Narnpura 380013 , Gujarat ; Way 2 Wealth BrokersPvt Ltd , Govind Chaudhari , 7600017727 , 304, Iii Floor, 3rd Eye Building Panchavati Cross Road, C GRoad 380009 , Gujarat ; Bangalore Ifci Financial Services Ltd , MrAnil B S , 32557222 , No.7 2nd Cross Csi CompoundMission Road 560027 , Karnataka ; Jm Financial Services PrivateLimited , Branch Manager , 30912400,22998264,65,66,67
, 97/4 Residency Rd 560025 , Karnataka ; Kotak Securities Limited , , , Umiya Landmark-ii Flr., No:10/7 -lavelle Rd , Karnataka ; Stock Holding Corporation Of India Ltd , Anupama Sinha , 22995236 , Blore Stock Exch. Towers 51, 1 Cross, J.c. Road 560027 , Karnataka ; Way 2 Wealth Brokers Pvt Ltd , Aby George , 9987922211 , F-102 Suraj Plaza, 196 8/8, 8th Floor,Main Raoad 25th Cross, 3rd Block Jayanagar 560011 ,
Karnataka ; Way 2 Wealth Brokers Pvt Ltd , Janardhan , 080-40868927 , Ground Floor, Coffee Day Square Annex, Vittal Mallya Road 560001 , Karnataka ; Bhubaneswar : Skp Securities Ltd , , 0674 6544937 , 45/46 Ashoknagar, 2nd Floor, Janpath 751009 , Orrissa ; Calicut : Ifci Financial Services Ltd , Mr Nijoy Jose , 3211770, 4022005 , Faremont Building1st Floor, Wayanadu RdEranhipalam Po 673006 , Kerala ; Chandigarh
: Ifci Financial Services Ltd , Mr Harjit , 8699010371 , Ifci Bhawan , 1- C, Sector- 27 AMadhya Marg 160019 , Chandigarh ; Indiabulls Securities Ltd , Goldy Aggarwal , 9876369999 , Sco 477-478 Sector 35 C 160035 , Chandigarh ; Chennai : Dsp Merrill Lynch Limited , Rajini Nagarajan , 43911704 , # 801- 803 Sigma Wing 8th Floor BlockA, Raheja Towers, Annasalai 600002 , Tamil Nadu ; Ifci Financial Services Ltd , Mr Narayan/
Ms Ambika Priya , 28306600 , 142Mahatma Gandhi Road NungambAkkam 600034 , Tamil Nadu ; Jm Financial Services Private Limited , Branch Manager , 42255666 , GeeGee Crystal 5th Floor 91-92. Dr.radhakrishnan Salai Mylapore 600004 , Tamil Nadu ; Standard CharterdSecurites (India) Limited , Branch Manager , 26264500, 4300 , W-123 1st Floor 3rd Avenue Anna Nagar 600040 , Tamil Nadu ; Stock Holding Corporation
Of India Ltd , Srinithya , 044-25340766 , 25340725 , Justice Basheer Ahmed Sayeed Bldg, 3rd Floor 45,Moore Street, Second Line Beach 600001 , Tamil Nadu ; Way 2 Wealth Brokers Pvt Ltd , Nagalakshmi , 044-42201512 , Wing E, 2nd Floor, Rnj Enclave, No.11, Mahalingapuram Main Road, Nungam Bakkam 600034 , Tamil Nadu ; Chidambaram : Indo Thai Securities Limited , SaurabhMunot , 9994018624 , 41/2 Bazar Street
608001 , Tamil Nadu ; Cochin : Geojit Bnp Paribas Financial Services Ltd , K.bipin Murali , 9987049917 , 5th Floor Finance Towers Kaloor 682017 , Kerala ; Stock Holding Corporation Of India Ltd , Reshmi Antony , 2397402 , 4th Floor,Kurian Towers Opp.saritha Theatre Banerjee Rd,Ernakulam-682018 , Kerala ; Dehradun : Anand Rathi Shares & Stock Brokers Limited , Vipul Mehrotra, 0135-2655438, 9359949313 , Anand Rathi,
29 Rajpur RoadAnekant Palace ,Dehradun 248001 , Uttaranchal ; Gurgaon: Indiabulls Securities Ltd, Rakesh Kumar , 3082164 , Plot No 448-451 Udyog Viharphase V Ndiabulls House 122016 , Haryana ; Indiabulls Securities Ltd , Sudesh Kumar , 9354941910 , 12th Floor Tower ABuilding No. 5 Dlf Phase Iii, Dlf Cyber City 122016 , Haryana ; Hyderabad Edelweiss Broking Limited , , , 2nd Floor, M. B. Towers, Plot No. 5, Road
No. 2, Banjara Hills 500034 , Andhra Pradesh ; Enam Securities Pvt Ltd , Branch Manger , 39893626, 0-3, 650/217 B&C, Maheshwari Chambers, 2nd Floor, Somajiguda 500082 , Andhra Pradesh ; Ifci Financial Services Ltd , Mr SatishAddala , 040-23410491 , My Home Laxmi NivasAppt Flat No-104 Green Lands Ameerpet 500016 , Andhra Pradesh ; Jm Financial Services Private Limited , Branch Manager , 66360009,10,12,46
, 9-10 Uma Chambers 3rd Floor Banjara Hills 500034 , Andhra Pradesh ; Karvy Stockbroking Ltd , , , 46, Avenue 4, Street No.1, Banjara Hills 500034 , Andhra Pradesh ; Motilal Oswal Securities Limited , Gopal Majhi , 040-30624444/45/ 30624447 (Fax) , 201, Lumbini Amrutha Chambers,Near Nagarjuna Circle, Road No.3, Banjara Hills,-380009 , Andhra Pradesh ; Motilal Oswal SecuritiesLimited , Gopal Majhi , 040-30624444
, 201, Lumbini Amrutha Chambers,Near Nagarjuna Circle, Road No.3, Banjara Hills-500082 , Andhra Pradesh ; Sharekhan Ltd, Mr. Ranga Rao , 040 - 66827469-70. 093473 06668, 92463 31604 , 7-1-22/3/1-5/C, Afzia Towers 1st Floor Begumpet 500016 , Andhra Pradesh ; Standard Charterd Securites (India) Limited , Branch Manager , 23417032, 36 , Ug - 13 Mekins Maheshwari Mayank Plaza6-3-866 / 1 / AGreenlandsAmeerpet
500016 , Andhra Pradesh ; Way 2 Wealth Brokers Pvt Ltd , Sailaja , 040-4561239 , 6-3-571/1/5 Rock Vista 2nd Floor Rock Dale Compound Somaji Guda 500082 , Andhra Pradesh ; AK Stockmart Pvt Ltd , Sravan Reddy , 040-66759862 , 5-9-93/1, Sakhti Sai Complex, 207, 2nd Floor, Chapel Road 500001 , Andhra Pradesh ; Indore: Arihant Capital Markets Limited , Arvind Sharda , 9977250700 , F-1, Ahinsa Tower, 7, M G Road,
452001 , Madhya Pradesh ; Jaipur : Anand Rathi Shares & Stock Brokers Limited , Shivprashad Sharma , 9783800316 , C-98, Sanghi Upasana Tower, Subhash Marg, C-scheme 302001 , Rajasthan ; Indiabulls Securities Ltd , Gajraj Choudhary , 9413300066 , Office No. 331 & 332 Third Floor Ganpati Plaza M I Road 302001 , Rajasthan ; Nirmal Bang Securities Private Limited , Sushil Shrimal , 3093700, 9829126654 , 201 2nd
Floor Sangam Tower Church Road 302001 , Rajasthan ; Jamshedpur : Skp Securities Ltd , , , 45 Kamani Centre, 2nd Floor, Bistupur, 831001 , Jharkhand ; Skp Securities Ltd , , , 45 Kamani Centre, 2nd Floor, Bistupur, 831001 , Jharkhand ; Kanpur : Indiabulls Securities Ltd , Pramod Nigam , 9935282204 , 304 & 305 3rd Floor, Krishna Tower Civil Lines 208001 , Uttar Pradesh ; Kolkata : Ashika Stock Broking Limited , Ravi
Mundra , 9007066197 , 223/1 Trinity Bld Ajc Bose Rd 7th Floor Minto Park 700020 , West Bengal ; Aum Capital Market PrivateLimited , Navin Rustagi , 9831959243 , Akashdeep 1st Floor Lower Rawdon Street Mintopark 700020 , West Bengal ; Bonanza Portfolio Limted , Astha , 9007070514 , 1 Gibson Lane, Room No. 105 Behind Orient Cinema Bentinck Street 700069 , West Bengal ; Dsp Merrill Lynch Limited , Milan Doshi
, 033-22829875 , 7/1 Lord Sinha Road, Room No 407 Kolkata- 700071 , West Bengal ; Edelweiss Broking Limited , , , 2a And 2b, Savitri Towers, 3a Dr. Martin Luther King Sarani, Upper Wood Street 700017, West Bengal ; Enam Securities Pvt Ltd , Branch Manger , 3.24631e+15 , S-205,Ideal Plaza, 11/1, Sarat Bose Road 700020 , West Bengal ; Eureka Stock & Share Broking Services Ltd. , Samit Patra , 9051172648 , Gilander
House E Block 8 N S Road Ground Floor 700001 , West Bengal ; Ifci Financial Services Ltd , Mr Umashankar/ Mr Rohit Mahipal , 32011083, 44026213 , Chatterjee International Centre, 3rd Floor 33-a Jawaharlal Nehru Road 700071 , West Bengal ; Indiabulls Securities Ltd , Preeti Ojha , 9874265097 , Lee Commerce, 26 Lee Road Lee Residency, Second Floor 700020 , West Bengal ; Jm Financial Services Private Limited
, Branch Manager , 39870330 , Kankaria Estate 8th Floor 6th Little Russell Street 700071 , West Bengal ; Karvy Stockbroking Ltd , , , 19 R N Mukherjee Road 2nd Floor Kolkata 700001 , West Bengal ; Kotak Securities Limited , , , 7th Floor, Apeejay House, Block C, 15, Park Street , West Bengal ; Microsec Capital Limited , Nishikant Mehta , 9830036610 , 1st Floor Shivam Chambers 53 SyedAmir Ali Avenue 700019 , West
Bengal ; Motilal Oswal Securities Limited , Snehalata Dubey , 9830665717 , 3rd Floor Constantia Bldg 11 Dr U N Brahmachari Street 700017 , West Bengal ; Sharekhan Ltd , Mr. Nilesh Shah , 033 - 22830055, 22805555. 98300 63749 , Kankaria Estate 1st Floor 6-little Russell Street 700071 , West Bengal ; Skp Securities Ltd , Anjan Majumder , 9830628184 , Level 21 Chatterjee International Centre 33 AJawaharlal Nehru Road
700070 , West Bengal ; Standard Charterd Securites (India) Limited , Branch Manager , 22137028, 33 , Mangalam Bldg 24 & 26 Gr Floor Hemanta Basu Sarani Dalhousie 700001 , West Bengal ; AK Stockmart Pvt Ltd , Dinendra Arya/ Nilesh Khandelwal , 033 22882644 , Om Towers,Unit No.1408, 14th Floor,32,J.l.nehru Road,700071 , West Bengal ; Lucknow : Anand Rathi Shares & Stock Brokers Limited , Soni Singh , 0522-
2208544,9415568907 , Anand Rathi, 27/6/1, Taj Plaza , Madan Mohan Malviya Marg, , , Lucknow - 226001 , UttarPradesh ; Ludhiana: Anand Rathi Shares & Stock Brokers Limited, Amandeep Kaur , +91 161 662 8700 , #15, San Plaza, 2ndFloor, Feroze Gandhi Market, Ludhiana. - 141001 , Punjab ; Anand Rathi Shares & Stock Brokers Limited , Amandeep Kaur , +91 161 662 8700 , #15, San Plaza, 2nd Floor, Feroze Gandhi
Market, Ludhiana. - 141001 , Punjab ; Mumbai : Amit Jasani Financial Services Pvt Ltd , Bijal Bakhai , 9820286603 , 301, Hind Rajasthan Chambers, 6, Oak Lane, Opp Gokul Restaurant, Fort, 400023 , Maharashtra ; Anand Rathi Shares & Stock Brokers Limited , Shekhar Margaje , 9820693039 , 4th Floor Silver Metropolis Jai Coach Compund Opp Bimbisar Nagar Goregaon East 400063 , Maharashtra ; Anand Rathi Shares
& Stock Brokers Limited , Rajendra Bait , 022-39950304 , Seagull House, 2nd Floor, Plot No.6, Shivaji Colony, Andheri-kurla Road, Chakala, Andheri (E) , Maharashtra ; Ashika Stock Broking Limited , Branch Manager , 61117000 , 1008, Raheja Centre, 10th Floor, 214 Nariman Point Mumbai-400021 , Maharashtra ; Asit C Mehta Investment Intermediates Limited , Vijay Hiralal Bhatt , 9769240709 , Nucleus House Saki Vihar Road
Andheri East 400072 , Maharashtra ; Asset Alliance Securities Pvt Ltd , P.j. Subbarao / Rakesh , 022-66101182,9820529866 , Latin Manharlal Securities 903 9th Floor P J Tower Bse Building Dalal Street Fort 400001 , Maharashtra ; Aum Capital Market Private Limited , Navin Rustagi , 022-40336900 , 403-404 Maker Bhavan No. 3 4th Floor 21 New Marine Lines 400020 , Maharashtra ; B P Equities Private Limited , Ketan Jain
, 61596262 , 307 MatharuArcade Subhash Road Vile Parle East 400057 , Maharashtra ; B P Equities Private Limited , Rahul G Kapadia , 9819747686 , 24/26 Cama Bldg Dalal Street, Fort 400001 , Maharashtra ; Bonanza Portfolio Limted , Rakesh Goyal , 9820593730 , Plot No. M-2, Cama Industrial Estate, Walbhat Road, Goregaon ( E ) 400063 , Maharashtra ; Centrum Wealth Management Limited , Mr. Rajesh Thadhani ,
9821501179,022-42159000,42159465 , Centrum House 4th Level Cst Road Vidya Nagari Marg, Kalina Santacruz (E) 400098 , Maharashtra ; Dalal & Brocha Stok Broking Pvt Ltd , Bhavesh Doshi , 9324611986 , 507 Maker Chambers V 221 Nariman Point 400021 , Maharashtra ; Dsp Merrill Lynch Limited , Unmesh Kulkarni , 9820662558 , 8th Flr, Mafatlal Centre, Nariman Point 400021 , Maharashtra ; Edelweiss Broking Limited
, Amit Dalvi , 9320331070 , 104 P J Towers Bse Building Fort 400001 , Maharashtra ; Emkay Global Financial Services Ltd , Pramod Rathod , 9833522839 , B - Ruby Mills Tower 7th Floor, South East Wing Senapati Bapat Marg Dadar (W) 400028 , Maharashtra ; Enam Securities Pvt Ltd , Digal Shah , , Solaris C Bldg 4th Floor Opp L& T Gate No 6 Saki Vihar Rd 400072 , Maharashtra ; Eurasia Investment Advisors Private Limited
, Arvind Kumar Pandey , 9820851977 , Kushesh Mansion, 1st Floor, 48/54, Janam Bhoomi Marg, Goga Street, Opp. Fort Central Rest 400001 , Maharashtra ; Fortune Equity Brokers(i) Limited , Harshad Mehta , 9892305181 , K K Chambers,2nd Floor, Sir P.t.marg,Fort, 400001 , Maharashtra ; Fortune Equity Brokers(i) Limited , Harshad Mehta , 9892305181 , 59 Sonawalla Building 1st Floor B S Marg Fort 400001 , Maharashtra
; Geojit Bnp Paribas Financial Services Ltd , K Bipin Murali , 9322302143 , 22b, Rajabahadur Mansion Ambalal Doshi Marg Opp Stock Exchange Post Office Fort 400023 , Maharashtra ; Hdfc Securities Limited , Sunil Raula , 9987095797 , I Think Techno Campus Building B Alpha Office Floor 8 Nr Kanjurmarg Stn Opp Crompton Greaves Kanjurmarg East 400072 , Maharashtra ; Ifci Financial Services Ltd , Mr Santanu Ray/ Mr
Kamlesh Vishwakarma , 43335111, 181, 184 , 2b(1), Film Centre Ground Floor, 61 Tardeo Road 400034 , Maharashtra ; Indiabulls Securities Ltd , Sandeep Mujumdar , 9820035823 , 8&9/F, Indiabulls Finance Centre, Tower, F P No 612,613, Of Tps Iv Mahim Division, Elphinstone Mills, Senapati Bapat Marg 400013 , Maharashtra ; Indo Thai Securities Limited , Dinesh Sancheti , 9820023882 , G-2 Rigal House 92/94 J.s.s. Road
Opera House 400004 , Maharashtra ; Integrated Enterprises (India) Limited , Sriram , 9833097271 , 15,1st Floor,Modern House Dr.v.b.gandhi Marg Fort 400023 , Maharashtra ; Jm Financial Services Private Limited , Branch Manager , 30877000, 67617000 , Palm Court M- Wing 4th Floor Goregaon Link Road Malad West 400064 , Maharashtra ; Jm Financial Services Private Limited , Branch Manager , 67104738, 30978700
, Apeejay House 3rd Floor Dinshaw Vaccha Road Near K CCollege Churchgate 400020 , Maharashtra ; Joindre Capital Services Limited , AP Shukla , 9322223426 , 32 Raja Bahadur Mansion Grnd Flr Opp Bank Of Maharashtra Mumbai Samachar Marg 400023 , Maharashtra ; Karvy Stockbroking Ltd , , , 24-b, Rajabahudur Mansion, Gr Floor 6 Ambalal Doshi Marg,Behind Bse Ltd Fort 400001 , Maharashtra ; Khandwala Securities
Ltd , Narayan Kotian , 9820041579 , Vikas Building Ground Floor Green Street Fort 400023 , Maharashtra ; Kjmc Capital Market Services Limited , Sanjay Kothari , 9321026970 , 168, Atlanta, 16th Flr, Nariman Point 400021 , Maharashtra ; Kotak Securities Limited , Rakesh Patel , 67409724 , Nirlon House 3rd Floor Dr Annie Besant Road Near Passport Office Worli 400025 , Maharashtra ; L & T Finance , Ajit Tole , 9004696518
, 3rd Floor C Wing Laxmi Tower Bandra Kurla Complex Bandra East-400050 , Maharashtra ; Lalkar Securities Private Limited , Kapil Janak Thacker , 9819344077 , 5th Flr, Crescent Chambers, Tamarind Lane, Fort 400001 , Maharashtra ; Lkp Securities Ltd , Dinesh Waghela , 9821067167 , Above Bank Of Maharashtra Building, 45/47 , Mumbai Samachar Marg ,Opp. Bse, Fort 400001 , Maharashtra ; Mf Global Sify Securities
India Pvt Ltd , Rezaur Rahman , 9920016970 , No 1, 2nd Flr, C Block, Modern Centre, K K Marg, Jacob Circle, Mahalaxmi 400011 , Maharashtra ; Money Honey Financial Services Private Limited , Mr Anupkumar Ghanshamdas Bhaiya , 9820452811 , 1st Floor, Nahar Singh Industry Building Opp Movie Star Cinema Ram Mandir Goregaon-w 400104 , Maharashtra ; Motilal Oswal Securities Limited , Vinith Poojari , 9167364912
, Queens Mansion 2nd Floor AK Nayak Marg Behind Khadi Gramudyog Fort 400001 , Maharashtra ; Motilal Oswal Securities Limited , Vinith Poojari , 9820596262 , 9th Floor Bajaj Bhavan Nariman Point 400021 , Maharashtra ; Nirmal Bang Securities Private Limited , Monika Bafna , 30274514, 7738380099 , B - 201, Khandelwal House Poddar Road Near Poddar Park Malad (E ) 400097 , Maharashtra ; Prabhudas Lilladher
Pvt Ltd , Mr. Manish Bhatt / Nilesh , 022-66322222,91 , 3 Rd Floor, 570 Sadhana House P. B. Marg, Behind Mahindra Tower Worli 400018 , Maharashtra ; Reliance Securities Limited , , 32095882 , AWing, Office No-401/402 Victory Park, Chandrawarkar Road , Borivali(w) 400092 , Maharashtra ; Religare Securities Limited , Chirag Parmar , 67288000 , 301/302, Viraj Tower, Gundavali, Western Express Hightway,Near Landmark
Building, Andheri (East), 400 093 , Maharashtra ; Sharekhan Ltd , Pankaj Patel , 022-61169179 , 10th Floor Beta Bldg Lodha Ithink Techno Campus Opp Jvlr Opp Kanjurmarg Stn Kanjurmarg East 400042 , Maharashtra ; Smc Global SecuritiesLimited , Branch Manager , 9323216183 , 258, 1st Floor Perin Nariman Street Fort 400001 , Maharashtra ; Sunidhi Securities & Finance Limited , Dhiraj Modi , 2266155936, 9892108616
, 31, Tamarind Lane Near Bombay House Fort 400001 , Maharashtra ; Sunidhi Securities & Finance Limited , Mr Dhiraj Modi , 9892108616 , 14th Floor Maker Chambers 4 Nariman Point 400021 , Maharashtra ; Sushil Financial Services Private Limited , Hemendra M Shah , 9323810343 , 12, Horniman Street, Fort 400001 , Maharashtra ; Sykes & Ray Equities (India) Ltd , Vishakha Paresh Chowhan , 0 , Sykes & Ray Equities
Ltd, Doulatam Mansion, Kitridge Road, Colaba 400005 , Maharashtra ; Systematix SharesAnd Stocks (India) Limited , Mahesh Ojha , 022-30298000,66198000,9323144250,9867690499 , 3rd Floor J K Somani Bldg British Hotel Lane Mumbai Samachar Marg Fort 400001 , Maharashtra ; Tata Securities Limited , Tejas Uparkar , 9223172594 , 4 Nirmal Milan Chs Nehru Road Vile Parle (E) 400057 , Maharashtra ; Trust Financial
Consultancy Services Pvt Ltd , ASen , 9819806754 , 109/110, Balarama, Bandra Kurla Complex, Bandra East, 400051 , Maharashtra ; Way 2 Wealth Brokers Pvt Ltd , Leena Koparde , 022-61462900 , Hincon House, 24/7 Park Tower B 3rd Floor Lbs Marg Vikroli (W) 400083 , Maharashtra ; AK Stockmart Pvt Ltd , , , 30-39, Free Press House,3rd Floor, Free Press Journal Marg, Nariman Point, Mumbai - 400 021 , Maharashtra
; Nagpur : Anand Rathi Shares & Stock Brokers Limited , Ravindra Maloo , 0712-6635600,615, 9823417027 , Block No 1,Shraddha House, Kingsway 01,Nagpur 440 001 , Maharashtra ; New Delhi : Anand Rathi Shares & Stock Brokers Limited , Sanjeev Kumar Shukla , 011 43559000 9313320193,9311118190 , Anand Rathi,911/912, 9th Flr, Ansal Bhavan,Kasturba Gandhi Marg, Cannought Place 110001 , Delhi ; Bonanza
Portfolio Limted , Naresh Arora , , 4353/4c, Madan Mohan Street, Ansari Road 110002 , Delhi ; Dsp Merrill Lynch Limited , Tanushree Pathak , 43579563 , 2nd Floor Dlf Building Sansad Marg 110001 , Delhi ; Edelweiss Broking Limited , , , Office No. 603- 606, 6th Floor, Mercantile House, 15 Kasturba Gandhi Marg 110001 , Delhi ; Enam Securities Pvt Ltd , Branch Manager , , Ski Capital Services Ltd 718 Main Joshi Road
Karol Bagh 110005, Delhi ; Ifci Financial Services Ltd , Mr D PSingh/ Ms Anupama Puri , 26433207, Ifci Towers 15th Floor Nehru Place 110019 , Delhi ; Ifci Financial Services Ltd , Raman Talwar , 43588620 , 212, 213, 2nd Floor, Naurang House B Block, 21 K G Marg 110001 , Delhi ; Jm Financial Services Private Limited , Branch Manager , 41305000,3092 5500 , 114 Himalya House 23 KG Marg 110001, Delhi ; Karvy Stockbroking
Ltd , , , 105-108, Arunachal Building 19, Barakhamba Road, Connaught Place New Delhi 110001 , Delhi ; Kotak Securities Limited , , , 202-217, 2nd Floor, Ambadeep Building, 14, Kasturba Gandhi Marg , Delhi ; Motilal Oswal Securities Limited , Madhu Nanda , 9810254874 , 801-806 8th Floor Prakash Deep Building7 Tolstoy Building Cannought Place 700017 , Delhi ; Nirmal Bang Securities Private Limited , Somnath Dev
, 43603961, 8800891393 , Flat No.120, New Delhi House, 27 Barakhamba Road, 110001 , Delhi ; Prabhudas Lilladher Pvt Ltd , Mr. Arun Bansal , 011-42900500,503 , 3rd Floor 54/D-1 Rama Road Kirti Nagar Ind Area 110015 , Delhi ; Sharekhan Ltd , Mr. Hemendra Agarwal. , 011-45117000 . 98101 10383, 98105 56541 , 39, First Floor Samyak Tower Near Metro Pillor No. 120 Pusa Road 110005 , Delhi ; Smc Global Securities
Limited , Branch Manager , 9958696929 , 68 1st FloorHimlaya House 23 K G Marg Connaught Place 110001 , Delhi ; Standard Charterd Securites (India) Limited , Branch Manager , 43293200, 14 , E-2/27 Ground Floor Main Link Road Jhandewalan Near Jhandewalan MetroStn Gate No 2 110055 , Delhi ; Standard Charterd Securites (India) Limited , Branch Manager , 47090181, 84 , 159 Aggarwal Citi Plaza Plot No. 17 Manngalam
Place Sector 3 Rohini 110085 , Delhi ; Standard Charterd Securites (India) Limited , Branch Manager , 41514821, 24 , 52-53 Malviya Smriti Bhawan Deen Dayal Upadhyay Marg 110002 , Delhi ; AK Stockmart Pvt Ltd , Manish Singhal , 011-23739628, 011-47340685 , 609,6th Floor, Antriksh Bhawan, 22 Kasturba Gandhi (K.g)Marg, Connaught Place 110001 , Delhi ; Noida Indiabulls Securities Ltd , Urmisha Katyal , 9810156577
, A-27/E 2nd Floor Sector-16 201301 , Uttar Pradesh ; Religare Securities Limited , Subhash Bharadwaj , 9999512299 , Plot No. 11, A3,A4,A5,Gys Global,Sector - 125,(U.p.) - 201 303 , Uttar Pradesh ; Panaji : Indiabulls Securities Ltd , Santosh Babban Chauhan , 9975943693 , Sf4 & Sf5 18th June Road Ranipramila Arcade Second Floor 403001 , Goa ; Pune : Anand Rathi Shares & Stock Brokers Limited , Rupali Pakhale/ Vijay
Mane , 020-25657401, 9595620256 , 2nd Floor,indrayani C.t.s. No.58/1,Plot No.92/1,Above Barishta Cafe.law College Road,Nr.krishna Dining Hall,Erandwane , Maharashtra ; Indiabulls Securities Ltd , Shrinivasulu Dongari , 9970282634 , City Survey No 796-a2 Nearkamla Nehru Park Opp Ambika Sale Bhandarkar Rd Shivaji Ngr 411005 , Maharashtra ; Indiabulls Securities Ltd , Sameer M Kamadoli , 9011055267 , 101 1st Floor
Abhijit Court Cts No 799b Plot No 137 B Bhandarkar Road 411004 , Maharashtra ; JmFinancial Services Private Limited , Branch Manager , 39871601, 00, 66033720 , 205 Business Guild Opp. Krishna Dining Hall Law College Road Erandawane 411004 , Maharashtra ; Motilal Oswal Securities Limited , Tushar Karde , 9167364912 , Lohia Jain Centre 1st Floor893/6 Near Goodluck Chowk Opp Oakwood Hotel NrIipm Inst Bhandarkar
Road Deccan Gymkhana 411004 , Maharashtra ; Sajag Securities Pvt Ltd , Anita , 9850640965 , Regent Chambers, 33/15-b, Karve Road, Opp Garware College 411004 , Maharashtra ; Standard Charterd Securites (India) Limited , Branch Manager , 25453436, 25453473 , A/2 1st Floor Deccan Chambers C.t. Survey No. 33/40 Erandwane Karve Road 411004 , Maharashtra ; Tata Securities Limited , Sunil Kudale , 9028000928
, Gr Floor, F C Annex Building F CRoad Bhamburda 411005 , Maharashtra ; Raipur : Skp Securities Ltd , , 0771-4267211 , 211, Lalganga Shopping Mall,2nd Floor G.e Road, 492001 , Chattisgarh ; Rajkot : Ans Private Limited, Sheth Bhavesh Natavarlal , 9825072372 , Arham Financial Center, Opp Star Chamber, Harihar Chowk DrRajendra Prasad Road 360001, Gujarat ; Ifci Financial ServicesLtd , Mr DarshanGatecha , 9824201302
, 2nd Floor, Aradhana Complex Near Bank Of Baroda Opp Nutan Nagar Community Hall Kotecha Chowk Kalawad Road 365005 , Gujarat ; Indiabulls Securities Ltd , Rajat Sharma , 3048464 , Shreeji Complex Opp Jalram Patrol Pump Kalawad Road 360001 , Gujarat ; Marwadi Shares And Finance Limited , Raj Jivrajani , 9727724629 , Marwadi Financial Plaza Nana Mava Main Road Off 150 Feet Ring Road 360005 , Gujarat
; Surat : Indiabulls Securities Ltd , Bhaveshkumar Hasmukhbhai Patel , 9825311171 , House-d 2nd Floor 21st Century Business Center Ring Road 395001 , Gujarat ; Jainam Share Consultants Pvt Ltd , Chirag Jitendra Shah , 9824370901 , M 5/6, Malhar Complex, Dumas Road, Ichchanath, Piplod 395007 , Gujarat ; Standard Charterd Securites (India) Limited , Branch Manager , 2463101, 02 , U-18 Upper Ground Floor Jolly
PlazaAthwagate 395001 , Gujarat ; Thane : Tata Securities Limited , Nachiappan Ramanathan , 9029032454 , I-thinkTechno Campus BuildingA, 3rd Floor, Off Pokharan Road 2, 400607 , Maharashtra ; Vadodara : Indiabulls Securities Ltd , Doshi B , 9824540909 , BaraodaTrident Trident Race Course 390007 , Gujarat ; Market CreatorsLimited , Kalpesh JShah , 9925027472 , Creative Castle , 70-sampatrao Colony, Opp Masonik
Hall Productivity Rd, Alkapuri 390005 , Gujarat ;
NRI APPLICANTS SEEKING ALLOTMENT OF BONDS IN PHYSICAL FORM SHALL SUBMIT THE APPLICATIONS ONLY AT : MUMBAI, DELHI, AHMEDABAD, HYDERABAD, CHENNAI, BANGALORE, CHANDIGARH AND KOCHI.
3
INDIAN RAILWAY FINANCE CORPORATION LIMITED
AXIS BANK LIMITED
Ahmedabad: Trishul-Opposite Samartheshwar Temple, Law Garden, Ellis Bridge, Ahmedabad-380006, Gujarat 079-66306102, 9825041432, Allahabad: 28 B, Civil Station, M.G. Marg, Civil Lines, Allahabad-211001, Uttar Pradesh 0532-2427645/46/47, 9889052700, Anand: Satyam Chambers, Amul Dairy, Road, Anand-388001, Gujarat 0269-250975/475, 0269-250975/475/02692-666000/212 , Bangalore: No. 9, M.G. Road, Block
A, Bangalore-560001, Karnataka, 080-25370615 / 616, 9880490023/642, Bardoli: Manchhaba, Sankskruti Bhavan, Sardar Baug, Bardoli-394601, Gujarat-02622-227828/22/929, 8980804702, Bharuch: Shri Sad Vidya Mandal Institute of Technology, old N.H No.8, Bharuch-392002, Gujarat 02642-225221/48219, 9824437244, Bhavnagar: Plot No. 4/B, Vasundhara Complex, opp. Dakshinamurthy School,Waghawadi Road,
Bhavnagar-364002, Gujarat 0278-2573702/ 03, 9979208920, Bhilwara: Ganpati Enclave,Heera Panna Campus, op.Nahar Brothers, Petrol Pump, Pur Road, Bhilwara-311001, Rajasthan 01482-247861/2/3/4/5, 01482-247861/2/3/4/5, Bikaner: Shree Gaurav Complex, Daga Maidan, Nr Dak Bunglow & Rly Stn, Rani Bazar Rd, Bikaner-334001, Rajasthan 0151-2202132/33/35, 8094449555, Chandigarh: SCO 343-344,Sector 35-
B,Chandigarh-160022, Chandigarh 0172-4601401/02/03, 9872252632, Chennai: 149 1C/1D, Mount Poonamalle Road, Ramapuram, Chennai-600089, Tamil Nadu 044-28306800 7845845758, Goa: Heritage, Ground Floor, Swatantra Path, Opposite Sapna Terraces, Vasco-Da-Gama 403 802, Marmagoa, Goa, 0265-2311613/2311323, Gujarat : Vardhaman Complex, Opp GB Circle, NearPizza Hut , Race Course Circle (South),
Vadodara 390 015, 0265-2311613/2311323, Gujarat : Amit Clinic, Opp. BaiAvabai High School, Halar Road, Valsad 396 001,Gujarat, 02632-253110/253119, Guwahati: Chibber House, G S Road, Dispur, Guwahati-781005, Assam 0361-2340522/2340561, 9706095745, Gwalior: Kanwal Complex, Shrmant Madhav Raoscindia Marg, Gwalior-474002, Madhya Pradesh 0751-2233770,80,90, 8878801582/0751-4097724, Hissar: SCO
No. 177, Commercial Urbal Estate No. 1 Hissar, Hissar-125001, Haryana 01662-227442/5/8/56, 8053112602/ 03, Hyderabad: 6-3-879/B First Floor, G Pulla Reddy Blgreenlands, Begumpet Road, Hyderabad-500016, Andhra Pradesh 040-23400732/731, 9704055589, Jaipur: O-15, Green House, Ashok Marg, C-Scheme, Jaipur 302001, Rajasthan 0141-4061111, 9314468394, Jalandhar: SCO 30-31, Guru Ram Dassdivine Tower,
Opposite Mini, Jalandhar-144001, Punjab0181-4633970/71/73, 9216024567, 0181- 4356003, Jamnagar: Jaidev Arcade,GrndFlr, Park Cly Main, Main Rd, Nr JoggersPark, Jamnagar-361008, Gujarat 0288-2665219, 9662277285, Jodhpur: Prince Tower,Plot No 654,Near Jaljog Chowraha,Residency Road, Jodhpur-342003, Rajasthan 0291-2647622/44, 9413792287, Katni: Ground Floor, Nagpur Golden Building, Opp: Old Collector,
Atekatni-483501, Madhya Pradesh (07622) 409900/1/2, 8878803172, Kolkata: 7, Shakespeare Sarani,Kolkata-700071, West Bengal 033-2822933/496, 9830463389 Kota: 414, Shopping Center, Kota District, Kota-324007, Rajasthan 0744-2365511/13/14, 9772219009, Ludhiana: Shop No. 3, LGF, Surya Towers,108 The Mall, Ludhiana-141001, Punjab 0161-4684680, 4684603-0161-4684619, Meerut: Hotel Crystal Palace, G-
2/47 Civillines, Boundary Road, Meerut Dist., Meerut-250001, Uttar Pradesh 0121-4012300/313/301, 9536901772, Mumbai: Universal InsuranceBuilding,Ground Floor, Sir P MRoad, Fort, Mumbai-400001, Maharashtra022-66101031/1088, 022-66107265, Nagpur: M. G. House, Rabindranath Tagore Road, Besides Board Office,Civil Lines, Nagpur-440001, Maharashtra 0712-6621800/6621801, 9326034437, NewDelhi: Statesman
House,148, Barakhamba Road, New Delhi-110001 011-23311047/051, 9999113382 Panipat: Gaylord Hotel Building, Near HDFC Bank, G.T. Road, Panipat132103, Haryana 0180-4015001/02/03, 9896331623, Panjim: Siddharth Bandodkar Bhavan, P. Shirgaonkar Road, Panaji403001, Goa 0832-6640808/03/05, 0832-6640828 Patiala: 4464/5, Rajwara Road, The Mall Road, Patiala-147001, Punjab 0175-2205977/9/956,
9872259484, Pune: Sterling Plaza 1262/B, J M Road, Deccan Gymkhana, Pune-411004, Maharashtra 020-66295000, 8888899098 Raipur: Opp New Bus Stand, Jeevan Bima Marg, Pandri, Raipur-492004, Chattisgarh 0771-2445501/502/504, 9630671672, Rajkot: Titan, Near K KV Circle, Kalawad Road, Rajkotrajkot-360005, Gujarat 0281-6695999/901/2, 9712982277, 9428344149 Ranchi: Shambhu Complex,H B Road, Near
Firayalal Chowk, Ranchi-834001, Jharkhand 0651-2301039, 9934535910, Shimla: GF/FF Durga Cottage, SDA Commercial Complex, Kasumpti, Shimla-171009, Himachal Pradesh 0177-2622352/076, 9418506354, Surat: Digvijay Towers, Opp. St Xaviers School, Ghod Dod Road, Surat-395001, Gujarat 0261-4082300/399/366, 9913761634, Thiruvananthapuram / Trivendrum: TC2/2421, Condor Building, Pattom PO,
Thiruvananthapuram-695004, Kerala 0471-4400500/711, 0471-4400721/720 Udaipur: 222/21, Saheli Marg, Near UIT Circle, Udaipur-313004, Rajasthan 0294-2424431/2/3/4/5, 9414321186, Ujjain: Hotel Ashray, Ground Floor, 77, Dewas Road, Ujjainujjain-456010 Madhya Pradesh 0734-4295700/1-10, 8878803292, Varanasi: Tulsi Complex C-19/134, M-B,Gr & 1st Flr, Shastri Nagar, Sigra,Varanasi-221002, Uttar Pradesh 0542-
2227395/7/8, 9457846687, Visakhapatnam: Padmasree Arcade, NH-5, Chinagantyada Main Road, Visakhapatnam-530026, Andhra Pradesh 0891-2766421/2745036, 09985447665.
HDFC BANK LTD.
Agra: First Floor, Pariney Garden, Bhagfarjana, Civil Lines, Agra-282002, Ahmedabad: Astral Tower, Near Mithakhali Six Raod, Navrnagpura, Ahmedabad-380 009, Ahmednagar: Ambar Plaza, A Wing, Second Floor, Station Road, Ahmednagar-41400 Amritsar: 26 Kennedy Avenue First Floor, Amritsar-143001 Asansol: P.C Chatterjee Market, Rambandhu Talaw, Asansol-713303, Bangalore: Cash Management Services, Salco
Centre, # 8/24, Richmond Road, Bangalore-560025, Bardoli: ShreeAmbika Niketan, Station Road, Sardar Baug, Bardoli, Bardoli-394601, Bareilly: Wbo, 1st Floor, 154, Krishna Place, Civil Lines, Bareilly - 243 001 Uttar Pradesh, Baroda: 1st Floor, Fortune Tower,Vadodara Stock Exchange Building, Opp. Parsi Agiyari,Sayajigunj, Baroda-390005, Belgaum: No 4830/2a Opp District Hospital, Dr Ambedkar Road, Belgaum-590 002,
Belgaum-590002, Bhatinda: 83/1 Liberty Chowk, Civil Lines, Bhatinda, Bhatinda-151001, Bhavnagar: 1st Floor, Sterling Point, Waghawadi Road, Bhavnagar-364001, Bhilai: Chauhan Estate, G.E. Road, Supela, BhIlai-490023, Bhubaneshwar: C111, Business Park, 1st Floor, Sahid Nagar, Bhubaneswar-751007, Bokaro: B-9, City Centre, Sector-4, Bokaro Steel City, Bokaro-827001, Burdwan: 45 Gt Road/Burdwan-713101,
Burdwan-713101, Calcutta: Abhilasha - Ii, 6 Royd Street (2nd Floor), Kolkata-700016, Calicut: Iii Floor, Simax Towers, Kannur Road, Nadakkave, Calicut ,Calicut-673011, Chennai:-No. 115, Dr. Radhakrishnan Salai, 2nd Floor, Opp. To Csi Kalyani Hospital, Mylapore, Chennai-600004, Cochin: First Floor, Palarivattom 25,Cochin-682025, Coimbatore: Wbo ,1552,B7, First Floor, Classic Towers , Trichy Road, Coimbatore-641018,
Cuttack: Holding No 32, 32/ABajrakabati Road, Cuttack, Orissa - 753 00, Cuttack-753001, Dehradun: WboDeptt, 56, Rajpur Road, Dehradun-248001, Delhi: Fig-Ops 1st Floor, Kailash Bldg, Newdelhi-110001, Dhanbad: Sri Ram Plaza, 1st Floor, Bank MoreDhanbad, Jharkhand-826001, Erode:-No.680,Lotus Enclave,Brough Road,Erode,Erode-638001, Gandhidham:-Plot No.1, Sector-8, Rabindranath Tagore Road,,Gandhidham-
370201, Gorakhpur: Wholesale Banking Operations,Shreenath Complex, 10, Park Road, Civil Lines, ,Gorakhpur-273001, Gwalior: J K Plaza, Gast Ka Tazia, Lashkar ,Gwalior-474001, Hissar:-3 & 4 Mc Area Red Square Market Railway Road Hisar,Hisar-125000, Hyderabad: Wbo 1-10-60/3, Iii Floor, Suryodaya,Begumpet,Hyderabad-500016, Indore: 1st Floor, Brilliant Avenue, Sch No. 94, SecTor -B, Behind Bombay Hospital,
Ring Road,Indore-452010 Jabalpur: 1st Floor, Kumbhare Mension, 636, Vijay Nagar, Mr- 4, Main Road , Sbi Chowk, Jabalpur (Mp) - 482002, Jabalpur M.P.-482002 Jaipur: Hdfc Bank House, 2nd Floor, O-10,Ashok Marg,C-Scheme,Jaipur,Jaipur-302001, Jammu:-Cb-13, Rail Head Commercial Complex, Gandhi Nagar,Jammu-180004 Jodhpur: Ist Floor, 15, Keshav Comlex, Nimbera House, Paota, Mandore Road, Jodhpur -
342010.,Jodhpur-342010, Kanpur: 15/46, 1st Floor, Civil Lines, Kanpur-208001, Kottayam: 3rd Floor Unity Buildings , Kk Road,Kottayam-686002 Ludhiana: Sco-54, Phase -2 Urban Estate Dugri,Ludhiana-141001, Mangalore:-Ideal Towers 1st Floor , Opp Sharavu Ganapathi Temple , G T Road Mangalore -1,Mangalore-575001 Mehsana: PrabhuComplex Nr Rajkamal Petrol Pump, Highway Road,Mehsana 384002.,Mehsana-
384002, Moradabad:-Hdfc Bank Ltd, First Floor, Chaddha Complex, Gmd Road,Moradabad-244001 Mumbai: Ground Floor, Maneckji Wadia Building,Nanik Motwani Marg,Near Kala Ghoda,Opp Mumbai University, Fort, Mumbai- 400 001,Mumbai-400001, Muzaffarnagar:-First Floor, 53/4 Janshat Road,New Mandi,Muzaffarnagar-251001, Nadiad: Shootout Building, CollegeRoad, Nadiad 387001,Nadiad-387001 Nasik:-Hdfc Bank
Ltd,3rd Floor , Archit Centre , Opp Sandeep Hotel, Chandak Circle Link Road , Near Mahamarg Bus Stand , Nasik 422 002,Nasik-422002, Navsari: Gr Flr , Nandani Complex , Station Road ,Navsari-396445, Nellore: 17/126, G.V.R. Enclave, G.T. Road, Nellore- 524001,Nellore-524001, Panjim:-301, Milroc Lar Menezes, Swami VivEkanand Road,Panjim-403001, Patna:-Plot No 651 Jamal Rd Patna- ,Patna-800002, Porbandar:-
Om Shiv Shakti R.D.Chambers, M.G. Road, Porbandar - 360 575,Porbandar-360575, Pune: Fortune Square 3 Rd Floor, Deep Bungalow Chowk, Model Colony, Shivajinagar,,Pune-411016, Rajahmundry:-46-17-20, 1stfloor, Danavaipet, Rajahmundry,Rajahmundry-533103, Rajkot: Shivalik - V , 3rd Floor, Gondal Road, Rajkot,Rajkot-360002, Rourkela: Dewadi Bhavan,Rourkela-769001, Shillong: Anders Mansion, Police
Bazar,Shillong,Shillong-793001, Shimoga:-Hdfc Bank Ltd, WB O, No447 ,Sharavathi Complex, Savarlane Road, Shimoga,Shimoga-577201, Siliguri: 136/115 Hill Cart Road,Siliguri-734401, Solapur: 8516/11 Murarji Peth,Sun Plaza Bldg, LuckyChowk, Solapur-413007, Surendranagar: Middle Point, AWing, Nr : Milan Cenama, Main Road, Surendranagar.,Surendranagar.-363002, Tirupati: 19-8-180,KrishnaArcade, Beside Ibp
Petrol Pump, NearAnnamaiah Circle,Tirupati-517501, Tirupur: No-169,Chidambaram Complex,Kumaran Road,Tirupur - 641601,Tirupur-641601, TRichur: Third Floor, Suharsha Towers,Shornur Road,,Trichur-680001, Unjha: 1st Floor, Suvidhi Complex, Station Road, Unjha-384170, Valsad: 1st Floor, Ekta Apt, Tithal Road, Valsad.,Valsad-396001, Vijayawada: 40-1-48/2, 2nd Floor,Valluri Complex, M GRoad,Vijayawada-520010,
Vishakapatnam: First Floor, Potluri Castle, # 48-14-9, Dwarakanagar, Visakhapatnam-530016
IDBI BANK LTD.
Ahmedabad: IDBI Complex , Lal Bungalows Off, CG Road, Ahmedabad Pin : 380006, Gujarat (079)-66072623, Ambala: 169/2, Rai Market,Ambala Cantt.,Ambala Pin : 133001,Haryana (0171)-2631819/20, Aurangabad: Plot No. 07, Raghbir Chambers,Vidya Nagar,Jalna Road,Aurangabad Pin : 431003,Maharashtra (0240)-5622997/5672038, Bangalore: 102, Shakthi Comfort Towers, K.H.Road, Pin : 560027,Karnataka 91
(80) 67121000, Bhavnagar: G-10, Ground Floor,Radhe Shyam Complex,Waghawadi Road, Bhavnagar Pin : 364001,Gujarat (278) 2524270/73, Bhopal: Hall ACentre Point,M.P.Housing Board Building,T T Nagar,Bhopal Pin : 462003,Madhya Pradesh (0755)-6463006/023, Bhubaneswar: IDBI House, Janpath,Ground Floor,Janpath,Unit -IX,Bhubaneshwar Pin : 751022,Orissa (0674)- 2541655/695, Chandigarh: SCO 72-73,Sector
17 - B,Chandigarh Pin : 160017,Chandigarh (0172)-5059704, Chennai: PM Towers, 37, Greams Road ,Chennai Pin : 600006 , Tamil Nadu (044)-24301731, Dehradun: 59/4, International Trade Centre, Rajpur Road,Dehradun Pin : 248001, Uttaranchal (0135)-744477, Dhanbad: Skylark Complex,Bank More,DhanbadPin : 826001,Bihar 03262300761/762 Durgapur: Ruma Sweets Building,Nachan Road,Benchity,Durgapur Pin
: 713213 (034)-32588297, Guwahati: Satyen Niwas, Opp. Sukleshwar Mandir, M.G. Road, Pan Bazar,Guwahati Pin : 781001, Assam (0361)-2730375/76/77, Hyderabad: Mahavir House,Basheerbagh Square,Hyderabad Pin : 500029,Andhra Pradesh +91 (40) 66746000/41, Indore: Alankar Chambers,RatlamKothi, AB Road,Indore Pin : 452001, Madhya Pradesh (0731) 2519001, Jaipur: D-24 Durlabh Niwas,Prithviraj Road, C
Scheme, Jaipur Pin : 302001 (0141)-5113456, Jodhpur : Dhanalaxmi Towers, 1st Chopsani Road, Jodhpur, Pin : 342003, (0291)-5153508-11, Kanpur: JeevanVikas,MG Road,Near Statue Junction,Kanpur Pin : 208001,Uttar Pradesh (0512)-2305437, Kochi: Panampilly Nagar,Post Bag Num 4253,Kochi Pin : 682036, Kerala (0484)-2322060, Kolhapur: Groundfloor,Royal Heritage Building,Opp to Basant Bahar Theater,Assembly
Road,Kolhapur Pin : 416002 , 0231-2680681/2/3, Kolkata: 44, Shakespeare Sarani,PB No 16102,Kolkata Pin : 700017,West Bengal (033)66338866, Lucknow: UPCB Bldg.,2 MG Road, Lucknow, Pin:226001 (0522)-2619915, Mumbai- Nariman Point: 224-AMittal Court, A-Wing,2nd Floor,CMS Dept.,Nariman Point,Mumbai-400021 +91 (22) 66588111, Mysore: AnandArchade, MIG- 11,V.M. Double Road,Saraswathipuram,
Kuvempunagar, Mysore Pin : 570009, Karnataka 0821-2545424, Nagpur: 3rd Floor, Gupta Tower, Temple Road,Civil Lines Opp. Science, Nagpur Pin : 440001, Maharashtra (0712)-6656412/415, Nashik: A-1& 2 Prathamesh,Thatte Nagar,Gangapur Road,Nashik Pin : 422005, Maharashtra (0253)- 2317001/5627001, NewDelhi : Indian Red Cross Society Bldg,1, Red Cross Road, Post Box Num 231, New Delhi Pin : 110001,Delhi
(UT - NCT) (011)-23461900, Panaji: Alcon Chambers, Dayanand Bandodkar Marg, Panaji Pin : 403001, Goa (0832)-2224597/2426525, Patna: Kashi Palace Complex,Dak Bungalow Road,Opposite Heera Palace ,Patna Pin : 800001, Bihar (0612)-6510293, Pune: IDBI House,Dynaneshwar Paduka Chowk,Fergusson College Road, Pune Pin : 411004,Maharashtra (020)- 66004108/2, Raipur: Singhania House,Civil lines,Opp
Museum,Raipur Pin : 492001 ,Chhattisgarh (0771)-4044972, Rajkot: Near KathiyawadGymkhana, Dr.Radha Krishna Road, Rajkot Pin : 360001,Gujarat 02832-290090, Surat: ESS EN House,Ghod Dod Road, Surat Pin : 395001,Gujarat (0261)-6540385, Trivandrum: Ground Floor, Samrudhi Magnet Building,Opposite Womens College,Near Hotel Taj Residency, Vazhuthacaud,Thiruvananthapuram Pin : 695014,Kerala (0471)-
3018236/38/39, Vadodara: 46/A, Garg Plaza,Gautamnagar,Race Course Road,Besides Geb Building, Baroda Pin : 390007,Gujarat (0265)-6455070/71/72.
ICICI BANK LTD.
Ahmedabad - ICICI Bank Ltd. JMC House, Opp. Parimal Gardens,Opp Parimal Garden, Ambawadi, Ahmedabad 380 006; Amritsar - ICICI Bank Ltd, 361, M.C International The Mall, Amritsar - 143001, Punjab Bangalore - ICICI Bank Towers, 1, Commissariat Road, Ground Floor, 560025; Bharuch - ICICI Bank Ltd, Blue Chip Complex, Sevashram Road, Panchbatti, Bharuch 392001; Bhavnagar- Ground Floor, Plot No.
2569,Ratnadeep, Opp. Central Salt Research Institute,Waghawadi Road, Bhavnagar-364002; Bhopal - Plot No. 11, Zone II, Alankar Palace Near Pragati Petrol Pump, M. P. Nagar, Bhopal- 462011;Bhubaneshwar - ICICI Bank Ltd., OCCF Building, Opp Sriya Talkies, Unit - III, 751001;Chandigarh-SCO 9-10-11, SECTOR 9-D. CHANDIGARH 160017; Chennai - ICICI Bank Ltd, 110, Prakash Presidium, Uthamar Gandhi Salai,
(Nungambakkam High Road), 600034; Ernakulam (Cochin) - Emgee Square, M.G.Road, Ernakulam, Kochi - 682035 ;Coimbatore- Cheran Plaza, 1619, TrichyRoad, Coimbatore- 641018; Faridabad- ICICI Bank Ltd., Booth No. 104-105, District Centre, Sector 16, Faridabad- 121007, Haryana - 121007 Ghaziabad- ICICI Bank Ltd, R- 1/88, Raj Nagar, Ghaziabad, Uttar Pradesh. - 201001;Guntur - ICICI Bank Ltd., 5-82-2, PMG
Complex, Lakshmipuram Main Road, Guntur - 522002 (Andra Pradesh); Gurgaon - ICICI Bank Ltd, SCO18 & 19, HUDAShopping Centre, Sector-14, Market Complex, Gurgaon 122001; Guwahati - Ground Floor, Shanti Complex, G S Road, Bhangagarh, Guwahati 781005; Hissar - ICICI Bank Ltd, Plot No 57-60, Kamla Palace Road, Red Square Market, Hissar, Haryana 125001;Hubli - Eureka Junction, Travellers Bungalow
Road, Hubli 580029; Hyderabad - ICICI Bank Ltd., 6-2-1012, TGV Mansions, Opp. Institution of Engineers, Khairatabad, 500004, door no 74 & 75 Vinayak nagar Gachbowli main road Gachibowli, 500032; Indore- ICICI Bank Ltd.,4, Chhoti Khajrani, Malav Parisar, A-Broad, Indore, MP - 452 008; Jaipur - ICICI Bank Ltd, C-99, Shreeji Towers, Subhash Marg, NearAhimsa Circle, C Scheme, 302001;Jamshedpur -Natraj Mansion,
Main Road, Bistupur, Jamshedpur 831001;Kanpur - J.S.Towers 16/106- TheMall, Kanpur 208001;Kolhapur - Ground Floor, Vasant Plaza, Rajaram Road, Rajarampuri, 416001; Kolkata - ICICI Bank Ltd., 22, R N Mukherjee Road, 700001;Lucknow - ICICI Bank Ltd, Shalimar Tower, 31/54 M.G. Marg, Hazratganj, Lucknow-226001; Ludhiana - ICICI Bank Ltd, S.C.O. 146 / 147, Feroze Gandhi Market, Ludhiana - 141001 ;Madurai
- 33, North Chitrai Street, Madurai 625001; Mumbai 30,Mumbai SamacharMarg, Fort- 400001; Mysore - 2950, AishwaryaArcade, 9th Cross, Kalidasa Road, V.V. Mohalla, Mysore 570002;Nagpur - Vishnu Vaibhav, 222, Palm Road, Civil Lines, Nagpur -440001; Nasik - ICICI Bank Ltd, U-1, Crown Commercial Complex, Opp. Rajiv Gandhi Bhavan (NMC), Utility Centre, SharanpurRoad, 422002; NewDelhi - ICICI Bank Ltd
- 9A, Phelps Building, Inner Circle,Connaught Place, 110001;Pondicherry -47, Mission Street, Pondicherry 605001;Pune - A-Wing, Shangrila Gardens, Bund Garden Road, 411001; Rajkot - Jai Hind Press annexe, Opp. Shardabaug, Babubhai Shah Marg, Rajkot-360001; Ranchi - ICICI Bank Ltd, Main Road (near Ratanlal Petrol Pump), Ranchi, Jharkhand 834001; Salem - ICICI Bank Ltd. Swarnambigai Plaza, S. F. No. 6/
5, Block no. 7, Ward-C, Omalur Main Road, Near Bus Stand, 636009; Surat - Anjan Shalaka, Lal Bungalow, Athwa Lines, Surat 395007; Vadodara - ICICI Bank Ltd., Landmark Building, Race Course Circle, Alkapuri, 390007; Vijaywada- D-40-1-52/5, Sainag Complex, M G Road, Vijayawada 520010.
KOTAK MAHINDRA BANK LTD.
Ahmedabad: Ground Floor, Chandan House, opp. Abhi jeet III,Near Mithakali Six Roads, Navrangpura, Ahmedabad - 380006, 079-66614800. Amritsar: 10, Kennedy Avenue, The Main Mall Road, Amritsar-143001, 0183-5002950; Anand: P.M.Chambers, Mot a Bazar, Val lab Vidya Nagar, Anand - 388120, 02692-229993/94, Bangalore: 10/7, Umiya Land Mark, Next to Chancery Hotel Lavelle Road,
Bangal ore-560001, 080-66123250, Bhavnagar: Bhavna Construct ion Company, Plot No 2108 /A, G. R. Sterling Centre, Waghwadi Road, Bhavnagar - 364001, 09327518890, Chandigarh SCO 153-154-155, Madhya Marg, Sector 9-C, Chandigarh-160009, 0172- 5008619, Chennai: Capi tale,Ground Floor, 555, Anna Salai, Chennai-600018, 044- 42040211, Coimbatore: 727, Avinashi Road, Skanda
Square, Coimbatore-641018, 0422-4506505, Hyderabad: Pavani Jewel Tower, Ground Floor, Somaji guda, Hyderabad - 500089, 040-66755036, Jaipur: 57, Krishna Tower , Sardar Patel Marg, C-Scheme, Jaipur-302001, 0141-5157110, Jamshedpur: Gayatri-Enclave, K Road, S. Town-Bistupur, Jamshedpur-831001, 0657-6621809, Jodhpur: Bombay Mot or Buildi ng, Bombay Mot or Ci rcle, 87/ B-2
Chopasani Road, Jodhpur-342003, 0291-5100810, Kanpur: 17/03, The Mall, Meghdoot Hotel Building, Kanpur-208001, 09919802770, 3067850, Kolkata: Apeejay House 15, Parkstreet, Kolkatta-700016, 033-44011974, Lucknow: 3GF, Speed Bui lding, Shahanazaf Road, Lucknow-226001, 0522-4038214, Ludhiana: SCO 120, Ground Floor, Feroze Gandhi Market , Ludhi ana-141001, 0161-5055200,
Mumbai: 5 C/ II, Mittal Court 224, Nariman Point, Mumbai - 400001, 91-22-66563408, Nagpur: Ground Floor, 345, Shree Mohini Complex, Kingsway, Nagpur-440001, 0712-6620801/6620807, New Delhi: Ground Floor, Ambadeep,14, K.G. Marg, New Delhi-110001, 08860635691, Noida: Plot 31 and 32, Block-G, Sector - 18, Noida, Distt. Gautam Budh Nagar, Uttar Pradesh-201301, 0120-4364801,
Pune: Bakre Avenue, FP NO 226/3, Bhandarkar Road, Pune-411004, 020-66094044, Rajkot: Nath Complex, Ground Floor, Near Race Course, Dr. Yagnik Road, Rajkot-360007, 0281-6622607, Surat: Ground Floor, Kotak House, KG Point, GhodDod Road, Surat-395007, 0261-6679027, Trichy: B-17,Aishwaryam Building, Sasthiri Road, Thillai Nagar,Trichy-620017, 0431-4023823, Vadodara / Baroda:
Panorama Buildi ng, R. C. Dut t Road, Alkapuri, Vadodara - 390015, 0265-6620351/352/353/357.
STATE BANK OF INDIA
SBI Ahmedabad: Main Branch (Br.Cd:301), Bhadra, Ahmedabad, Gujarat-380001, SBI Bangalore: Main Branch (Br.Cd:813), State Bank Road, Bangalore, Karnataka-560001, SBI Thyagarayanagar Branch: (Br.Cd:1020), 2, PrakasamRoad, T. Nagar, Chennai, Tamil Nadu-600017, SBI NewDelhi Main Branch: (Br. Cd: 691), C Block, 11 Parliament Street, New Delhi-110001, SBI HyderabadMainBranch: (Br.Cd:847), SBI Building,
Hyderabad, Andhra Pradesh-500095, SBI Jaipur MainBranch: (Br. Cd: 656), Main Branch, Sanganeri Gate, Jaipur District: Jaipur, Rajasthan-302001, SBI Spl Ins. Branch Kolkata: (Br.Cd:14524), Samriddhi Bhavan, 1, Strand Road, Kolkata, West Bengal-700001, SBI Lucknow MainBranch: (Br. Cd: 125), Tara Wali Kothi, Moti Mah Al Marg, Lucknow, Uttar Pradesh-226001, SBI Capital Market Br, Mumbai: (Br.Cd:11777), Videocon
Heritage, Charanjit Rai Marg, Fort, Mumbai, Maharashtra-400001, SBI Nagpur Branch: (Br.Cd: 432), Kingsway, Nagpur District: Nagpur, Maharashtra-440001, SBI Nashik Branch: (Br.Cd:1469), Old Agra Road, Nashik District: Nasik, Maharashtra-422002, SBI Sambalpur Branch, Orissa :(Br.Cd:0175), Sambalpur, ORISSA 768001, SBI Pune Main Branch: (Br. Cd: 454), Collector Office Compound, Pune, District: Pune,
Maharashtra-411001, SBI Surat Branch: (Br. Cd: 488), Surat-District: Surat, Gujarat-395001, SBI ThaneBranch: (Br. Cd: 489), Mazda Complex, Parsi Agiary Lane, Thane, District: Thane, Maharashtra-400601, SBI SCB Vadodra Branch: (Br. Cd: 4086), Trident Complex, Vadodra, Gujrat-390023.
INDIAN RAILWAY FINANCE CORPORATION LIMITED : APPLICATION FORMS AVAILABLE AT FOLLOWING LOCATIONS
LEAD MANAGERS TO THE ISSUE / CONSORTIUM MEMBERS TO THE ISSUE
INDIAN RAILWAY FINANCE CORPORATION LIMITED : COLLECTION CENTRES FOR APPLICATION FORM
1057/1508,AVANASHI ROAD,COIMBATORE,Tel - 4291000 30; Kotak Sec ., 1st Floor, Red rose chamber, 1437,Trichy road.P: 6699666; Sharekhan Ltd,Vignesvar Cresta,2nd Block 3rd Floor,1095-Avinashi Road,P N Palayam,Coimbatore,641037,Tel - 0422-2218252; CUTTACK : ICICI Sec ,Mr. RANJANROUT,1St Floor, Plot No. 37 & 38, Dolamundai,Post Office - Telenga Bazar,,CUTTACK - 753009; KARVY,ARUNODAYA
MARKET,LINKROAD,CUTTACK,Tel - 2335187,88; DEHRADUN : Bajaj , 15, Rohini Plaza, 11-E Rajpur Road, Dehradun 248001, Ph: 0135-6452648,0135-6452649; ICICI Sec ,Mr. RAJAN RAWAT,81A, Rajpur Road,UttamPlace, Dehradun,,DEHRADUN - 248001; Kotak Sec ., 1st Floor, Swaraj Complex, 72, Rajpur Road, P: 2745870; RREquity, 56, 1st Floor, Rajpur Road, Dehradun,Tel - 0135-3258181; SMC ,Mr. Shobhit,7,8,9&10
shiva palace, second floor, rajpur road Dehradun 248001 ,Tel - 9368572105; DHANBAD: Bajaj , Ozone Plaza, 1st Floor, Bank More, Dhanbad 826001, Ph: 0326-2300576; ARVY,48/49, PATEL MARKET,NEAR GANDHI PARK, RAJPUR ROAD,DEHRADUN,Tel - 2713351 / 2714046 / 47; Kotak Sec ., 1St Floor, Commerce House - 2, Shastri Nagar, P:2308482; RREquity, 218,Sri Ram Plaza 2nd,Floor Bank More,Dhanbad Jharkhand-
826000 9431721838, 9431159178; SMC ,Mr. Anup,1st FloorD D House Sonapatti p.o Jharia Jharkhand828111 ,Tel - 9334001022; DURGAPUR : Eureka , Acharijee Market, GroundFloor, Benachitty, Tel 3290491/2584650; KARVY,OLD DUTTAAUTOMOBILE BUILDING,1ST FLOOR, BENACHITY, MALANCHAROAD,DURGAPUR,Tel - 2586375 to 77; RR Equity, Banerjee House- Dakshinayan Durgapur-713218 West Bengal
0343-2556908, 9434009475; ERODE : KARVY,NO.4, VEERAPAN TRADERS COMPLEX,KMY SALAI, SATHY ROAD,ERODE,Tel - 2225615; Sharekhan Ltd,Akhil Plaza, Block No.1, T.S.No.121, Perundurai Road, Opp to Padmam Restaurant, Erode - 638011,Tel - 0424 2241001 / 002/003; FARIDABAD : ICICI Sec ,Mr. SHUBHAM SRIVASTAVA,Ground Floor,SCO 52,HUDAMarket, Sector-29.,FARIDABAD - 121008; KARVY,A-
2B, 1ST FLOOR,NEELAM BATAROAD, NIT,FARIDABAD,Tel - 418000 / 105; RR Equity, Shop No. 55, 1st Floor, NIIT, Faridabad - 121001, Haryana 0129-02427361; SMC ,Mr. Kapil Uppal,4th Floor Crown Plaza, Main Mathura RoadSec 15 A, FARIDABAD Pin 121002 ,Tel - 9811890747, 9958896760; GANDHIDHAM : KARVY,OFFICE NO.12, KOMALCOMPLEX,2NDFLOOR, PLOT NO 305,NEAR SHIVAJI PARK, SECTOR 12-
B,GANDHIDHAM,Tel - 228630; GHAZIABAD: ICICI Sec ,Mr. ANAND SINGH,Office No S-4,5,7 &8,Ground Floor,Girdhar Plaza.Plot No.H-1,Block No.B, Shalimar garden,Sahibabad,GHAZIABAD - 201005; ICICI Sec ,Mr. ,Ground Floor, Supertech Icon,Nayay Khand-I,Indira Puram,GHAZIABAD - 201010; KARVY,1ST FLOOR,,C-7, LOHIANAGAR,GHAZIABAD,Tel -2701886 / 2701891 / 4112133; RR Equity, 114, Satyam Complex,
Raj Nagar DC, Raj Nagar, Ghaziabad - 201002, Tel - 0120-2828090; GORAKHPUR: Bajaj , Ground Floor, AD Towers, Bank Road, Gorakhpur, Gorakhpur 273001, Ph: 0551-6453025,0551-6453026; KARVY,ABOVE V.I.P. HOUSE,ADJACENT A.D. GIRLS COLLEGE, BANK ROAD,GORAKHPUR,Tel - 2346519 / 2333825 / 2333814; RR Equity, Gupta Metal Stores, Harbans Gali, Hindi Bazar Gorakhpur U.P 273005 0551-2205986,
9936590296; GUNTUR : KARVY,10/1,sai house,ARUNDELPET,GUNTUR,Tel - 2326686,85,84 2326687; GURGAON : Bajaj , Super Mart B-201, Super Mart - 1, DLF City Phase - IV, Gurgaon - 122002, Ph: 0124-6469991,0124-6468105; Bajaj , Sec 14 102, AKD Tower, Upper Ground Floor, Sector-14, Gurgaon- 122001, Ph: 124- 6468101, 6468102; ICICI Sec ,Mr. ,Sco 4, Sector 14,,GURGAON - 120001;ICICI Sec ,Mr. VIKAS
SINGH,A-4,5, DLF ShoppingMall,Arjun Marg,DLF City-I,GURGAON -122002; KARVY,SHOP NO.18, GROUND FLOOR,OPP: AKD TOWER, SECTOR 14,GURGAON,Tel - 4297206 / 4297202; Kotak SecuritiesLtd. ; O - 107Arjun Shopping Mall ; Arjun Nagar ; DLF Phase1 ; RR Equity, 101,Apna Bazaar Gurgaon Haryana 1220010124-5108108, 9212048108; Sharekhan Ltd,GF 10 JMD Regent Square,DLF Phase II,Near Chakarpur
Opp Sahara Mall,Main Mehrauli Gurgaon Road,Gurgaon,122001,Tel - 0124 - 4104555 / 6 / 7; GUWAHATI : Bajaj , Room No.102, 1st Floor, Dunfur Apartment, R G Baruah Road, Guwahati 781024, Ph: 9207045530, 312; ICICI Sec ,Mr. UTTAM KUMARSHAHU,3rd &4th Floor, D.R.Braj Mohan Building, M73,G.S.Road,,GUWAHATI - 781005; KARVY,2ND FLOOR, RAMKUMAR PLAZA, CHATRIBARI ROAD,NEAR HIMATSHINGA
PETROL PUMP,GUWAHATI,Tel -2608102 / 2608122; Kotak Sec ., Akshay Tower , 4th Floor, Fancy Bazar, S.S. Road. P: 2732243;GWALIOR: KARVY,NEAR NADIGATE PUL, MLB ROAD,SHINDEKI CHAWANI,GWALIOR,Tel - 4069001 / 4069002 /4087774; HISSAR : KARVY,SCO 71, RED SQUARE MARKET,1STFLOOR,HISSAR,Tel - 225845 / 225868 / 225836 /315761; SMC ,Mr. Ashish Goel,Mago Securities Ltd 104, SCFGram,
1st Floor GreenSquar Market Hissar ,Tel - 9416023332; HUBLI : ICICI Sec,Mr. PRASHANT S T,KVM PLAZA,1st Floor,Next to JTK Show Room,Club Road (BellowVLCC),HUBLI - 580029; KARVY,GIRIRAJAHOUSE, NO.451/B,WARD NO.1, CLUB ROAD,HUBLI,Tel - 2353962, 2353974, 2353975; Kotak Sec ., V AKalburgi Complex, Ground floor, Besides Vivekanand corner, Desai Cross, Deshpandenagar.P: 2357512; HYDERABAD
: Bajaj , 3-6-522, 2nd & 3rd Floor, Archies Showroom, Himayath Nagar, Hyderabad 500029, Ph: 040 - 44555555, 64631421, 22; Centrum ,Mr. R. Santosh Kumar,6-3-1111/311, Babukhan Mall,Somajiguda,Hyderabad 500 016,Tel - 040-49101700/ 07702600014; Enam Sec, 6-3-650/217B & C, Maheshwari Chambers, 2
nd
Floor, Somajiguda, Tel 39893626; EDELWEISS, 2
nd
Floor, MB Tower, Plot No. 5, Road No. 2, Banjara Hills,
Hyderabad - 500034; Tel. : 040 - 40316911; ICICI Sec ,Mr. ,D. No. 19-64, 1St Floor, Prasanna Heights Brundavan Colony,;ICICI Sec ,Mr. VENKATAKRISHNACH,1St Floor,Shop No.1,2&3,SreeramRama Towers,Chaitanyapuri, Dilsukhnagar,HYDERABAD -500060;ICICI Sec ,Mr. VASUDEBO NARAM,D No. 2-2-1130/25A,Chintala Arcade Sivam Main Road, Prasanth Nagar New Nalllakunta,HYDERABAD - 500044;ICICI Sec ,Mr.
SURESHKUMAR ARLA,1St Floor,3-6-517,Shop No-103 Sai DattaArcade,Himayatnagar, Main Road,HYDERABAD- 500029;ICICI Sec ,Mr. DEVENDRAKUMAR,Ground Floor, 101 & 102 Prashanthi Ram Towers,Behind Saradhi Studio,Yellareddy Guda.,HYDERABAD - 500073;ICICI Sec ,Mr. GBLAXMINARAYANARAJU,Ground Floor, 11-4-659,Bhavya Farooqi Splendid Towers,Red Hills,Lakdikapool,HYDERABAD - 500004;ICICI
Sec ,Mr. RAGHAVENDRAPRASAD PATNAM,First Floor,B- 44,Journalist Colony,Film Nagar Road, Jubilee Hills,HYDERABAD - 500016;ICICI Sec ,Mr. MAHESHWAR MN,First Floor, 6-3-111Amrutha Mall Somajiguda,HYDERABAD - 500082;ICICI Sec ,Mr. BURARAJKUMAR,First Floor,D.No.1-10-209,Kamala Towers, Ashoknagar,HYDERABAD - 500020;ICICI Sec ,Mr. SRINIVASARAO MUDDAPATI,32/3RT, First Floor,Municipal
No.7-1-261/92E Sanjeeva Reddy Nagar;ICICI Sec ,Mr. HARISH REDDY,First Floor, Concourse Building Green Lands Road,Ameerpet;ICICI Sec ,Mr. RAVIKUMAR NANGUNOORI,Plot No 3 & 4 Sreerama Towers,,Miyapur;ICICI Sec ,Mr. ,214 MIG KPHB Colony,Road No.1, Kukatpalli,HYDERABAD - 500072; ICICI Sec ,Mr. HUSNA HAJI,Groud Flr,D.No:1-8-138 To 143, Krishna Castle, Besi - Heritage Flights ,Penderghast
Road,,SECUNDERABAD -500003;ICICI Sec ,Mr. SANDEEP NARAYAN,DNo. 3-6-100/B, GroundFloor, West Marredpally;ICICI Sec,Mr. NARENDAR KONDUPARTHY,Ground Floor, Plot No 29 , Hi- Tech City,Madhapur;ICICI Sec ,Mr. ,A-G-1 & A-G-2, Conjeevaram House, Padmarao Nagar;ICICI Sec ,Mr. MOHAMMED PASHA,GroundFloor,Survey No.19/A,Ward No1 D. No. 4-65/5, Street No,8Habsiguda; JM Financial , Mr Ganpathi
Murthy/Chandrasekhar, 9-10Uma Chambers,3rd Floor, Banjara Hills, Ph:040- 39875900/6636 0009/10/12/46; JM Financial , Mr. Mallesh/Mr. Pravin Chary, 3rdFloor, 305 Jade Arcade, M G Road, Secundrabad500 003.Tel : (040) 3982 5200; KARVY,BUILDINGNO.160 (PART),OPP: MAYFAIR COMPLEX, RASOOLPURA, S P ROAD,SECUNDERABAD,Tel - 23433108 ,27883200;KARVY,KARVY CENTRE, GROUND FLOOR,AVENUE
4,STREET NO.1,BANJARAHILLS,Tel - 23388743, 66510313; Kotak Sec ., 9-1-777, 4th Flr, Beside ITC Bldg, S D Rd, P:65326394; Standard Chartered ,Attn : Raju Chinta,103/402, Mahavir House, Basheer Bagh Square, Hyderabad - 500029.,Tel - 9642656600;Standard Chartered ,Attn : Sanjeev Raidu,UG - 13, Mekins Maheshwari Mayank Plaza, 6-3-866 / 1 / A, Greenlands, Ameerpet, Hyderabad - 500016. ,Tel - 9849643003;
SMC ,Mr. Ramesh Babu,206, 3rd floor Bhuvana Towers, S D Road SECUNDERABAD, 500003 ,Tel - 9246295575; Sharekhan Ltd,7-1-22/3/1-5/C,Afzia Towers,1st Floor,Begumpet,Hyderabad,500016,Tel - 040 - 66827469-70; INDORE : Bajaj , Shop No. 3, City Plaza, M.G. Road, Indore- 452001, Ph: (0731) 6452014; EDELWEISS , 312, D. M. Tower, Race Course Road, Indore - 452001; Tel. : 0731-4061164; ICICI Sec ,Mr. ANUJ
PANDEY,1St Floor,Anjani Plaza,Ashok Nagar,,INDORE - 452001;ICICI Sec ,Mr. ANAND PESHKAR,Ug-6, Ug-7, Shekhar Residency, Scheme - 54, Sector F,,INDORE - 452001;ICICI Sec ,Mr. ABHISHEK GUPTA,UG 5/6, Royal Road Gold, A.Y.N.Road,,INDORE -452001; JM Financial , Mr. Manish Upadhyay, UG-7 & 8, Ground Floor, D M Tower, ,21/1, Race Course Road, Ph:0731- 3072111/4262111; KARVY,BALAJI COPORATE,
19/1, NEWPALASIA,,NEAR JANGEERWALACHOWRAHA,,INDORE,Tel - 4081500 TO 4081524; Kotak Sec ., 314, Citi Centre, 570, M.G. Road.P:2537336; RR Equity, 206 Gold Arcade, 1/3 New Palasia, Indore M.P- 452001 9826062666; Standard Chartered ,Attn : Ved Prakash Dhimole,UG - 4,5 & 6, Royal Diamond, Y.N. Road, Indore - 452001.,Tel - 9826033348; SMC ,Mr. Harish Aggarwal,206,Gold Arcade 3/1 New Palasia
, Indore, MP ,Tel - 9826062666; Sharekhan Ltd,102-104 Darshan Mall,15/2 Race Course Road,Indore,452001,Tel - 0731 - 4205520 - 24; JABALPUR : ICICI Sec ,Mr. SANJEEV SINGH,655, Napier Town, Katanga GorakhpurCrossing,,JABALPUR - 462001; Kotak Sec ., Jain Tower, 3rd Floor, Ruseel Chowk,P: 4085850; RR Equity, Shop No. 5, Unique Tower, Shashtri Bridge Chowk, Jabalpur Madhya Pradesh 482002 9827066823,
9827066823; Sharekhan Ltd,2nd Floor, Mangalam Building, 103, Napier Town, Shastri Bridge Road, Jabalpur 482001,Tel -0761-5007775; JAIPUR : Bajaj , G-3, Anukampa Tower, Church Road (M. I. Road), Jaipur 302001, Ph: 0141-6503342, 43; Eureka , 213/214, Jaipur Towers, M I Road, Tel 3918040/41; EDELWEISS , Green House 601 & 602; 6
th
Floor, Ashok Marg, Jaipur - 320 001; Tel. : 0141-4045167; Hem Sec,203, IInd
Floor, Jaipur Tower, M.I. Road, Jaipur; ICICI Sec ,Mr. TARUNARAMWANI,A-2, Lal Kothi Shopping Center, Tonk Road,JAIPUR - 302015;ICICI Sec ,Mr. PRATIBHAAGARWAL,Shop No. G-8,G-9 Vaishali Tower II,Vaishali Nagar, Nursery Circle,JAIPUR - 302021;ICICI Sec ,Mr. GOVIND CHOUDHARY,Gr.Floor, M I Road,JAIPUR - 302001;ICICI Sec ,Mr. DURGESH KANWAR,G-34,Ganpati Paradise, Central Spine, Vidhyadhar
Nagar,JAIPUR - 302023; JM Financial , Mr. Navneet Sharma, G-7 & G-8,Brij Anukamba,Plot No.K-13, Ashoka Marg,C-Scheme, Ph:0141-3984400; KARVY,S-16/A, LAND MARK, OPP: JAI CLUB,MAHAVEER MARG, C- SCHEME,JAIPUR,Tel - 2378703 / 04/ 05/ 06 ; Kotak Sec ., 305-308, 3rd Floor, Green House, O-15,Ashok Marg, C-Scheme; KJMC, 41, JAI JAWAN COLONY II TONKROAD, DURGAPURA,JAIPUR 302016, Tel
- 0141-2545735; RR Equity, 7,Katewa Bhawan, MI Road,Jaipur- 302001 0141-3235456; Standard Chartered ,Attn : Shweta Bhutani,8, Katewa Bhawan, 1st Floor, M.I. Road, Jaipur - 302001. ,Tel - 9828044491;Standard Chartered ,Attn : Vinay Singhal,8, Katewa Bhawan, 1st Floor, M.I. Road, Jaipur - 302001. ,Tel - 9783333369;Standard Chartered ,Attn : Naveen Sharma,8, Katewa Bhawan, 1st Floor, M.I. Road, Jaipur - 302001.
,Tel - 9799299894; SMC ,Mr. R K Bhandari,401, fourth Floor Shyam Anukampa , Ashok Marg C scheme Jaipur ,Tel - 9929644402; Sharekhan Ltd,Flat No 401/402, 4th Floor, Green House,Ashok Marg, C-scheme, Jaipur-302001,Tel - 0141-4078000;Sharekhan Ltd,7 Katewa Bhawan,Opp Ganpati Plaza,M. I. Road,Jaipur,302001,Tel - 0141-5114137; JAMNAGAR : ICICI Sec ,Mr. SATISH BHALARA,3Rd Floor, Cross Road Complex,
Bedi Bunder Road,,JAMNAGAR - 361008; KARVY,G-12,MADHAV PLAZA,OPP-SBI BANK,NEAR LALBUNGLOW,JAMNAGAR,Tel - 2556520 /2556260 / 2556420; Kotak Sec ., 701, 5th Floor, City Point, Station Road, P: 5540355; Sharekhan Ltd,4/5, Avantika Commercial Complex, 2nd Floor, Limda Lane Corner, Jamnagar - 361 001.,Tel - 0288 2541861; JALANDHAR : KARVY,LOWER GROUNDFLOOR, OFFICENO.3, PRIME
TOWER,PLOT NO.28, G T ROAD,JALANDHAR,Tel - 4634401 TO 415; Kotak Sec ., 2nd Floor, 465, Lajpat Nagar Market; JAMSHEDPUR: Eureka , 1
st
Floor, RJS Building, Diagonal Road, Bistupur, Tel 2428777; ICICI Sec ,Mr. DEEPAK RANJAN,Gayatri Enclave 2nd Floor (Rear Portoin) Bistupur.,JAMSHEDPUR - 831001; KARVY,3RD FLOOR, KANCHAN TOWERS,3 SB SHOP AREA, BISTUPURMAIN ROAD,,JAMSHEDPUR,Tel
- 2487020, 2487045, 2320048; Kotak Sec ., Bharat Business Centre, Ho No.2, 2nd Flr, Rm No. 8, Ram Mandir Area Bistupur,P:3090856; SMC ,Ms Shama Firdous,K2-L1 TIWARY BECHER COMPLEX,P.O. BISTUPUR ,JAMSHEDPUR 831001 ,Tel - 9934399678; Sharekhan Ltd,B1/2 , 2nd Floor Bhadani Trade Centre,Bistupur Jamshedpur-831001,Tel - 0657-2320903; JAMMU : KARVY,1ST FLOOR, 29 D/C,GANDHI
NAGAR,JAMMU,Tel - 9205044665 / 668; JODHPUR : ICICI Sec ,Mr. PUJARAY,Gul-Indi Bhawan, 1st Floor, Plot No. 9/A/B/I and III, Ratanada, Nr. Punjab National Bank, Ratanada Road,,JODHPUR - 342001; KARVY,203, MODI ARCADE,CHOPSKINI ROAD,JODHPUR,Tel - 5103026 / 5103046 /3251441; Kotak Sec ., 1st Floor, Gulab Bhawan, Chopasani Road,P: 5101956; RR Equity, 77, Prem Vihar, Chopasni Road Jodhpur
Rajasthan 342003 9928388322; SMC ,Mr. Upendra Gandhi,201, Poonam Complex, III-C Road, Sardapura, Jodhpur, Rajasthan 342 003 ,Tel - 9314712688; Sharekhan Ltd,A-3 1st Floor,Olympic Tower,Station Road,Jodhpur,342001,Tel - 0291 - 2635600 / 6450835 / 836 ; KANPUR: Bajaj , 106, Ratan Esquire, 14/144, Chunni Ganj, Kanpur 208001, Ph: (0512) 6451763 64; ICICI Sec ,Mr. SATYAJIT NAG,111/432, 80Ft Road,Ashok
Nagar,,KANPUR - 208001; KARVY,15/46, CIVIL LINES, NEAR MUIR MILLS,STOCK EXCHANGE ROAD,KANPUR,Tel - 2330127 / 2331445; Kotak Sec ., 312-315, 3rd Floor, 14/113, Kan Chambers, Civil Lines, P: 3018114; RR Equity, 26 L.G.F. Roland Tower 17/5 The Mall Kanpur Uttar Pradesh 208001 2079930, 9336219040; Standard Chartered ,Attn : Ashvini Kumar Sharma,15 / 59, O Civil Lines, Kanpur - 208001. ,Tel -
9044200777; SMC ,Mr Parikshit,15/240 - I, CIVILLINES, KANPUR, 208001 ,Tel - 9936449444;SMC ,Mr. Neeraj Jain,SPFLHouse 15/63 Civil Lines ,Tel - 9336836894; KOCHI : Bajaj , Rubicon Building, S.A. Road, South Over Bridge, Valanjambalam, Kochi 682016, Ph: 0484-6452566, 65; ICICI Sec ,Mr. VIPIN NAIR,1St Floor, Prabhus Towers, Mg Road, North End,,KOCHI - 682035;ICICI Sec ,Mr. SREEJITH MS,44/2102-C,
Deshabhimani Junction, Kaloor,,KOCHI - 682017;ICICI Sec ,Mr. ,First floor,Adonai Towers,, S.A.Road,,KOCHI - 682016; KARVY,G 39, PANAMPALLY NAGAR,OPP: KERALASTATE HOUSING BOARD,KOCHI,Tel - 2322724 / 726 / 152 /2310884; Kotak Sec ., 40/1400, 11th Floor, Ensign Enclave, Jos Junction, M.G. Road.P: 2377386; Standard Chartered ,Attn : George Thomas,1st Floor, Sana Tower, 39/2579C, M.G. Road,
Ernakulam, Cochin - 682016. ,Tel - 2372669 / 70 / 73 ; Sharekhan Ltd,Chicago Plaza, 1st Floor, Rajaji Road, Ernakulam, Kochi-682 035,Tel - 0484-2368411; KOLKATA : Bajaj , 5th Floor, Room No. 507, 7/1, Lord Sinha Road, Kolkata 700071, Ph: 033 22820383; Centrum ,Mr. Rakesh Singh,Suite No. 307, 3rd Flr., Central Plaza, 2/6, Sarat Bose Road, Kolkata - 700 020,Tel - / 09830010132; Eureka , B, 3/5, Gillander House,
8, N.S.Road, Tel 03339180300; Eureka , 9B, Wood Street, 1
st
Floor, Tel 03339180380/81; Eureka , 7, Lyons Range, 2
nd
Floor; Enam Sec, S-205, Ideal Plaza, 11/1, Sarat Bose Road, Tel 32426310/30588154; EDELWEISS, 2
nd
Floor, Savitri Tower, 3A, Upper Wood, Kolkata - 700 017 ; Tel. : 033- 40104635; ICICI Sec ,Mr. ARINDAM SAHA,30-G, Chowringee Mansion,J L Nehru Road,Park Street.,KOLKATA- 700016;ICICI Sec
,Mr. DEEPKUMAR,112A, Third floor, RashBehari Avenue,KOLKATA- 700029;ICICI Sec ,Mr. AMULLYABISWAS,Victoria Plaza,385, Garia Main Road,KOLKATA- 700084;ICICI Sec ,Mr. NITISH SHRIVASTAVA,339, Canal Street, Lake Town,,KOLKATA- 700048;ICICI Sec ,Mr. MADHURI GUPTA,95, Dumdum Road,,KOLKATA- 700074;ICICI Sec ,Mr. DEBPRIYOBOSE,P.S. Srijan Tech Park, Dn 52, Salt Lake City, Sector V,,KOLKATA
- 700091;ICICI Sec ,Mr. ,46 C, Jawaharlal Nehru Road, 15A, Everest House,KOLKATA- 700071; JMFinancial , Mr. Bharskar Chatopadyay, Kankaria Estate, 8th Flr,6th Little Russell Street, Ph: 033-3987 0330; KARVY,AD-60, SECTOR - 1,SALT LAKE CITY,KOLKATA,Tel - 23210461 to 23210464 / 0587;KARVY,49, JATIN DAS ROAD,NEAR DESHPRIYAPARK,KOLKATA,Tel - 24647231,32, 24644891; KARVY,19, R N MUKHERJEE
ROAD,2ND FLOOR,DALHOUSIE,Tel - 22437863 to 69 / 90 / 89; Kotak Sec ., 7th Floor, Apeejay House, Block C, 15, Park Street,P:22273999; Kotak Sec ., Govind Bhavan, Ground Floor, 2, Biplabi Trilokya Maharaj Sarani(Brabourne Road),P: 2235 8105; RR Equity, 704,Krishna Bldg.,224,AJC Bose Road, Kolkata- 700017 033-22802963/22806878; Standard Chartered ,Attn : Ms. Preeti Karnawatt,Premises No 152 First Floor,
S.P Mukherjee Road,Kolkata 700 026.,Tel - 033 - 24634044-45;Standard Chartered ,Attn : Bimal Halder,Mangalam Bldg., 24 & 26, Gr Floor, Hemanta Basu Sarani, Dalhousie, Kolkata - 700001. ,Tel - 9230563772/9830063772;Standard Chartered ,Attn : Ravikant ,Mangalam Bldg., 24 & 26, Gr Floor, Hemanta Basu Sarani, Dalhousie, Kolkata - 700001. ,Tel - 9874658287;Standard Chartered ,Attn : Partha Pal,Shree Manjiri, 1st
Floor, 8/1, Sir William Jones Sarani, Kolkata - 700071. ,Tel - 9830619223; SMC ,Mr. Vivek Niyogi,18,RABINDRASARANI PODDER COURT GATE NO 4, 5th FLOOR KOLKATTA-700001 ,Tel - 9933664479; Sharekhan Ltd,Kankaria Estate,1st Floor, 6-Little Russell Street, Kolkata - 700 071.,Tel - 033- 22830055; KOTA : KARVY,29, SHOPIING CENTRE,1ST FLOOR KOTA,KOTA,Tel - 2365144 / 2365145 / 2365146; Kotak Sec
., D-8 First Floor, Shri Ram Complex, Gumanpura; SMC ,Mr J K Jain,4-a-6 Talwandi Kota Rajasthan ,Tel - 9829116982; KOTTAYAM : Bajaj , Skyline Citadel Building, Ground Floor, Kanjijuzhy, K.K. Road, Kottayam 686004, Ph: 0481-6452249/51;ICICI Sec ,Mr. NIRMAL JOHN,2nd floor,Ashirwad Towers,No.3,Block 54, Shastri Road,KOTTAYAM - 686001; KARVY,1st Floor, C S I Ascension Square,Railway Station
Road,Collectorate,KOTTAYAM,Tel - 2302420 / 2302421; KOLHAPUR : Bajaj , Ground Floor, Damodar Enclave Apartment, 10th Lane, Rajaram-puri, Kolhapur 416001, Ph: 0231 6450529; KARVY,OMKAR PLAZA1 ST FLOOR,UNIT F - 2 & F - 4,RAJARAM RTOAD , BAGAL CHOWK,,KOLHAPUR,Tel - 2520650 / 2520655; Sharekhan Ltd,Office No 5, 3rd Floor, Ayodhya Tower, C S Number 511/KH, 1/2 EWard, Dhabolkar Corner,
Kolhapur,416001,Tel - 0231 - 6687063 - 69 / 76; LUCKNOW : Bajaj , 5, Commerce House, Habibullah Compound, 11, M.G. Marg, Hazratganj, Lucknow 226001, Ph: 0522 6565568; ICICI Sec ,Mr. DEBMALYAMUKHERJEE,Ground Floor, Landmark Arcade2,Badshah Nagar Crossing,Faizabad Road,LUCKNOW- 226006;ICICI Sec ,Mr. BINIT AGARWALA,Raj Palace, A1/15,Sector H, Purania Chauraha,Aliganj,LUCKNOW-
226024;ICICI Sec ,Mr. IMRAN KHAN,S/268, E Block Market,Awasthi Complex,Rajajipuram,LUCKNOW- 226017;ICICI Sec ,Mr. NITESH TIWARI,First And Second Floor, Speed Building, 3, Shahnajaf Road,LUCKNOW- 226001; KARVY,94, MAHATMAGANDHI MARG,OPP: GOVERNOR HOUSE, HAZRATGANJ,LUCKNOW,Tel - 2236819-28, 3817001 ;KARVY,B-1/2, VIJAY KHAND,,NEAR UNION BANKOF INDIAGOMTI
NAGAR,LUCKNOW,Tel - 4104270- 79;KARVY,24, USHASADAN,PREM NAGAR, ASHOK MARG,LUCKNOW,Tel - 4104300 - 309; Kotak Sec ., 1-2 Ground floor, Commerce House, Habibullah Estate,11 M.G. Marg.P:3950119; Kotak Sec ., A-1 ; Ashish Palace,Sector E,Aliganj, P: 3232285; RR Equity, G-32,Shriram Tower,13- A,Ashok Marg, Lucknow- 226001 0522- 4057612; SMC ,Mr. Anoop,Radha Krishna Bhawan, Plot No.
3/A, 5 Park Road, Lucknow ,Tel - 9839826932; Sharekhan Ltd,1st Floor Marie Gold, 4 Shahnajaf Road,Hazratganj,Lucknow (UP),226 001,Tel - 0522 - 4010342;Sharekhan Ltd,2/159, Vivek Khand, Gomti Nagar, Lucknow-226010,Tel - 0522-4101693; LUDHIANA: Bajaj , M-3, ABC Services, SCO-137, Feroze Gandhi Market, Ludhiana-1, Ph: (0161) 2412287; ICICI Sec ,Mr. GURPREET MANGAT,Sayal Complex, Gill Road,,LUDHIANA
- 141001; KARVY,SCO 136, 1ST FLOOR,FEROZE GANDHI MARKET,LUDHIANA,Tel - 44680050 / 4680062-63 ; Kotak Sec ., SCO-122, 2nd Floor, Firoz Gandhi Market,P: 5047214; MADURAI : Bajaj , Suriya Towers, No.5, First Floor, 272/273, Good Shed Street, Madurai - 625001, Ph: 0452 - 6461023, 6461024, 6461025; ICICI Sec ,Mr. ,1St Floor, No. 466, 467 A.R. Complex,K.K. Nagar, Madurai 625020 Tamilnadu,MADURAI
- 625020; KARVY,274, GOODS SHED STREET,~,MADURAI,Tel - 2350852; Kotak Sec ., Shop AFirst Floor, KRV Arcade, AR PLAZA16 & 17, North velli Street.P: 2341225; MANGALORE : Bajaj , Essel Towers, BS 4, Bunts Hostel Circle, Mangalore 575003, Ph: 0824-6451218, 17; Kotak Sec ., No.4, 3rd Floor, The Trade Centre, Jyoti Centre, Bunts Hostel Road, P: 424180; KARVY,MAHENDRAARCADE, NO.4-6-577/21/
22,KODIABAIL,MANGALORE,Tel - 2492302, 2496332, 2492901; Kotak Sec ., No.4, 3rd Floor, The Trade Centre, Jyoti Centre, Bunts Hostel Road, P: 424180; RR Equity, F 2 1st Floor Adithi Arcade Karangalpay mangalore 575003 Karnataka 9845288557; Sharekhan Ltd,T-1 3rd Floor,Utility Royal Tower,K S Rao Road,Mangalore,575001,Tel - 0824 - 2441318 MEERUT: Bajaj , G-43, Ganga Plaza, Meerut cantt. - 250001, Ph:
0121 - 6451510, 6451511; ICICI Sec ,Mr. VINEET CHOUDHARY,P P Plaza Plot No. 177/1, Mangal Pandey Nagar,MEERUT - 250005; KARVY,1ST FLOOR, MEDI CENTRE,OPP EVES CENTRE HAPUR ROAD NEARBACHHAPARK,MEERUT,Tel - 4033727 / 3271640; SMC ,Mr. Sanjay Pahuja,KAVERI COMPLEX, P.L. SHARMAROAD MEERUT ,Tel - 9837101412;SMC ,Mr. Abhishek Bhardwaj,C/O KSB CAPITAL SERVICES
LTD SHOP NO-1,FIRST FLOOR,HARI LAXMI ROAD,P K ROAD,CROSSINGMEERUT ,Tel - 9837024084; MUMBAI : Bajaj , Agra Bldg, Gr. Floor, 7/9 Oak Lane, Fort, Mumbai 400023, Ph: 022 66376999; Centrum ,Mr. Rajesh Thadhani,Centrum House, 4th level, CST Road, Vidya Nagari Marg, Kalina, Santacruz (E), Mumbai - 400098,Tel - 022-42159465/ 9821501179; Eureka, Raheja Chambers, R. NO. 909, 9
th
Floor, 213, Nariman
Point, Tel 32583020; Enam Sec, Khatau Building, 2
nd
Floor, 44 Bank Street, Off Shahid Bhagatsing Road, Fort, Tel 22677901; Enam Sec, 201-A, Laxmi Towers, Bandra Kurla Complex, Bandra E, Tel 66803600; Enam Sec, Hari Chamber, Ground Floor, 58/64, Shahid Bhagat Singh Road, Fort, Tel 22677901; EDELWEISS ,104, 1
st
Floor, P J Tower, BSE Bldg., Dalal Street, Fort, Mumbai - 400 001; Tel. : 022 - 67471345
/ 67494586; Hem Sec,14/15, Khatau , Tel - Building, 1st Floor, 40 Bank Street, Fort,Mumbai-400023; ICICI Sec ,Mr. KSHITIJ SHARMA,Shop No 4,5,6,7Roop Maya Co-Op Hsg.Soc., Sector 6, Airoli,NAVI MUMBAI - 400708;ICICI Sec ,Mr. ANUP KUMAR,Shop No.6,7 & 8,Ground Flr.Vaishnavi Tower,Sector-44,Nerul (W).,NAVI MUMBAI - 400706;ICICI Sec ,Mr. VIKAS SHARMA,Apsara Building,Shop No. 4, Sector - 17,Vashi.,NAVI
MUMBAI - 400702;ICICI Sec ,Mr. ARVIND JHA,Gr. Floor,Tulsi Pooja Shopping Center,New Panvel (E).,NAVI MUMBAI - 410206;ICICI Sec ,Mr. SANJAY RANKA,Shop No. 1, Bhomi Tower,Sec - 4, Plot No. 28,Kharghar,,NAVI MUMBAI - 410210; ICICI Sec , Gr. Floor, H.T Parekh Marg, Back Bay Reclamation,Churchgate,,MUMBAI - 400020; ICICI Sec , SHREE SAWAN KNOWLEDGEPARK, GR. FLOOR, PLOT NO. D-507, T.T.C
INDUSTRIALAREA, M.I.D.C, TURBHE, NEAR JUINAGAR RAILWAY STATION, 400705; ICICI Sec ,Mr. MEHUL SHAH,Shop no 11, Megh Apartment, Junction of factory lanes & LT road,,MUMBAI - 400092;ICICI Sec ,Mr. ,JayaApartments, R BMehta road, Ghatkopar (E),MUMBAI -400075;ICICI Sec ,Mr. SANKALP KUMAR,Shop no. 9,10, Meriline Corner,;ICICI Sec ,Mr. ANSHULIKAPREMCHANDANI,Shop No. 1 & 2, Dilkush
Bungalow,J. P. Road, Andheri West,MUMBAI - 400058;ICICI Sec ,Mr. NILESH ARAS,56/57, Saraf Choudhari Nagar Co. Op. Soc.,Thakur Complex,Kandivali East,MUMBAI - 400101;ICICI Sec ,Mr. UMESH GUPTA,Shop No. 26, 27 & 51, Gr.Floor, Ashoka Shopping Centre,LT Marg, GT Hospital Compound,Marine Lines,MUMBAI - 400002;ICICI Sec ,Mr. ,1A&2, Balaji Arcade,S.V Road Kandivili (W),MUMBAI - 400067;ICICI Sec ,Mr.
BHAVIN GANDHI,Ground Floor,Jayshree Plaza,L.B.S. Marg, Bhandup (W),MUMBAI - 400078;ICICI Sec ,Mr. ,Gr.Floor,Shop No.7,8,9, Anand Vatika,Siddharth Nagar, Nr City Centre, S V Road,Goregaon (W),MUMBAI - 400062;ICICI Sec ,Mr. ,Gr Floor, Devraj Mall, Krishna Kunj Hsg Soc. Harishankar Joshi Road, Dahisar (E).,MUMBAI - 400068;ICICI Sec ,Mr. R SHASTRI,1St Floor Sai Kiran,Central Avenue 11Th Road
Junction,Chembur.,MUMBAI - 400074;ICICI Sec ,Mr. ARVIND TIWARI,Radha Kunj, Azadnagar,Vile Parle West,MUMBAI - 400056;ICICI Sec ,Mr. DHARMVEER SACHAN,Gr. Floor, Vardhaman Apt.,40, Hanuman Road,Vile Parle (E),MUMBAI - 400057;ICICI Sec ,Mr. PAWAN BALI,Gr. Floor, Shop No. 2,Grace Chamber, Amrit Nagar, Chakala, Andheri (E),,MUMBAI - 400093;ICICI Sec ,Mr. ,227, Gr. Floor, G-2A,Nariman
Bhavan,Nariman Point,MUMBAI - 400021;ICICI Sec ,Mr. RAJESHSINGH,Shop No. 1,2,3,4, Shagun Mall,Dindoshi, Gokul Dham, Goregaon (E),,MUMBAI - 400063;ICICI Sec ,Mr. ,Gr. Floor, H.T Parekh Marg, Back Bay Reclamation,Churchgate,,MUMBAI - 400020; ICICI Sec ,Mr. AJAY SINGH,1st Floor,Gopi Cinema Mall,,DOMBIVALI - 421202; JM Financial ,Mr Ashit Vora, 1st Floor, Patel House, Next to Bank of Baroda,M G Road,
Vileparle (East), Ph:022-2613 5202-03/67077440-43; JM Financial ,Ms.Riddhi Trivedi, Palm Court, M- Wing, 4th Floor, Goregaon Link Road,Malad (West), Ph:022-30877000/67617000-Ext.382; JM Financial ,Mr.Nilesh Gavle, Ground Floor, Anushka, New Link Rd,Andheri (West), Ph:022-66191600/612; JM Financial ,Mr R Mukundan/Ms Armin Irani, 2,3,4 Kamanwala Chambers,P M Road, Fort, Ph:022-3021 3500/2266 5577 80;
JM Financial , Ms Jyotsna Solanki/Mr C V George, Shop No 6, Dattani Trade Center,Chandra Varkar Road, Borivali (West), Ph:022- 3021 5400/6695 9120 23; JM Financial , Ms Charulata Mehta/Mr. Tilak Sanil, 424/425 Kalidas Plaza, V B Lane,Ghatkopar (East), Ph:022-3097 8700/6710 4738; KARVY,207,JEEVAN UDYOG BUILDING, 2nd FLOOR,ABOVE KHADI BHANDHAR ,D N ROAD, FORT,MUMBAI,Tel - 22062077, 2087,
2051, 2023;KARVY,7, ANDHERI INDUSTRIALESTATE,OFF: VEERADESAI ROAD,ANDHERI (WEST),Tel - 26730799 / 843 / 311 ; Kotak Sec ., 32, Gr Flr., Raja Bahadur Compound, P:22655074; Kotak Sec ., 6th Floor, Kotak Towers, Building No. 21, Infinity Park, Off Western Express Highway, Goregaon Mulund Link, Road, Malad (E),P: 6605 6825; Kotak Sec ., Nirlon House, 3rd Floor, Dr Anie Besant Road, Worli,P:66529191;
KJMC, 168, ATLANTA16TH FLOOR,NARIMAN POINT,MUMBAI 400 021, Tel - 022-40945500; LKP, Bank of Maharashtra, 45/47, Bombay Samachar Marg, Fort, Mumbai:400001,Tel 22663963; RR Equity, 18 First Floor,105 bombay Samachar Marg.,Fort, Mumbai- 400023 022-40544201/224; RR Equity, 133A, Mittal Tower, AWing, 13th Floor, NarimanPoint, Mumbai- 400021 9324804084; SUSHIL FINANCIALS ,12, HOMJI
STREET,FORT,MUMBAI 400 001; Standard Chartered ,Attn : Sandeep Chavan,Ground Floor, Anand Commercial Centre, S.V. Road, Santacruz (West), Mumbai - 400054. ,Tel - 9867439536;Standard Chartered ,Attn : Balu Salve,6, Sanghrajka House, 1st floor, 431, Dr. D.B. Marg, Opera House, Mumbai 400 004 ,Tel - 9323207578;Standard Chartered ,Attn : Rahul Jha ,6, Sanghrajka House, 1st floor, 431, Dr. D.B. Marg, Opera
House, Mumbai 400 004 ,Tel - 9930929935;Standard Chartered ,Attn : Deepak Singh,Sai Plaza, Ground Floor, Jawahar Road, Ghatkopar (East), Mumbai - 400077. ,Tel - 9920371720;Standard Chartered ,Attn : Mr. Rahul Kamble,Work Station - 1016, Standard Chartered Tower, 201-B/1,1st Floor, Western Express Highway,Goregaon (East), Mumbai 400063,Tel - 9869082673;Standard Chartered ,Attn : Jalaj Pandya,Shop No.
1&2, Shroff Towers, Sodawala Cross Lane, Borivali (West), Mumbai - 400092. ,Tel - 9167587420; SMC ,Mr. K C Motiwala,258,Perin Nariman Street First Floor Fort mumbai -400001,Tel - 9821111219; Sharekhan Ltd,Plot No - 1012, Godawn,Devi Dayal Compound,Next to Crampton & Greaves,Kanjur Village Road,Nr Kanjurmarg Station, Kanjurmarg- ( E ),Mumbai-400042,Tel - 022 6116 9179;Sharekhan Ltd,301 & 302, 3rd Floor,
Manibhuvan Co-opHsg Soc.Ltd., Plot No.343, Above ICICI Bank, S.V.Road, Pahadi Village, Goregaon(W),Mumbai - 400 062,Tel - 022-67418570/65153123;Sharekhan Ltd,ShankarAshish Bldg, 1st Floor, R.S.Marg, Chandavarkar Cross Road lane, Above HDFC Home Loans, Near ICICI Bank,Borivali (W), Mumbai- 400 092,Tel - 022- 6513 1221;Sharekhan Ltd,20;Rajabahadhur,Mansion, 1st 5g,2nd,floor Hamam street,Fort,Mumbai
400023,Tel -022 66105691/92/93; MUZAFFARNAGAR : KARVY,203/99, CSADARBAZAR, TOWN HALL ROAD,ABOVEBANKOF INDIA,MUZAFFARNAGAR,Tel - 2437349, 2437359; MURADABAD: KARVY,FIRST FLOOR, SINGHBHAWAN,,CHOWKTAARI KHANAGMD ROAD,MORADABAD,Tel - 2310470 / 2320470; MYSORE: ICICI Sec ,Mr. ANILMN,D. No. 86/3A, Panabvati Circle, Kalidasa Road,Jayalakshmipuram,,MYSORE
- 570012; KARVY,NO.9/2, NEWNOL.L-350, SILVER TOWER, 1ST FLOOR,ASHOKAROAD, OPP: CLOCK TOWER,MYSORE,Tel - 2524292, 2524294; Kotak Sec ., No: 646 - Kiran Mansion - 2 nd Floor, Chamaraja Double Road, P: 4000861; NAGPUR: Bajaj , Shop No. 5, Pushpakunja Commercial Complex, Central Bazar Road, Ramdas Peth, NAGPUR 440010, Ph: 0712-6618577; ICICI Sec ,Mr. AMIT GONDEWAR,Ganesh
Heights,Kotwal Nagar Ring Road, Khamla,NAGPUR - 440015; ICICI Sec ,Mr. RAVINDRAAKHARE,First Floor,Shop No. 138 To 140,Shree Ram Shyam Towers,,NAGPUR - 440001; KARVY,230-231, 3RD FLOOR, SHREERAM TOWER,NEAR NIT BUILDING,SADAR,NAGPUR,Tel - 6614146 / 6614145; Kotak Sec ., Plot no. 5, 3rdfloor, Lotus Gorepeth Layout WHC Road , Dharampeth, P: 6620278; Standard Chartered ,Attn : Minal
Vikhare,101/102, Shriram Shyam Towers, 1st Floor, Kingsway, Sadar, Nagpur - 440001.,Tel - 9370327614; Sharekhan Ltd,409/412, Heera Plaza, Near Telephone Exchange Square, Central Avenue, Nagpur-440 008,Tel - 0712-2731922 / 23 / 24 / 25;SharekhanLtd,Plot No. 79, 1st Floor, Universal Annex, Dharampeth Extension, Opposite New Wockhardt Hospital, Shivaji Nagar, Nagpur - 440010.,Tel - 0712 - 6654100 to 119 ; NASIK
: Bajaj , G 18 & 19 , Suyojit Sankul, Tilak Wadi, Sharanpur Road, Nashik 422002, Ph: 0253 - 6629011, 6629012; ICICI Sec ,Mr. SHAUNAK BODKE,Shop No. 67, 68, Vasant Market,Canada Corner,,NASIK - 422002;ICICI Sec ,Mr. VIHIT SALINS,Ground Floor, Plot No. 7, Mahindra Memorial Centre, Rathchakra Chowk,Vadala- Pathardi Road, Indira Nagar,NASIK - 422009; KARVY,F1, SUYOJIT SANKUL,SHARANPUR
ROAD,NASIK,Tel - 9665066531,32,33; Kotak Sec ., G-5, Suyojit Avdhoot Tower, Old Gangapur Naka, Gangapur Rd,P: 6609804; Sharekhan Ltd,5 SK Open Mall, Yeolekar Mala, Near BYK Collage, Collage Road,Nashik , 422005,Tel - 0253 6610975 to 989; NAVSARI : KARVY,1/1,1ST FLOOR, CHINMAY ARCADE,OPP: SATTAPIR, TOWER ROAD,NAVSARI,Tel - 280364, 280366,280367; NADIAD : KARVY,104-105, CITY
POINT,NEAR PARAS CINEMA,NADIAD,Tel - 2563245, 2563210; NEWDELHI : Bajaj , Bajaj House, 97, Nehru Place, New Delhi - 110019, Ph: 011- 41693000, 26410315.; Centrum ,Mr. Tajinder Pal SinghBhatia,B-33, 1st floor, Connaught Place, Inner Circle, NewDelhi - 110 001.,Tel - 011-43525545/ 9582230104; Enam Sec, M-39, IInd Floor, Outer Circle, Connaught Place, Tel - 49811200/201;ICICI Sec,Mr. ,GR. FLOOR,PREMISES
NO F-3/28, KRISHNANAGAR, MAINMARKET,,NEWDELHI - 110051;ICICI Sec ,Mr. KHAGENDRAPANT,Ground Floor, UG-05,Upper Gr. Floor,Vikas SuryaPlaza, 7 Community Centre, Road No. 44, Pitam Pura, Rani Bagh,NEWDELHI - 110034;ICICI Sec ,Mr. ,Ground Floor, Plot No. 24 ,25, LSCMayurVihar-II,NEWDELHI - 110096;ICICI Sec ,Mr. JAYDEV MANDAL,Ground Floor & Mezzanine, Ab-11,CommunityCenter Safdarjung
Enclave,NEWDELHI - 110029;ICICI Sec ,Mr. ,Ground Floor & Mezzanine, 29, Community Centre, Naraina Industrial Estate, Phase - I,NEWDELHI - 110028;ICICI Sec ,Mr. ,Building No 4, 1St Floor, SMR House, Basant Lok Vasant Vihar,NEWDELHI - 110057;ICICI Sec ,Mr. PUJAKUMARI,1st Floor, Shop No. 39, Pushpa Market, Lajpat nagar II,NEWDELHI - 110024;ICICI Sec ,Mr. RAVIKUMAR SHARMA,GroundFloor Plot no-
8A,Block No.E,HauzKhas,NEWDELHI - 110016;ICICI Sec ,Mr. MOHAMMAD AAMIR,GroundFloor & First FloorPlot No 17, Community Center,Mayapuri,NEWDELHI - 110064;ICICI Sec ,Mr. RAHUL SHARMA,GroundFloor 4435-3/6, Portion 4/7Ansari Road, Next to Corrporation BankATM, Daryaganj,NEWDELHI - 110002;ICICI Sec,Mr. RAVISHSINGH,Gr. Floor , 1St Floor, Plot No-10, LSCRajdhani Enclave, Vikas Marg, RAJDHANI
ENCLAVE, NEWDELHI - 110092;ICICI Sec ,Mr. PREETI SINGH,Ground Floor, Rohini Sector-9, NEWDELHI - 110085;ICICI Sec ,Mr. RAHULAGGARWAL,Ground Floor & Upper, 22 Central Market, Ashok Vihar,NEWDELHI - 110052;ICICI Sec ,Mr. VISHALNARANG,Unit F-7,8,9,10,11,12,13,14,Malik Buildcon Plaza-2 Pocket-V Sec 12, Dwarka,NEWDELHI - 110075;ICICI Sec ,Mr. DEEPAK THAKUR,Gr. Floor 30/5,Nangia Park
Circle, Shakti Nagar,NEWDELHI - 110007;ICICI Sec,Mr. ARINDAM BISWAS,Ground Floor 3C/4, New Rohtak Road,NEWDELHI - 110005;ICICI Sec ,Mr. MAYANK PANDEY,First Floor(Left Side), DDAShopping Complex, Alaknanda,NEWDELHI - 110019;ICICI Sec ,Mr. ASEEMKAPOOR,Plot No. 13, Community Centre, NewFriends Colony,NEWDELHI - 110065;ICICI Sec ,Mr. SAMIT KAPOOR,179 - 182, Dda Office Complex,
Rajendra Bhawan RajendraPalace,NEWDELHI - 110008;ICICI Sec ,Mr. SARIKAABROL,ShopNo. 45 & 46, Tilak Nagar,,NEWDELHI - 110018;ICICI Sec ,Mr. ,114/115,1St Floor,Arunachal Bldg 19, Barakhamba Road,Connaught Place,NEWDELHI - 110001;ICICI Sec ,Mr. JITENDERARYA,J2/21, 1St Floor, Rajouri Garden,,NEWDELHI - 110027; JM Financial , Mr Prasad Nair/Mr C S Tiwari, 114 Himalya House,23,K G Marg, Ph:011-
4130 5000/3092 5500; KARVY,105-108, ARUNACHALBUILDING,19, BARAKHAMBAROAD, CONNAUGHT PLACE,NEWDELHI,Tel - 23324401 / 43509200; Kotak Sec ., 202-217, 2nd Floor, Ambadeep Building, 14, Kasturba Gandhi Marg.P:66313131; KJMC, 221, HANS BHAWAN, 2ND FLOOR, BAHADUR SHAH ZAFARMARG,NEWDELHI 110 002, Tel - 011-23370091; RR Equity, 47, M.M. Road, Rani Jhansi Marg, Jhandewalan,
New Delhi 110055 011-23636363/62; RR Equity, 105, Anchal Plaza,Nelson Mandela Road Vasant Kunj,New Delhi-110070, 011-26891262,26134764 ;RR Equity, 105, Pratap Bhawan , Bahadur Shah Zafar Marg, New Delhi - 110001 011- 49505500,41509018; RR Equity, 118, Gagandeep Building, Rajendra Place , New Delhi- 110008 011- 25764872,41538956; RR Equity, 106, Pankaj Chambers, Preet Vihar Community Centre,
Delhi - 110092, 011-42421238-39, 49504400; RR Equity, Shop No. 24, FD Market, Pitampura , Delhi - 110034 011 27311419; RR Equity, N-24 - 25, Connaught Place, New Delhi - 110001 011- 41523306, 46308803, 41523229; RR Equity, 111, Jyotishikhar, 8 Distt. Centre , Janakpuri, New Delhi - 110018 011- 25617654; Standard Chartered ,Attn : Mohd. Arif Jamal,E-2/27,Ground Floor, Main Link Road, Jhandewalan, Gate No.2,
New Delhi-110 055,Tel - 9818704922;Standard Chartered ,Attn : Suvi Mishra,52-53, Malviya Smriti Bhawan, DeenDayal Upadhyay Marg, New Delhi-110002.,Tel - 9999966498/9310022558;Standard Chartered ,Attn : Syed Haider Abbas,52-53, Malviya Smriti Bhawan, Deen Dayal Upadhyay Marg, New Delhi-110002.,Tel - 9358844612/8957134701;Standard Chartered ,Attn : Krishan Deep Singhal,52-53, Malviya Smriti Bhawan,
Deen Dayal UpadhyayMarg, New Delhi-110002.,Tel - 9829220486/09582200486;Standard Chartered ,Attn : Richa Mittal,159, Aggarwal Citi Plaza, Plot No. 17, Manngalam Place, Sector3, Rohini, New Delhi -110 085. India,Tel - 9818820126;Standard Chartered ,Attn : Vivek Prakash Rai,159, Aggarwal Citi Plaza, Plot No. 17, Manngalam Place, Sector3, Rohini, New Delhi -110 085. India,Tel - 9711407979; SMC ,Mr. Puneet Gupta,503,
Ansal Bhawan Barakhamba Road New Delhi 110001,Tel - 9871626464;SMC ,Mr. Keshav Jejware,6B, First Floor Himalaya House 23, K G Marg Connaught place New Delhi -110 001 ,Tel - 9958696929;SMC ,Mr. Mahesh Gupta,17 , Netaji Subhash Marg, Daryaganj, New Delhi-110 002 ,Tel - 9818620470, 9810059041; Sharekhan Ltd,39, First Floor, Samyak Tower, Near Metro Pillor No. 120, Pusa Road, New Delhi - 110005,Tel -
011-45117000 ; NOIDA : ICICI Sec ,Mr. SARFARAZ AHMED,16, 15, 14, &12-A, Ground Floor,Msx Tower Ii,,GREATER NOIDA- 201306; ICICI Sec ,Mr. KUMAR SHIVENDRA,B 1/34-35,Central Market, Sector-50,NOIDA- 201301; KARVY,307,2nd FLOOR JAIPURIAPLAZA, D-68A,2ND FLOOR, (OPP DELHI PUBLIC SCHOOL) SECTOR 26,NOIDA,Tel - 2539271 / 2539272 / 2539273; Kotak Sec , 2nd Floor, G-31-32, Atta Market,
Sector-18,P: 4606911; RR Equity, P-5,Sector - 18,Noida- 201301, Uttar Pradesh 0120-4336992; SMC ,Mr. Kapil Chopra,106-Ocean Plaza .P-5 SEC-18, NOIDA-201301,Tel - 9717000378; PATNA : Bajaj , Flat No. 108, 1st Floor, Ashiana, Plaza, Budha Marg, Patna 800001, Ph: 0612- 6451056 - 59, 61 63; ICICI Sec ,Mr. ANUP SRIVASTWA,ICICI Bank Premises,Sumitra Sadan, Boring Road Crossing,,PATNA - 800001;
KARVY,ANAND TOWER, 2ND FLOOR, EXHIBITION ROAD,NEAR REPUBLIC HOTEL, OPP: ICICI BANK,PATNA,Tel - 2321354 / 56 / 57; KotakSec ., Office No.7, Twin Tower Hathwa, South Gandhi Maidan,P: 2224620; RR Equity, 422-23, 4th Floor,Ashiyana Harniwas Complex,NewDak Bunglow Road Patna Bihar 800001 9334114868, 9334114868; SMC ,Mr. Shekhar,Frontline Financial Consultancy Pvt. Ltd. 209, 2nd Floor,
Pandey Mall ,Fraser Road, PATNA, 800001 ,Tel - 9798981521; Sharekhan Ltd,406-407 B,Ashiana Plaza,Budh Marg,Patna,800001,Tel - 0612-2213112 / 13 / 14 / 15 / 16;Sharekhan Ltd,117, Palika Bazar, !st Floor, Raj Mahel Road, Patan, Gujarat,384265,Tel - 02766 - 223038 / 325759 ; PATIALA : KARVY,SCo 27b,CHHOTI BARANDARI,PATIALA,Tel - 5051726 / 5051727 / 5051728; PANIPAT : KARVY,1ST FLOOR, KRISHNA
TOWER,ABOVE AMERTEX, GT ROAD,PANIPATH,Tel - 2644308 / 2644376 ; PONDICHERRY : Bajaj , No. 127/A, 100 Ft. Road,Natesan Tower, 1st Floor, Natesan Nagar, Pondicherry 605001, Ph: 0413 -6452334, 6452335; ICICI Sec ,Mr. PRABHU PONNUSAMY,Gr. Floor, AvnPlaza, 100 Ft Road, Gayatri Nagar, Mudaliarpet,PONDICHERRY -605004; KARVY,NO.7,THIAYAGARAJASTREET,PONDICHERRY,Tel - 2220640; PUNE
: Bajaj , ShopNo 6, Sanas Plaza, 1302, Subhash Nagar, Bazirao Road, Pune 411002, Ph: 020-65009460, 61; Centrum ,Mr. Abhishek Mehta,401 B & C, City Point,17 Boat Club Road,Pune - 411 001,Tel - 020-30488112/ 9765555651; Enam Sec, 1248A, Asmani Plaza, Coodluck Chowk, Deccan Gymkhana, Shivaji Nagar, Tel 25521606; EnamSec, 101 & 102, Silver Prestige, 1
st
Floor, Swargate, Tel 30205492/93; ICICI Sec ,Mr.
ABHINAV KUMAR,Ground Floor, Abhimanshree Apartments-2 Condominium Bhuvaneshwar Society, Aundh,PUNE - 411007;ICICI Sec ,Mr. JANKI VYAS,GroundFloor, Sheetal Plaza, CTS No. 1125,Final Plot No.499 Model Colony, Shivajinagar,Bhamburda,PUNE - 411016;ICICI Sec ,Mr. VIJAY AVHAD,RAMAS.No 682/A, CTS No1048, Plot No 49, Chatrapati Rajaram Co-Op Hou.Soc, Jedhenagar,Bibwewadi,PUNE- 411037;ICICI
Sec ,Mr. RAJ R,Office No.3, TeddiesApartment Kondhawa,PUNE - 411048;ICICI Sec ,Mr. ,Gr. Floor &Mezzanine,Krishnakunj, S No.211, Hissa No. 2E, Plot No. 17 Kalyaninagar, Yerwada,PUNE - 411006;ICICI Sec ,Mr. SEEMAKUMARI,Gr. Floor & Basement, Pramila Apt, Plot No. 16, Beside Hotel Kamat, Dahanukar Colony Circle, Kothrud,PUNE - 411029;ICICI Sec ,Mr. RAHUL RATHI,Gr.Floor, 86A,SurveyNo.390/1684-1, M.G.Road,
Camp,PUNE - 411001;ICICI Sec ,Mr. ,Groud Floor, Premsagar,H Wing , Chinchwad,PUNE - 411033;ICICI Sec ,Mr. RUCHI SINGH,Shop No 1 & 2 Gr. Floor, Sneh Bldg, Cts No 1404, Pimpri,PUNE - 411017;ICICI Sec ,Mr. AASHISH AGARWAL,Ground Floor, KPCT B Wing, S No.16,Hisa No.1/1,CTS No.912,Wanawadi ,Fatimanagar.,PUNE - 411040; JM Financial , Mr Anand Shirke/Mr Sanjay Yelwande, 205 Business Guild , Law
College Road, Erandawane, Ph:020-3987 1600-01/ 66033730; KARVY,OFFICE NO.6, THIRDFLOOR, RACHANATRADE ESTATE,LAWCOLLEGE ROAD, NEAR SNDT CIRCLE, CTS NO.105, ERANDWANE,PUNE,Tel - 66048790 (5 LINES) / 91 / 92 / 93; Kotak Sec ., 2 ND FLOOR, KUMAR BUSINESS CENTER,BUND GARDEN ROAD, P: 66066129; Standard Chartered ,Attn : Sagar Waikar,A/2, 1st Floor, Deccan Chambers,
C.T. Survey No. 33/40, Erandwane, Karve Road, Pune - 411004. ,Tel - 9860004662; SMC ,Mr. Ashutosh,1ST Floor, Dealing Chamber, J MRoad, Pune, 411004,Tel - 9769345255; Sharekhan Ltd,301, Millenium Plaza, 3rd Floor, Opp Fergusson College main Gate, Fergusson College Road,Shivaji Nagar, Pune-411 004.,Tel - 020 - 66021301 /02/03/04/05/06; PANIJIM : Bajaj , F2, 1st Floor, Alfran Plaza, Panaji, Goa, Panaji 403001,
Ph: 0484 2356869, 70; KARVY,18,19,20, CITY BUSSINESS CENTRE, COEL HO PEREIERABUILDING,DADAVIADYAROAD, OPP JAMAMASZID ROAD,PANJIM,Tel - 2426870, 2426871, 2426872; Kotak Sec ., 2ND Floor,Gurusai Plaza,Isidoria Baptista Road,Margao,P: 6624833; Standard Chartered ,Attn : Rajesh Naik,15, 16 & 17, Haroons Arcade, Magnum Center, 1st Floor, M. G. Road, Panaji, Goa - 403001. ,Tel -
9822588602; Sharekhan Ltd,F49/F50, 1st Floor, B Block, Alfran Plaza, M.G. Road, Panaji, Goa - 403001,Tel - 0832- 2421460; RAIPUR: ICICI Sec ,Mr. ,Maruti Business Park, Ff-03, Ge Road,,RAIPUR -492001; KARVY,LOWER LEVEL-02& 03, MILLENNIUM PLAZA,,NEARINDIAN COFFEE HOUSE, G E ROAD,RAIPUR,Tel - 2236694,96 ,4039320; Kotak Sec ., Menzanine Fllor, Chawla Complex, Devendra Nagar Road, P: 251555;
RAJAHMUNDRY : ICICI Sec ,Mr. RAJU MP,Door No: 46-22-11, Karrisu Reddy Plaza, Danavaipeta, East Godavari District,,RAJAHMUNDRY - 533103; KARVY,D NO 6-1-4, 1ST FLOOR,RANGACHARY, T NAGAR,RAJAHMUNDRY,Tel - 2434468,69,70; RAJKOT: Bajaj , Prathibha Complex, Moti Tanki Chowk, Rajkot 360001, Ph: 0281-6450135, 37; Enam Sec, 308, 3
rd
Floor, Tower Commercial Complex, Jawahar Complex, Tel
2226383/384; ICICI Sec ,Mr. MANISH SAVALIYA,1st Floor, Shantiniketan Complex ,150 Feet Ring Road, RAJKOT - 360007; JM Financial , Mr. Sona Verghese, 202 Solitaire, 2nd Floor, Swami Vivekananda Marg, Ramkrishna Nagar,Ph:0281-3984000/3984101; KARVY,104, SIDDHIVINAYAK COMPLEX,DR. YAGNIK ROAD, OPP. RAMKRISHNAASHRAM,RAJKOT,Tel - 3291043, 3291042, 2239338; Kotak Sec., Nath Complex,
2nd floor, Yagnik Road.P:2459436; SMC ,Mr. Dhariya ,302/B 3rd Floor,Shivalik- 5 | Makkam Chowk | Gondal Road.Rajkot -360 002 ,Tel - 8000903984; Sharekhan Ltd,102/103,Hem Arcade,OppVivekanand Statue,Dr Yagnik Road,Rajkot-360001,Tel - 0281-2482483 / 84 / 85; RANCHI : Eureka , G-2, Qtr, Shree Gopal Complex, Court Road, Tel 06512200230/2209646; ICICI Sec ,Mr. SATYASAURABH,First Floor, Ranchi Club
Complex , Main Road,RANCHI - 834001; KARVY,203,COMMERCE TOWERS, 2ND FLOOR,BESIDE MAHABIR TOWERS , MAIN ROAD,RANCHI,Tel - 2330386, 2330394, 2330320; Kotak Sec ., Shop no. 24 & 25, 2nd Floor, A.C. Market, G.E.L. Church Complex, Main Road, P:2200860; Sharekhan Ltd,Shree Gopal Complex,4th Floor,Room No I,Court Road,Ranchi,834001,Tel - 0651-2208205 / 2309156 ; ROURKELA :
KARVY,PLOT NO.554, 1ST FLOOR, SANDHUCOMPLEX,KACHERY ROAD, UDIT NAGAR,ROURKELA,Tel - 2510770, 2510771, 2510772; SALEM : Bajaj , 22, GF, OmalurMain Road, SALEM 636009, Ph: 0427 -6452565, 6452566; ICICI Sec,Mr. KARUPPAIAN C,1st floor, 270/1, Bharathi Street, Swarnapuri,,SALEM - 636004; KARVY,40, BRINDAVAN ROAD,5th cross,FAIR LANDS,SALEM,Tel - 2335701,02,03,04,05; Kotak
Sec ., 5/241, F Rathna Arcade Five Road,Meyyanur,P: 2335476; Sharekhan Ltd,Sri Ganesh Tower,561,2nd Floor,Saradha College Main Road,Salem - 636007,Tel - 0427 - 6454864 / 65/ 66; SURAT : Bajaj , L-4, Ground Floor, Vishwakarma Chambers, Majura Gate Crossing Road, Ring Road, Surat - 395002, Ph: 0261-6450421, 6450422; ICICI Sec ,Mr. ,1St Floor, Viishal Chambers, Nr. Athwagate Charrasta,Besides Sardar
Bridge,SURAT -395001;ICICI Sec ,Mr. BHAVIN PATEL,G/10, 11, 12 Sarthi Complex, Hira Baug, Warachha,SURAT - 395006;ICICI Sec ,Mr. KULDEEPSINGH,Shop No.35,36 & 37,2Nd Floor, Shreeji ArcadeComplex Anand Mahal Road,Adjan Road,SURAT - 395009; JM Financial , Mr. Dipen Shah/Mr. Nishant Trivedi, 407, 4th Floor, 21 Century Business Centre, Ring Road, Ph:0261-3984000; KARVY,G-16, EMPIRE STATE BUILDING,
NEAR UDHANADARWAJA,RING ROAD,SURAT,Tel - 3017155 - 52; Kotak Sec ., Kotak House, K G Point, 1st Floor, Nr.Ganga Palace, Ghoddod Road.P: 2254553; RR Equity, 9-Ravi Raj Society, Behind Gayatri Mandir,New City Light Road Surat Gujarat 395002 0261-2265818, 9925233692; Standard Chartered ,Attn : Dharmesh Prajapati,U-18,Upper Ground Floor, Jolly Plaza, Athwagate, Surat 395001 ,Tel - 9913166765;
Sharekhan Ltd,M-1 to 6,Jolly Plaza, Mezzanine Floor, Athwa Gate, Surat - 395 001,Tel - 0261 - 6560310 - 6560314; SILIGURI : Bajaj , 3rd Floor, Jatin DasSarani, Ashram Para, Siliguri, Siliguri 734001, Ph: 9641831375; Eureka , 2
nd
Floor, Metro Plaza, S.F. Road, Khalpara, Silliguri 734405, Tel 9832379189; KARVY,NANAK COMPLEX,2ND FLOOR, SEVOKE ROAD,SILIGURI,Tel - 2526393, 2526394; Kotak Sec ., Nanak Complex,
2nd Floor, Sevok Road ; Standard Chartered ,Attn : Ratnesh Shukla,Pratap Market, 1st floor, Sevoke Road, Siliguri - 734401. ,Tel - 9614433804 / 9735099233; SHIMLA: KARVY,TRIVENI BUILDING, BY PASCHOWK,KHALLINI,SHIMLA,Tel - 2003205 / 2623205 / 2624453; SHIMOGA: KARVY,NO.8-50/A, LLR ROAD; OPP: TELECOMGMS OFFICE,DURGIGUDI,SHIMOGA,Tel - 228795,96,97,226747; SHILLONG: KARVY,MANI
BHAWAN ANNEX, THANE ROAD,OPP: RKM ELP SCHOOL, LOWER POLICE BAZAR,SHILLONG,Tel - 2224186 / 75 / 8172; THANE MUMBAI : Bajaj , Rashesh Building, Shop no. 11, 1st Floor, 150 ft Road, Bhayandar (w), Thane - 401104, Ph: 022 - 65991662 - 63; ICICI Sec ,Mr. ,Ground Floor, Block 1, Shop No 3,Emerald Plaza, Hiranandani Meadows,Glady Alvares Marg, Off Pokhran Road No. 2,Thane (W),THANE -
400610;ICICI Sec ,Mr. ,Olympia Bldg, Poonam Sagar Mira Road (East),THANE -401107;ICICI Sec ,Mr. MUDASSAR VALSANGKAR,1St Floor, Office No. 2, Gaurangi Chambers, L.B.S. Marg.,THANE - 400602;ICICI Sec ,Mr. ,Ground Floor, Galleria, Talao Pali,,THANE - 400602; TRICHUR : Bajaj , VIII/78/9, Bharatha Kshemam Building, Next to SBI ATM, College Road, East Fort, Thrissur 680005. Ph: 0487-6451533, 70; ICICI
Sec ,Mr. ,R.V.Trade Centre, Third Floor,Patturaickal,THRISSUR - 680022; KARVY,2ND FLOOR, BROHERSCOMPLEX, NEAR DHANALAXMI BANK HEAD OFFICE,NAIKKANAL JUNCTION,THRISSUR,Tel - 2322483 / 2322484; SharekhanLtd,Pooma Complex,1st Floor,M GRoad,Thrissur - 680001,Tel - 0487-2446971 / 72 / 73 / 74; TIRUPATI : ICICI Sec ,Mr. VENKATAVENKUMAHANTHI,Gr.Flr D/o: 19-3-12/J4, Ramanuja Circle,
Tirchanoor Road,,TIRUPATI - 517501; KARVY,NO16FIRST FLOOR, RC ROAD,0,TIRUPATI,Tel -2252756; TIRUPUR : ICICI Sec,Mr. ,The Coocoon,No.56/1, Sabari Salai, Binny Compund,,TIRUPUR -641601; KARVY,244 A, 1ST FLOOR,,KAMARJ ROAD, OPP COTTON MARKET COMPLEX,TIRUPUR,Tel - 2214221 / 2214319; TRICHY: ICICI Sec ,Mr. SADIQ BASHA,Gr. Floor, No. B14Colony Main Road, Thillai Nagar,TRICHY
- 620017; KARVY,SRI KRISHNAARCADE,60, THENNUR HIGHROAD, THENNUR,TRICHY,Tel - 2791322 / 2798200 91000 ; Kotak Sec ., C-56,1-24-4th cross, Thillai Nagar; TRIVANDRUM : Bajaj , Edamala Plaza, TC 14/999Vellayambalam Road, Vazahuthacadu Sasthamangalam Post, Thiruvananthapuram 695010, Ph: 0491-6450176; ICICI Sec ,Mr. ARYAVIJAYAN,2 Nd Floor,Kamala Towers , Vazhuthacaud,,TRIVANDRUM
- 695014; KARVY,2ND FLOOR, AKSHAYATOWERS,SASTHAMANGALAM,TRIVANDRUM,Tel - 2725989 / 90 / 91; Kotak Sec ., Mahesh Estates, 2nd Floor, T L -15/1805, Vazhuthacadu, P: 2337423; UDAIPUR : ICICI Sec ,Mr. ANKIT BHATNAGAR,Sf, 5C, Madhuvan, ,UDAIPUR -313001; KARVY,201-202, MADHAV CHAMBERS,OPP: GPO MADHUBAN,UDAIPUR,Tel - 5101601/ 5101602; Kotak Sec ., 222/12, Ist Floor, Mumal
Towers, Saheli Marg, P: 513901; Standard Chartered ,Attn : Lalit Soni,Abhay Niwas, 5, 1st Floor, Residency Road, Udaipur - 313001. ,Tel - 8104191453; Sharekhan Ltd,4 BHATT JI KI BARI,UDAIPUR,,Tel - 0294-2426945 ; UJJAIN: KARVY,101, ASTHATOWER, 13/1, DHANWANTARY MARG,FREEGANJ,UJJAIN,Tel - 4250001 TO 4250010; VADODARA: Bajaj , 129 Siddharth Complex, R CDutt Road, Vadodara 390007, Ph:
0265 3088162; Centrum ,Mr. Nikunj Amin,122 Dwarkesh Complex, R C Dutt Road, Vadodara - 390 007.,Tel - 0265-2353603/ 09879298550; Enam Sec, GF 9, Silverline Towers, Sayajiganj, Tel 3026945/46; Enam Sec, 642, Fortune Towers, Sayajiganj, Tel 2225412;ICICI Sec ,Mr. TUSHAR DAVE,Ground Floor, Gardenview Chambers, Sayajiganj,VADODARA- 390005;ICICI Sec ,Mr. HARSHIL DESAI,Amrapali Complex, 1St Floor,
Shop No. 142, 143, 144, 145, 146, Water Tank Road, Karelibaug.,VADODARA- 390018;ICICI Sec ,Mr. BHUMISH PATEL,Rutukalash Complex, Gr Floor, Shop No 7,8,9 TulsidhamChar rasta, Manzalpur,VADODARA- 390011;ICICI Sec ,Mr. HITESH PARMAR,1St Floor, Gokulesh Ii, 96 Sampatrao Colony,R.C.Dutta RoadAlkapuri.,VADODARA- 390007; JMFinancial , Mr. Ghanshyam Vyas, G1Ground Floor, Shohan, 49 Alkapuri Society,
Alkapuri, Ph:0265-3984 311; KARVY,B -3,Mangaldeep complex,,Opp,Masonic hall,Productivity Road,,,VADODARA,Tel - 2322864 / 3243348;KARVY,T-2, 3RD FLOOR SAVOY COMPLEX, HARIBHAKTI EXTN,,OPP. ABS TOWER, OLD PADRA ROAD,VADODARA,Tel - 6456183 / 6456186; Kotak Sec ., 216, Meghdhanush Complex, Race Course Road (South),P: 2314455; RR Equity, 222 Siddharth Complex,RC Dutta
Road.,Vadodra- 390007 0265-3256190/2353195; Standard Chartered ,Attn : Dipen Shah,F-101, Savoy Complex, Old Padra Road, Vadodara - 390020. ,Tel - 9825533141; Sharekhan Ltd,6-8/12,Sakar Complex,1st Floor,Opp ABS Tower,Haribhakti Extension,Old Padra Road,Vadodara-390015,Tel - 0265 - 2322938 ; VALSAD : KARVY,SHOP NO.2, PHIROZACORNER,TITHAL CROSS ROAD,VALSAD,Tel - 326901, 326902;
VARANASI : Bajaj , D-58/53-54, 1st Floor, Shiva Complex, Rath Yatra Crossing, Varanasi 221010, Ph: 0265-6450181; ICICI Sec ,Mr. SAPNATIWARI,21/2A, 1St Floor, Karnachha Rathyatra Road,,VARANASI - 221001; KARVY,D 64 / 132, KA, 1ST FLOOR,ANANT COMPLEX, SIGRA,VARANASI,Tel - 2225365 / 2227257; RR Equity, Shop no. 38, Ground Floor Kuber Complex, Rath Yatra 9415201997; VASCO : KARVY,B-2,
1ST FLOOR, RAGHUNATH APARTMENTS,OPP: AUTO SERVICE, F LGOMES ROAD,VASCO - GOA,Tel - 2518019, 2518020; VIJAYAWADA: Bajaj , Kalyan Complex 39-1-89, 1st Floor, Beside OBC Bank, Temple Street, M.G. Road, Labbipet, Vijayawada - 520010, Ph: 0265 - 6450181; ICICI Sec ,Mr. ,29-6-31, 1St Floor, Sai Srinivasa Shopping Complex, Nakkal Road, Suryaraopet,,VIJAYAWADA- 520001; KARVY,39-10-7,
OPP: MUNICIPAL WATER TANK,LABBIPET,VIJAYAWADA,Tel - 2495200 / 400 / 500 ; Kotak Sec ., 40-1-48/1, Labbipet, M.G.Road,P: 6649061; Sharekhan Ltd,Centurian Plaza, D. No: 40-1-129, 2nd floor, Old coolex Building, M.G. Road, Vijaywada,520 010,Tel - 0866-6629993; VISAKHAPATNAM : Bajaj , Door No. 10-1-125, 1ST Floor, Asilmetta Junction, Beside Prasad Labs, Visakhapatnam 530003, Ph: 0891-6461773, 74;
ICICI Sec ,Mr. ,1-83-43, 1St Floor, Narendra Polyclinic Building, M V P Colony.,VISAKHAPATNAM - 530017; JM Financial , Mr K SN Murthy, Door No 9-1-224/4/3, 1st Floor, Nandan Nirman,CBM Compound, Ph:0891-3983800; KARVY,47-14-5/1, ESWAR PARADISE,DWARAKANAGAR MAIN ROAD,VISHAKAPATNAM,Tel - 2752915 to 18; Kotak Sec ., Door No.47-10-15, VRC Complex , 2ndFloor, Railway Station Rd , Dwarka
Nagar, P: 6642009; Standard Chartered ,Attn : Vithalacharya Peddinti,Vijayalakshami Nilayam, 1st Floor, 10-50-81, Rock Dale Layout, Waltair Main Road, Visakhapatnam - 530002. ,Tel - 9032476139; Sharekhan Ltd,28-2-46, Second Floor, Daspalla Complex, Suryabagh, Visakhapatnam - 530020,Tel - 022- 6643297;
NRI APPLICANTS SEEKING ALLOTMENT OF BONDS IN PHYSICAL FORM SHALL SUBMIT THE APPLICATIONS ONLY AT : MUMBAI, DELHI, AHMEDABAD, HYDERABAD, CHENNAI, BANGALORE, CHANDIGARH AND KOCHI.
IN THE NATURE OF FORM 2A - MEMORANDUM CONTAINING SALIENT FEATURES OF THE PROSPECTUS
4 INDIAN RAILWAY FINANCE CORPORATION LIMITED
GENERAL INSTRUCTIONS
TERMSOF THEISSUE
The Bonds being offered as part of the Tranche 1 Issue and are subject to the provisions of the SEBI
Debt Regulati ons, the Compani es Act, CBDT Notification No. 52/2011.F.No. 178/56/2011-(ITA.1) dated
September 23, 2011, the terms of the Shel f Prospectus, the Tranche Prospectus, the Appl ication Form,
the terms and condi tions of the Trustee Agreement and the Debenture Trust Deed, other appl icabl e
statutory and/or regulatory requirements including those issued from time to time by SEBI/the GoI /RBI/
BSE/NSE, and/or other statutory/regulatory authoriti es rel ating to the offer, issue and listing of securities
and any other documents that may be executed in connection wi th the Bonds.
1. Authority for the Issue: The GoI, by virtue of power conferred upon it under Section 10(15)(iv)(h) of the
Income Tax Act, 1961, has issued Notificati on No. 52/2011.F.No. 178/56/2011-(ITA.1) dated September
23, 2011 authorising the Company to issue the said Bonds upto an aggregate amount of ` 10,00,000 lakhs
during the fi nancial year 2011-12. The Company has already raised secured tax free, redeemable, non-
cumulative, non-convertible bonds through pri vate placement route, aggregati ng to ` 73,111 l akhs. The
deemed date of all otment was November 8, 2011 and the date of refund was December 1, 2011. The
l isti ng and tradi ng i n these bonds have commenced on NSE and BSE from December 11, 2011 and
December 8, 2011 respectively. Thus, the Company shall issue Bonds upto an aggregate amount of `
6,30,000 l akhs through thi s Issue during the fi nancial year 2011-12 out of the total permi ssi ble amount
of ` 10,00,000 lakhs, as approved by i ts Board through i ts resolution dated January 10, 2012.
2. Issue and Status of Bonds: 2.1. Public Issue of Tax Free Secured Redeemable Non Convertible Bonds
in the nature of Debentures havi ng tax benefits under Section 10(15) (iv) (h) of the Income Tax Act, 1961
not exceeding ` 6,30,000 lakhs at par in one or more tranches in the financial year 2011-12. 2.2. The Bonds
shall be secured pursuant to a Debenture Trust Deed and underlying security documents. The Bondholders
are enti tled to the benefit of the Debenture Trust Deed and are bound by and are deemed to have notice
of all the provisions of the Debenture Trust Deed. 2.3. The Company is issuing the Bonds in accordance
wi th the Notificati on No. 52/2011.F.No. 178/56/2011-(ITA.l) dated September 23, 2011 i ssued by CBDT.
2.4. The Bonds are i ssued in the form of tax-free, secured, redeemable, non-converti bl e bonds in the
nature of debentures. 2.5. The cl ai ms of the Bondholders shal l rank pari-passu inter-se and shall be
superior to the claims of any unsecured creditors of the Company and subj ect to applicable statutory and/
or regulatory requi rements, rank pari passu to the claims of creditors of the Company secured against
charge on the movable assets comprising of roll ing stock such as wagons, locomotives and coaches.
3. Form, Face Value, Title and Listing etc.: 3.1.1. Form of Allotment: The Allotment of the Bonds shall be
in a dematerialized form as well as physical form. The Company has made depository arrangements with
CDSL and NSDL for the issuance of the Bonds in dematerialized form, pursuant to the tripartite agreement
dated May 8, 2003 among the Company, CDSL and the Registrar to the Issue and the tripartite agreement
dated January 23, 2002 among the Company, NSDL and the Registrar to the Issue (collectively, Tripartite
Agreements). The Company shall take necessary steps to credit the Depository Participant account of the
Appl icants with the number of Bonds allotted in demateriali zed form. The Bondholders holdi ng the Bonds
in dematerialised form shall deal with the Bonds in accordance with the provisions of the Depositories Act,
1996 (Depositories Act) and/or rules as notified by the Depositories from time to time. 3.1.2. The Bondholders
may remateri ali ze the Bonds issued in dematerial ized form, at any ti me after Al lotment, i n accordance
with the provisions of the Depositories Act and/or rul es as notified by the Depositories from time to time.
3.1.3. In case of Bonds issued in physical form, whether on Al lotment or on remateri ali zation of Bonds
Al lotted in demateri ali zed form, the Company wi ll issue one certi ficate for each Series of the Bonds to
the Bondholder for the aggregate amount of the Bonds that are held by such Bondhol der (each such
certi fi cate, a Consol i dated Bond Certificate). In respect of the Consol idated Bond Certi fi cate(s), the
Company wi ll, on receipt of a request from the Bondhol der withi n 30 days of such request, spli t such
Consolidated Bond Certi ficate(s) into smaller denominations in accordance with the applicable regulations/
rul es/act, subj ect to a mini mum denominati on of one Bond. No fees wil l be charged for spl itti ng any
Consol idated Bond Certificate(s) and any stamp duty, if payable, wil l be pai d by the Bondhol der. The
request to spl it a Consol idated Bond Certificate shall be accompanied by the original Consolidated Bond
Certifi cate(s) which wi ll , on issuance of the spl it Consoli dated Bond Certi fi cate(s), be cancel led by the
Company. 3.2.Face Value: The face value of each Bond is ` 1,000. 3.3.Title: 3.3.1In case of: i)Bond(s) held
in the demateri ali zed form, the person for the ti me bei ng appearing in the register of benefi cial owners
mai ntained by the Depositori es; and i i) Bond(s) held in physi cal form, the person for the ti me being
appeari ng i n the Regi ster of Bondhol ders (as defi ned bel ow) as Bondhol der, shal l be treated for al l
purposes by the Company, the Debenture Trustee, the Depositori es and all other persons deali ng wi th
such person as the holder thereof and its absolute owner for all purposes whether or not it is overdue and
regardless of any notice of ownership, trust or any i nterest i n i t or any writi ng on, theft or loss of the
Consolidated Bond Certi ficate issued in respect of the Bonds and no person will be liabl e for so treating
the Bondholder. 3.3.2. No transfer of title of a Bond will be valid unless and until entered on the Register
of Bondholders or the regi ster of benefi cial owners, maintained by the Depositori es and/or the Company
or the Registrar to the Issue prior to the Record Date. In the absence of transfer being registered, interest
and/or Maturi ty Amount, as the case may be, will be paid to the person, whose name appears first in the
Regi ster of Bondhol ders or regi ster of benefi cial owners maintained by the Deposi tori es and/or the
Company and/or the Regi strar to the Issue, as the case may be. In such cases, cl aims, if any, by the
purchasers of the Bonds wil l need to be settled with the seller of the Bonds and not wi th the Company
or the Registrar to the Issue. 3.4. Listing: The Bonds will be listed on NSE and BSE. NSE and BSE have
gi ven thei r i n-pri nci ple l isti ng approval by thei r letters no. NSE/LIST/157151-7 and no. DCS/SP/PI-
BOND/07/11-12, respectively, both dated January 19, 2012. The Designated Stock Exchange for the Issue
is NSE. 3.5. Market Lot: 3.5.1. The Bonds shall be allotted in physical as well as dematerialized form. As
per the SEBI Debt Regulations, the trading of the Bonds shall be in dematerialised form only. Since, the
trading of Bonds i s in demateriali ze form, tradable l ot i s one Bond (Market Lot). 3.5.2. For details of
All otment, see Issue St ructure beginni ng on page 32 of Prospectus Tranche - 1. 3.6. Procedure f or
Rematerialisation of Bonds: Bondholders who wish to hold the Bonds in physical form, after having opted
for allotment in dematerialised form may do so by submitting a request to their Depository Participant, in
accordance wi th the applicable procedure stipulated by the Deposi tory Participant.
4. Transfer of the Bonds, Issue of Consolidated Bond Certificates, etc.: 4.1. Register of Bondholders: The
Company shall maintain at its regi stered office or such other place as permitted by secti on 152A of the
Compani es Act a Register of Bondhol ders containing such particulars of the legal owners of the Bonds.
Further, the register of benefi cial owners maintained by Depositories for any Bond in dematerialized form
under Section 11 of the Deposi tories Act shall al so be deemed to be a Register of Bondholders for this
purpose. 4.2. Transfers: 4.2.1 Transfer of Bonds held in dematerialized form: Inrespect of Bonds held in the
dematerialized form, transfers of the Bonds may be effected, only through the Depositories where such
Bonds are held, in accordance wi th the provisi ons of the Depositories Act and/or rules as noti fied by the
Depositories from time to ti me. The Bondholder shal l give del ivery instructions containing detai ls of the
prospecti ve purchasers Deposi tory Participants account to his Deposi tory Participant. If a prospecti ve
purchaser does not have a Depository Partici pant account, the Bondholder may remateri ali ze his or her
Bonds and transfer them in a manner as specified in 4.2.2 below. 4.2.2 Transfer of Bonds in physical form:
The Bonds may be transferred by way of a duly executed transfer deed or other sui table instrument of
transfer as may be prescribed by the Company for the registration of transfer of Bonds. Purchasers of Bonds
are advised to send the Consol idated Bond Certifi cate to the Company or to such persons as may be
notified by the Company from time to ti me. If a purchaser of the Bonds in physical form intends to hold
the Bonds in dematerialized form, the Bonds may be demateri alized by the purchaser through his or her
Deposi tory Partici pant in accordance with the provisi ons of the Depositories Act and/or rul es as notifi ed
by the Depositories from time to time. 4.3. Formalities Free of Charge: Registration of a transfer of Bonds
and issuance of new Consolidated Bond Certificates will be effected without charge by or on behalf of the
Company, but on payment (or the giving of such indemnity as the Company may require) in respect of any
tax or other governmental charges which may be imposed in relati on to such transfer, and the Company
being satisfied that the requirements concerning transfers of Bonds, have been complied with. 4.4 Debenture
Redempt ion Reserve ( DRR ): Regulation 16 of the SEBI Debt Regulations and Secti on 117C of the
Companies Act requires any company that intends to issue debentures to create a DRR to which adequate
amounts shall be credited out of the profits of the Company till the redemption of the debentures. Further,
the Ministry of Company Affairs (MCA) has, through its circular dated April 18, 2002, specified that NBFCs
which are registered with the RBI under Section 45-IA of the RBI Act, 1934 shall create a DRR to the extent
of 50% of the value of the debentures i ssued through public issue. Accordingly, the Company shall create
DRR of 50% of the val ue of Bonds i ssued and all otted in terms of the Tranche Prospectus(es), for the
redemption of the Bonds. The Company shal l credit adequate amounts to the DRR from i ts profits every
year until the Bonds are redeemed. The amounts credited to the DRR shall not be utilized by the Company
for any purpose other than for the redempti on of the Bonds.
5. Application Amount : The Bonds are being issued at par and full amount of face value per Bond is
payable on appl icati on. El igibl e Appl icants can apply for any amount of the Bonds subject to a mini mum
applicati on size of ten Bonds, across any of the series(s) and in multiples of five bonds thereafter. The
Appl icants wil l be al lotted the Bonds in accordance wi th the Basis of Allotment.
6. Deemed Date of Allotment: The Deemed Date of Allotment for the Bonds shall be the date as may be
determi ned by the Board of the Company/ Committee of Directors and notified to the Stock Exchanges.
Al l benefi ts under the Bonds i ncl uding payment of i nterest wi ll accrue to the Bondhol ders from the
Deemed Date of Al l otment. Actual Al l otment may occur on a date other than the Deemed Date of
Al l otment.
7. Subscription: 7.1 Period of Subscription: The Issue shall remain open for the period mentioned below:
ISSUE OPENS ON FRIDAY, JANUARY 27, 2012
ISSUE CLOSES ON FRIDAY, FEBRUARY 10, 2012
The subscripti on li st for the Issue shall remai n open for subscription at the commencement of banki ng
hours and close at the close of banking hours, with an option for early closure (subject to the Issue being
open for a minimum of 3 days) or extensi on by such period, upto a peri od of 30 days from the date of
opening of the Issue, as may be deci ded by the Board of Di rectors/ Committee of the Company, subj ect
to necessary approvals, if any. In the event of such early closure of the subscription list of the Issue, our
Company shall ensure that public notice of such early closure is published on or before such early date of
closure through advertisement/s in a leading national daily newspaper. 7.2 Underwriting: The Issue is not
underwritten. 7.3 Minimum Subscription: In terms of the SEBI Debt Regulations, an issuer undertaking a
publi c issue of debt securities may disclose the minimum amount of subscri ption that it proposes to raise
through the issue in the offer document. The Company has decided not to stipulate minimum subscription
amount for this Issue.
8. Interest: 8.1. Interest: For all the categories the Tranche 1 and Series I Bonds and Tranche 1 and Series
II Bonds shall carry interest at the coupon rate of 8.00% p.a. and 8.10% p.a., respectively, payable annually
from, and incl uding, the Deemed Date of Allotment up to, but excluding their respective Maturity Dates,
payable on the Interest Payment Date (as specified in the Prospectus Tranche 1), to the Bondholders
as of the relevant Record Date. However, an additional interest at the rate of 0.15% p.a. and 0.20% p.a.
shal l be payable to the allottees under Category III for the Tranche 1 and Series I Bonds and Tranche 1
and Series II Bonds respectively. Accordingly, the Tranche 1 and Series I Bonds and Tranche 1 and Series
II Bonds allotted to Category III investors, shall carry an aggregate coupon rate of 8.15% p.a. and 8.30%
p.a., respecti vel y, payabl e annual l y from, and incl udi ng, the Deemed Date of Al lotment up to, but
excl uding thei r respective Maturi ty Dates, payable on the Interest Payment Date (as specified in the
Prospectus Tranche 1), to the Bondholders as of the relevant Record Date. The effective yield to Category
III investors would be 8.15% p.a. and 8.30% p.a. for the Tranche 1 and Series I Bonds and Tranche 1 and
Series II Bonds respectivel y. Please note that the aforesaid additional interest of 0.15% p.a. and 0.20%
p.a., shall onl y be available to the original all ottees and shall not be avail able i n the following i nstances:
1. In case the Bonds are sol d and/or transferred by the original allottee the transferee wil l not be entitled
to receive the interest at the coupon rate of 8.15% p.a. and 8.30% p.a., for the Tranche 1 and Series I Bonds
and Tranche 1 and Series II Bonds respectively and shall onl y be entitled to receive the interest at the
coupon rate of 8.00% p.a. and 8.10% p.a., for the Tranche 1 and Series I Bonds and Tranche 1 and Series
II Bonds respecti vely. However, in case of any transfer by a permanently disabled al lottee to their legal
heir(s), the transferee shall continue to be entitled to receive interest at the coupon rate of 8.15% p.a. and
8.30% p.a., for the Tranche 1 and Series I Bonds and Tranche 1 and Series II Bonds respectively; and 2.
Where the Bonds are held in joint names and subsequently there is a change in the sequence of the names
of the joint holders, the joi nt holders subsequent to such change in sequence of names, will no longer be
entitled to receive the interest at the coupon rate of 8.15% p.a. and 8.30% p.a., for the Tranche 1 and Series
I Bonds and Tranche 1 and Series II Bonds respectively and shall only be entitl ed to receive the interest
at the coupon rate of 8.00% p.a. and 8.10% p.a., for the Tranche 1 and Series I Bonds and Tranche 1 and
Series II Bonds respectively. However, i n case of change in name of any of the joi nt holders, such joint
holders shall continue to be entitled to receive interest at the coupon rate of 8.15% p.a. and 8.30% p.a.,
for the Tranche 1 and Series I Bonds and Tranche 1 and Series II Bonds respectively. However in case of
transmission of the Bond(s) in accordance with the articles of association of the Company, to the nominee
in the event of demise of the Bondholder (single or j oint holders) who was original ly allotted Bonds under
Category III, the new Bondhol der (singl e or joint holders) shall continue to be entitled to receive interest
at the coupon rate of 8.15% p.a. and 8.30% p.a., for the Tranche 1 and Series I Bonds and Tranche 1 and
Seri es II Bonds respectivel y. Pl ease note that for the purpose of cl assi fyi ng the i nvestors into various
categories, the appli cati ons will be consoli dated on the basis of PAN. Consequent to such consoli dati on
of appl icati ons, if an Appl icant falls i n any category other than Category III, such Appl icant wi ll not be
entitled to the additional interest at the rate of 0.15% p.a. and 0.20% p.a. for Tranche 1 Series I Bonds
and Tranche 1 Series II Bonds respectively. 8.2. Day Count Convention: Interest shall be computed on an
actual/actual basis on the principal outstanding on the Bonds. 8.3. Interest on Application Money: 8.3.1
Interest on application monies received which areused towards allotment of Bonds: Weshall payinterest on
the amount for which Bonds are all otted to the Appl icants subject to deduction of income tax under the
provisions of the Income Tax Act, 1961, as amended, from the date of realization of the cheque(s)/demand
draft(s) or 3 (three) days from the date of banking of the application (being the date of submission of each
application as duly acknowledged by the Bankers to the Issue) whichever is later upto one day prior to the
Deemed Date of Allotment, at the rate of 8.00% per annum. We may enter into an arrangement with one
or more banks in one or more cities for direct credit of interest to the account of the applicants. Alternatively,
the interest warrant will be dispatched along with the Letter(s) of Allotment at the sole risk of the Applicant,
to thesole/first Applicant. 8.3.2 Interest on application monies received which are liableto be refunded: We
shall pay interest on application money which is liable to be refunded to the Applicants in accordance with
the provisions of the SEBI Debt Regulations, or other applicabl e statutory and/or regulatory requirements,
subj ect to deducti on of i ncome tax under the provisions of the Income Tax Act, 1961, as amended, as
applicable, from the date of realization of the cheque(s)/demand draft(s) or 3 (three) days from the date
of receipt of the appli cation (being the date of presentation of each appl ication as acknowledged by the
Bankers to the Issue) whichever i s later upto one day prior to the Deemed Date of Allotment, at the rate
of 4% per annum. Such interest shall be paid along with the monies liable to be refunded. Interest warrant
wil l be dispatched/credited (in case of electronic payment) along with the Letter(s) of Refund at the sole
ri sk of the appl i cant, to the sol e/fi rst appl i cant. Provi ded that, notwi thstandi ng anythi ng contai ned
hereinabove, the Company shal l not be liable to pay any interest on monies liable to be refunded i n case
of (a) invalid applications or applications li able to be rejected, and/or (b) appl ications which are withdrawn
by the applicant. See Rejection of Application at page 61 of Prospectus Tranche - 1.
9. Redemption: 9.1 The face value of the Bonds will be redeemed at par, on the respective Maturity Dates
of each of the Bond Series. 9.2 Procedure for Redemption by Bondholders: The procedure for redemption
is set out below: 9.2.1 Bonds held in electronic form: No action is required on the part of Bondholders at
the time of maturity of the Bonds. 9.2.2 Bonds held in physical form: No action will ordinarily be required
on the part of the Bondholder at the time of redempti on, and the Maturi ty Amount will be pai d to those
Bondhol ders whose names appear in the Register of Bondhol ders mai ntai ned by the Company on the
Record Date fixed for the purpose of redemption. However, the Company may require the Consol idated
Bond Certificate(s), duly discharged by the sole holder or all the joint-holders (signed on the reverse of the
Consoli dated Bond Certi fi cate(s)) to be surrendered for redempti on on Maturi ty Date and sent by the
Bondholders by registered post with acknowledgment due or by hand delivery to the Registrar to the Issue
or the Company or to such persons at such addresses as may be notified by the Company from time to time.
Bondholders may be requested to surrender the Consol idated Bond Certi fi cate(s) in the manner stated
above, not more than three months and not less than one month prior to the Maturity Date so as to facilitate
timel y payment.
10. Payments: 10.1 Payment of Interest on Bonds: Payment of interest on the Bonds will be made to those
Bondholders whose name appears first in the Register of Bondholders or the register of benefici al owners
maintained by the Depositories and/or the Company and/or the Registrar to the Issue, as the case may be
as, on the Record Date. 10.2 Record Date: The record date for the payment of interest or the Maturity Amount
shall be 15 days prior to the date on which such amount is due and payable or such other date as may be
notified by the Company (Record Date). In case of redemption of Bonds, the trading i n the Bonds shall
remain suspended between the Record Date and the date of redemption. 10.3 Ef fect of hol idays on
payments: If the date of interest payment or redemption falls on a Saturday, Sunday or a public holiday
i n Delhi or any other payment centre noti fied i n terms of the Negoti abl e Instruments Act, 1881, the
succeeding Working Day will be considered as the effecti ve date. In case the date of payment of interest
or principal or any date specified fal ls on a holiday, the payment will be made on the next Working Day,
wi thout any interest for the period overdue. 10.4.Whi lst the Company wi ll use the electroni c mode for
making payments, where facili ties for el ectronic mode of payments are not avai lable to the Bondholder
or where the information provi ded by the Appli cant is insufficient or incomplete, the Company proposes
to use other modes of payment to make payments to the Bondhol ders, including through the dispatch of
cheques through courier, or registered post to the address provided by the Bondholder and appearing in
the Register of Bondholders or the register of benefi cial owners maintained by the Depositories and/or the
Company and/or the Registrar to the Issue, as the case may be as, on the Record Date. In the case of
payment on maturity being made on surrender of the Consolidated Bond Certifi cate(s), the Company will
make payments or issue payment instructi ons to the Bondholders within 30 days from the date of receipt
of the duly discharged Consolidated Bond Certifi cate(s). The Company shal l pay interest in accordance
with appli cabl e l aws, over and above the coupon rate of the rel evant Bonds, i n the event that such
payments are delayed beyond a peri od of ei ght days after the Company becomes l iable to pay such
amounts. 10.5 The Companys li abili ty to the Bondhol ders including for payment or otherwi se shall stand
extinguished from the Maturity Date or on dispatch of the amounts paid by way of principal and/or interest
to the Bondholders. Further, the Company will not be liabl e to pay any interest, i ncome or compensation
of any ki nd accruing subsequent to the Maturity Date.
11. Manner and Mode of Payment: 11.1 Manner of Payment: All payments to be made by the Company to the
Bondholders shall be made in any of the following manners: 11.1.1 For Bonds applied or held in electronic
form: The bank details will be obtained from the Depositori es for payments. Investors who have appl ied
or who are holding the Bond i n el ectroni c form, are advi sed to immedi ately update their bank account
detail s as appearing on the records of their Depository Participant. Failure to do so could result in delays
in credit of the payments to Investors at their sole ri sk and neither the Lead Managers nor the Company
shall have any responsibility and undertake any liability for such delays on part of the Investors. 11.1.2 For
Bonds held in physical form: The bank details will be obtained from the Registrar to the Issue for effecting
payments. 11.2 Modes of Payment: The mode of interest/refund/redemption payments shall be undertaken
in the following order of preference: 11.2.1 Direct Credit: Applicants having bank accounts with the Refund
Bank, as per the demographi c details received from the Depositories shall be eligible to receive refunds
through direct credi t. Charges, i f any, levi ed by the Refund Bank for the same woul d be borne by the
Company. 11.2.2 NECS: Through NECS for Appl icants havi ng an account at any of the centers notifi ed
by the RBI. This mode of payment will be subject to availability of complete bank account details including
the Magnetic Ink Character Recognition (MICR) code as appearing on a cheque leaf, from the Depositories.
The Company shall not be responsible for any delay to the Bondholder receiving credit of interest or refund
or Maturi ty Amount so long as the Company has initiated the process in time. 11.2.3 Real Time Gross
Settlement ( RTGS ): Applicants having a bank account with a bank branch which is RTGS enabled as per
the information available on the website of RBI and whose payment amount exceeds ` 2.00 lacs shall be
el i gi bl e to recei ve refund through RTGS, provi ded the demographi c detai l s downl oaded fr om the
Depositories contain the nine digit MICR code of the Applicants bank which can be mapped with the RBI
data to obtain the correspondi ng Indian Fi nancial System Code (IFSC). Charges, i f any, levied by the
Refund Bank for the same would be borne by us. Charges, if any, levied by the Applicants bank receiving
the credit would be borne by the Applicant. 11.2.4 National Electronic Fund Transfer ( NEFT ): Payment of
refund shall be undertaken through NEFT wherever the Applicants bank branch is NEFT enabl ed and has
been assigned the IFSC, which can be linked to an MICR code of that particular bank branch. IFSC Code
will be obtained from the website of RBI as on a date prior to the date of payment of refund, duly mapped
with an MICR code. Wherever the Appl icants have registered thei r MICR number and their bank account
number while opening and operating the beneficiary account, the same will be duly mapped with the IFSC
Code of that particular bank branch and the payment will be made to the Applicants through this method.
The process flow in respect of refunds by way of NEFT is at an evolving stage and hence use of NEFT is
subject to operational feasibil ity, cost and process efficiency and the past experience of the Registrar to
the Issue. In the event NEFT is not operationally feasi ble, the payment would be made through any one
of the other modes discussed in this section. 11.2.5 Cheques or Demand drafts: By cheques or demand drafts
made in the name of the Bondholders whose names appear in the Register of Bondholders as maintained
by the Company and/or as provi ded by the Depositories. All Cheques or demand drafts as the case may
be, shall be sent by registered/speed post at the Bondholders sole risk. 11.3 Printing of Bank Particulars:
As a matter of precaution against possible fraudulent encashment of refund orders and i nterest/redemption
warrants due to loss or mispl acement, the parti culars of the Appli cants bank account are mandatori ly
requi red to be provided for pri nti ng on the orders/warrants. Appli cations without these details are l iable
to be rejected. However, i n relati on to Appli cations for demateri al ised Bonds, these particulars wil l be
taken di rectl y from the Deposi tori es. In case of Bonds hel d i n physi cal form ei ther on account of
rematerial isati on or transfer, the Bondholders are advised to submi t their bank account detail s with the
Registrar to the Issue before the Record Date, failing which the amounts will be dispatched to the postal
address of the Bondholders. Bank account particulars will be printed on the orders/warrants which can then
be deposited only i n the account specified.
12. Special Tax Benefit: For the details of tax benefits, see section titled Statement of Tax Benefits on page
25 of Prospectus Tranche - 1.
13. Taxation: The Bonds are tax free in nature and the interest on the Bonds will not form part of the total income.
For further details, see section titled Statement of Tax Benefits on page 25 of Prospectus Tranche - 1.
14. Security: The Bonds issued by the Company will be secured by creating a charge on the movable assets
of the Company comprisi ng of roll ing stock such as wagons, locomoti ves and coaches by a pari passu
charge, present and future, as may be agreed between the Company and the Debenture Trustee, pursuant
to the terms of the Debenture Trust Deed. The Company will create security in favour of Debenture Trustee
pursuant to the terms of Shel f Prospectus/ Tranche Prospectus(es).
15. Events of Default: 15.1 The Debenture Trustee at its discretion may, or if so requested in writing by the
holders of not less than 75% in principal amount of the Bonds then outstanding or if so directed by a special
resolution shall (subject to being indemnifi ed and/or secured by the Bondholders to its satisfaction), give
notice to the Company speci fying that the Bonds and/or any particular series of Bonds, in whole but not
in part are and have become due and repayable at the early redemption amount on such date as may be
specified in such notice inter alia if any of the events listed in 15.2 below occur. 15.2 The complete list of
events of default shall be as specified i n the Debenture Trust Deed. 15.3 The early redempti on amount
payable on the occurrence of an event of default shall be as detailed in the Debenture Trust Deed. 15.4
If an event of default occurs whi ch is conti nui ng, the Debenture Trustee may with the consent of the
Bondholders, obtained i n accordance wi th the provisions of the Debenture Trust Deed, and with a pri or
written notice to the Company, take action in terms of the Debenture Trust Deed. 15.5 In case of default
in the redemption of Bonds, in addition to the payment of interest and all other monies payable hereunder
on the respecti ve due dates, the Company shal l also pay interest on the defaulted amounts.
16. Bondholders Rights, Nomination, etc.: 16.1 Rights of Bondholders: Some of the significant rights
available to the Bondholders are as follows: a) The Bonds shall not, except as provided in the Companies
Act, confer on Bondholders any ri ghts or privi leges available to members of the Company including the
right to receive notices or annual reports of, or to attend and / or vote, at the Companys general meeting(s).
However, if any resolution affecting the rights of the Bondhol ders is to be placed before the shareholders,
such resol uti on wil l first be placed before the concerned registered Bondholders for thei r consideration.
In terms of Section 219(2) of the Companies Act, Bondholders shall be enti tled to a copy of the bal ance
sheet on a specifi c request made to the Company. b) The rights, privileges and conditions attached to the
Bonds may be varied, modified and/or abrogated with the consent in writing of the holders of at least three-
fourths of the outstanding amount of the Bonds or wi th the sanction of a special resolution passed at a
meeti ng of the concerned Bondhol ders, provi ded that nothi ng i n such consent or resol uti on shal l be
operative agai nst the Company, where such consent or resol uti on modi fi es or varies the terms and
condi tions governing the Bonds, if modification, vari ation or abrogation is not acceptable to the Company.
c) The registered Bondholder or in case of joint-holders, the person whose name stands first in the Register
of Bondholders or register of beneficial owners shall be entitled to vote in respect of such Bonds, either
by being present in person or, where proxies are permitted, by proxy, at any meeting of the concerned
Bondholders summoned for such purpose and every such Bondholder shal l be entitled to one vote on a
show of hands and on a poll, his or her voting rights shall be in proportion to the outstanding nominal value
of Bonds held by him or her on every resolution placed before such meeting of the Bondholders. d) Bonds
may be roll ed over with the consent in writing of the holders of at least three-fourths of the outstanding
amount of the Bonds or with the sanction of a special resol uti on passed at a meeti ng of the concerned
Bondholders after providing at least 21 days prior notice for such roll-over and in accordance with the SEBI
Debt Regulati ons. The Company shall redeem the Bonds of all the Bondholders, who have not given their
positi ve consent to the rol l-over. The above rights of Bondhol ders are merel y i ndicati ve. The final rights
of the Bondholders will be as per the terms of the Prospectus Tranche - 1 read with the Shelf Prospectus
and Debenture Trust Deed to be executed by the Company with the Debenture Trustee. Special resolution
for the purpose of this section is a resolution passed at a meeting of Bondholders of at least three-fourths
of the outstanding amount of the Bonds, present and voting. 16.3 Succession: Where Bonds are held in
joi nt names and one of the joint holders di es, the survivor(s) will be recognized as the Bondholder(s) in
accordance with the appli cable laws. It wi ll be suffi ci ent for the Company to del ete the name of the
deceased Bondholder after obtaining satisfactory evi dence of hi s death, provided that a third person may
cal l on the Company to regi ster hi s name as successor of the deceased Bondhol der after obtai ning
evidence such as probate of a will for the purpose of proving his title to the Bonds. In the event of demise
of the sole or first holder of the Bonds, the Company will recognize the executors or administrator of the
deceased Bondholders, or the holder of the succession certificate or other l egal representative as having
title to the Bonds only i f such executor or administrator obtains and produces probate of will or letter of
admini stration or is the holder of the succession certificate or other legal representation, as the case may
be, from an appropriate court in India. The Board of Directors of the Company i n their absolute discretion
may, i n any case, dispense wi th producti on of probate of wi ll or letter of administrati on or successi on
certificate or other legal representation. 16.4 Nomination Facility to Bondholder: 16.4.1 The sole Bondholder
or fi rst Bondholder, along with other joint Bondholders (being individual(s)) may nominate any one person
(being an individual) who, in the event of death of the sole holder or all the joint-holders, as the case may
be, shall become entitled to the Bond. A person, bei ng a nomi nee, becomi ng entitled to the Bond by
reason of the death of the Bondholders, shall be entitl ed to the same rights to whi ch he wi ll be entitl ed
if he were the registered holder of the Bond. Where the nominee is a minor, the Bondholders may make
a nomi nati on to appoi nt any person to become entitled to the Bond(s), in the event of his death, duri ng
the minority. A nomination shall stand rescinded on sale of a Bond by the person nominating. A buyer will
be entitled to make a fresh nomi nation in the manner prescri bed. When the Bond is held by two or more
persons, the nominee shall become entitled to receive the amount only on the demise of all the Bondholders.
Fresh nominations can be made onl y i n the prescribed form avai l abl e on request at the Company s
administrative office or at such other addresses as may be notified by the Company. 16.4.2 The Bondholders
are advised to provide the specimen signature of the nominee to the Company to expedite the transmission
of the Bond(s) to the nominee in the event of demise of the Bondhol ders. The signature can be provided
in the Application Form or subsequently at the time of making fresh nominations. This facility of providing
the speci men signature of the nomi nee i s purel y optional . 16.4.3 Any person who becomes a nominee
under any applicable laws shall on the production of such evidence as may be required by the Companys
Board, as the case may be, elect either: (a) to register himself or herself as the holder of the Bonds; or (b)
to make such transfer of the Bonds, as the deceased holder coul d have made. 16.4.4 Notwithstandi ng
anythi ng stated above, Appl icants who are all otted bonds i n demateri al i zed form need not make a
separate nomination with the Company. Nominations registered with the respective Depository Partici pant
of the Bondholder wil l prevail. If the Bondholders require changing their nomination, they are requested
to inform their respective Depository Participant. For Applicants who opt to hold the Bonds in physical form,
the Appli cants are require to fill in the details for nominees as provi ded i n the Appli cation Form. 16.4.5
Further, the Companys Board or committee of Directors, as the case may be, may at any time give notice
requi ring any nomi nee of the deceased holder to choose either to be regi stered himsel f or herself or to
transfer the Bonds, and if the notice is not complied with, within a period of 90 days, the Companys Board
or committee of Directors, as the case may be, may thereafter wi thhold payment of all interests or other
monies payabl e in respect of the Bonds, until the requirements of the notice have been complied with.
17. Debenture Trustee: 17.1 The Company has appointedIndian Bankto act as the Trustee for the Bondholders.
The Company intends to enter into a Debenture Trust Deed with the Debenture Trustee, the terms of which
wil l govern the appoi ntment and functi oni ng of the Debenture Trustee and shal l speci fy the powers,
authorities and obligations of the Debenture Trustee. Under the terms of the Debenture Trust Deed, the
Company will covenant with the Debenture Trustee that it will pay the Bondholders the principal amount
on the Bonds on the relevant Maturity Date and also that it will pay the interest due on Bonds on the rate
speci fied under the respective Tranche Prospectus(es) under whi ch all otment has been made. 17.2 The
Bondholders shall, without further act or deed, be deemed to have i rrevocably given their consent to the
Debenture Trustee or any of its agents or authorised officials to do all such acts, deeds, matters and things
in respect of or relating to the Bonds as the Trustee may in its absolute discretion deem necessary or require
to be done i n the i nterest of the Bondholders. Any payment made by the Company to the Debenture
Trustee on behalf of the Bondholders shal l discharge the Company pro tanto to the Bondholders. All the
ri ghts and remedies of the Bondhol ders shal l vest in and shall be exercised by the Debenture Trustee
without reference to the Bondholders. No Bondhol der shall be entitled to proceed di rectl y agai nst the
Company unless the Debenture Trustee, havi ng become so bound to proceed, failed to do so. 17.3 The
Debenture Trustee wil l protect the interest of the Bondholders in the event of default by the Company in
regard to timely payment of interest and repayment of principal and they will take necessary action at the
Companys cost. Further, the Debenture Trustee shall ensure that the assets of the Company are sufficient
to di scharge the pri nci pal amount at all ti me under thi s Issue.
18. Miscellaneous: 18.1 Loan against Bond: The Bonds can be pledged or hypothecated for obtaining loans.
18.2 Lien: The Company shall have the right of set-off and lien, present as well as future on the moneys
due and payable to the Bondholder or deposits held in the account of the Bondholder, whether in single
name or joint name, to the extent of all outstanding dues by the Bondholders to the Company. 18.3 Li en
on Pledge of Bonds: Subject to applicable laws, the Company, at its discretion, may note a lien on pledge
of Bonds if such pledge of Bond is accepted by any Bank, institution or others for any loan provided to the
Bondholder against pledge of such Bonds as part of the funding. 18.4 Joint-holders: Where two or more
persons are holders of any Bond(s), they shall be deemed to hold the same as joint holders with benefits
of survivorship subject to applicable laws. 18.5 Sharing of Information: The Company may, at its option,
use its own, as well as exchange, share or part with any financial or other information about the Bondholders
available with the Company, its SPVs and affi liates and other banks, financial institutions, credit bureaus,
agencies, statutory bodies, as may be required and neither the Company nor its SPVs and affiliates nor
Applicantsare advised toreadthe ShelfProspectus andProspectus Tranche - 1dated January 19, 2012
(Prospectus) filed with Registrar of Companies, National Capital Territory of Delhi and Haryana and
the General Instructions contained in this application form carefully and to satisfy themselves of the
disclosures before making an application for subscription. Unless otherwise specified, all the terms
used in this form have the same meaning as in the Prospectus. For a copy of the Prospectus the
applicant mayrequest us and/or the Lead Managers. Further, investorsare advised to retainthe copy
of the Prospectus/Abridged Prospectus for their future reference. Please fill in the Form in English
using BLOCK letters. Investors should carefully choose the Series of Bonds they wish to apply for.
Please refer to Terms of the Issue in the Prospectus for details.
IN THE NATURE OF FORM 2A - MEMORANDUM CONTAINING SALIENT FEATURES OF THE PROSPECTUS
5 INDIAN RAILWAY FINANCE CORPORATION LIMITED
their agents shall be liable for use of the aforesaid information. 18.6 Notices: All notices to the Bondholders
required to be gi ven by the Company or the Trustee shall be publi shed in one national daily newspaper
having wide circulation and/or, will be sent by post/courier to the registered Bondholders from time to time.
18.7 Issue of Duplicate Consolidated Bond Certificate(s): If any Consolidated Bond Certificate is mutilated
or defaced, it may be replaced by the Company against the surrender of such Consolidated Bond Certificates,
provided that where the Consoli dated Bond Certi ficates are muti lated or defaced, they will be repl aced
only if the certificate numbers and the distinctive numbers are legible. If any Consolidated Bond Certificate
is destroyed, stolen or lost then on production of proof thereof to the Issuers satisfaction and on furnishing
such i ndemni ty/securi ty and/or documents as we may deem adequate, dupl i cate Consoli dated Bond
Certificate(s) shall be issued. Theabove requirement may be modified from time to time as per applicablelaw
and practice. 18.8 Future Borrowings: The Company shall be entitled at any time in the future during the
term of the Bonds or thereafter to borrow or raise l oans or create encumbrances or avail of fi nancial
assi stance in any form, and also to issue promissory notes or bonds or any other securities in any form,
manner, ranking and denomination whatsoever and to any eligible persons whatsoever, subject to applicable
consent, approvals or permission that may be required under any statutory/regulatory/contractual requirement
and to change its capital structure including through the i ssue of shares of any class, on such terms and
condi tions as the Company may deem appropri ate, without requiring the consent of, or imitation to, the
Bondholders or the Debenture Trustee in this connection. 18.9 Jurisdiction: The Bonds, the Trust Deed and
other relevant documents shall be governed by and construed in accordance with the laws of India. For the
purpose of this Issue and any matter related to or ancillary to the Issue, the Courts of New Delhi, India shall
have exclusive jurisdi ction.
ISSUEPROCEDURE:
IRFC and the Lead Managers would not be liable for any amendment, modification or change in applicable
law, which may occur after the date of the Prospectus Tranche - 1. Investors are advised to make their
i ndependent investigati ons and ensure that thei r Appli cati on does not exceed the investment li mi ts or
maximum number of Bonds that can be held by them under applicable law or as specified in the Prospectus
Tranche - 1.
19. Availability of Prospectus and Application Forms: Theabridged prospectuscontaining the salient features
of the Prospectus together with Application Forms and copies of the Prospectus may be obtained from our
Registered Offi ce, Lead Managers to the Issue and the Consortium Members for the Issue as mentioned
on the Application Form. In addition, Application Forms would also be made available to all the recognized
stock exchanges. We may provide Application Forms for being downloaded and filled at such websi tes as
we may deem fi t. In addition, Brokers having online demat account portals may also provide a facility of
submitti ng the appli cati on forms vi rtual ly onl ine to their account holders.
20. Who can apply: The following categories of persons are eligible to apply in the Issue: Category I: Public
Financial Instituti ons as defined in section 4A of the Companies Act, Statutory Corporati ons, Commercial
Banks, Co-operative Banks and Regi onal Rural Banks, which are authorised to invest i n the Bonds;
Provident Funds, Pension Funds, Superannuation Funds and Gratuity Fund, which are authori sed to invest
in the Bonds; Insurance companies registered with the IRDA; National Investment Fund; Mutual Funds;
Foreign Institutional Investors (incl uding sub-accounts); Insurance funds set up and managed by army,
navy or air force of the Union of India; Multilateral and bilateral development financial institutions; State
i ndustrial development corporati ons Compani es, bodies corporate and soci eties regi stered under the
applicabl e laws in Indi a and authorised to invest in the Bonds; Registered trusts which are authorised
to invest in the Bonds; Scientific and/or industrial research organisations, whi ch are authorised to invest
in the Bonds; Partnership firms in the name of the partners; Limited l iabil ity partnerships formed and
registered under the provisions of the Limited Liability Partnership Act, 2008 (No. 6 of 2009). Category II:
The following i nvestors applying for an amount aggregating to above ` 5 lakhs across all Series in each
tranche Resident Indian i ndivi duals; Hindu Undivided Fami lies through the Karta; and Non Resident
Indians on repatriation as well as non-repatriation basis. Category III: The following investors applying for
an amount aggregating to upto and including ` 5 lakhs across all Series in each tranche: Resident Indian
indi viduals; Hi ndu Undivided Famil ies through the Karta; and Non Resident Indi ans on repatriati on
as well as non-repatriation basis. Note: Partici pation of any of the aforementioned persons or enti ties is
subject to the appl icabl e statutory and/or regulatory requirements in connecti on wi th the subscri pti on to
Indian securities by such categories of persons or entiti es.
Applicantsareadvised toensurethat applications madeby themdonot exceed theinvestment limits or maximum
number of Bonds that can beheld by them under applicablestatutory and or regulatory provisions. Applicants
areadvised to ensurethat they haveobtained thenecessary statutory and/or regulatory permissions/consents/
approvals in connection with applying for, subscribing to, or seeking allotment of Bonds pursuant totheIssue.
The Lead Managers and their respective associates and affiliates are permitted to subscribe i n the Issue.
In pursuanceof circular no. CIR/IMD/DF/22/2011datedDecember 26, 2011by theSecuritiesand ExchangeBoard
of India,it is strictly advised that theLead Managers,their broking affiliates, consortium members, sub-consortium
members orany other person connected with distribution of theIssueshall not offer any incentive,whether direct
or indirect, inanymanner,whether in cash or kind or services or otherwiseto any person for makingan application
for allotment of Bonds offered in terms of theProspectus and TrancheProspectus(es). However, they may pay
fees or commission for services rendered in relation to theIssue. Theinformation below is givenfor thebenefit
of the investors. IRFC, the Lead Managers are not liable for any amendment or modification or changes
in appli cabl e laws or regul ations, which may occur after the date of the Prospectus Tranche - 1.
21. Applications cannot be made by: a) Minors without a guardian name; b) Foreign nationals; c) Persons
resident outside India other than NRIs; d) Overseas Corporate Bodi es
22. Applications by Public Financial Institutions, Statutory Corporations, which are authorized to invest in the
Bonds The application must be accompanied by certified true copies of: (i) Any Act/Rules under which they
are i ncorporated; (ii) Board Resolution authorisi ng investments; and (iii) Specimen signature of authorized
person
23. Application by Commercial Banks, Co-operative Banks and Regional Rural Banks Commercial Banks, Co-
operative banks and Regional Rural Banks can apply i n this public issue based upon their own investment
li mits and approval s. The application must be accompanied by certified true copi es of (i) Any Act/Rul es
under which they are incorporated (ii) Board Resolution authorising investments; (iii) Letter of Authorisation.
Failing this, IRFC reserves the right to accept or reject any Application in whole or in part, in either case,
wi thout assi gning any reason thereof.
24. Applications by Provident Funds, Pension Funds, Superannuation Funds and Gratuity Fund, which are
authorized to invest in the Bonds and National Investment Fund: The application must be accompanied by
certified true copies of: (i) Any Act/Rules under which they are incorporated; (ii) Board Resolution authorising
investments; and (ii i) Specimen signature of authori zed person
25. Application by Insurance Companies: In case of Applications made by insurance companies registered
wi th the Insurance Regulatory and Development Authority, a certifi ed copy of certi fi cate of registrati on
issued by Insurance Regulatory and Development Authority must be lodged along with Appl icati on Form.
The appl icati ons must be accompani ed by certifi ed copi es of (i ) Any Act/Rul es under whi ch they are
incorporated; (ii) certificate of registration issued by the Insurance Regul atory and Development Authority;
(iii) Memorandum and Articles of Association (iv) Power of Attorney (v) Resolution authori sing investment
and containi ng operati ng instructions (vi ) Speci men si gnatures of authori sed si gnatori es. Fail i ng this,
IRFC reserves the ri ght to accept or reject any Appl icati on i n whole or i n part, i n ei ther case, without
assi gning any reason thereof.
26. Applications by Mutual Funds : In terms of SEBI (Mutual Fund) Regulation, 1996, as amended, no
mutual fund scheme shall invest more than 15% of its NAV in debt instruments issued by a single company
which are rated not below investment grade by a credit rating agency authorised to carry out such activity.
Such investment limit may be extended to 20% of the NAV of the scheme with the prior approval of the
Board of Trustees and the Board of Asset Management Company. A separate applicati on can be made
in respect of each scheme of an Indian mutual fund regi stered with SEBI and such applications shall not
be treated as multiple applications. Appli cations made by the AMCs or custodians of a Mutual Fund shall
clearly i ndi cate the name of the concerned scheme for whi ch appl i cati on i s being made. In case of
Appl i cati ons made by Mutual Fund regi stered wi th SEBI, a certi fied copy of thei r SEBI regi strati on
certificate must be submitted wi th the Application Form. The appli cations must be also accompani ed by
certified true copies of (i) SEBI Registration Certificate and trust deed (ii) resolution authorising investment
and containing operating instructions and (i ii) specimen signatures of authorised signatories. Failing this,
IRFC reserves the ri ght to accept or reject any Appl icati on i n whole or i n part, i n ei ther case, without
assi gning any reason thereof.
27. Applications by FII : A registered Foreign Institutional Investor who purchases the Bonds under this Issue
shall make the payment for purchase of such securities either by inward remittance through normal banking
channels or out of funds held in Foreign Currency Account or Non-resident Rupee Account maintained by
the Foreign Institutional Investor with a designated branch of an authorised dealer in terms of the applicable
regulations governing the same. The application must be accompanied by certified true copies of: (i) SEBI
registration certi fi cate; (ii ) Inward remi ttance certifi cate (ii i ) Resoluti on authorizi ng the i nvest ment (iv)
Speci men signatures of authori zed si gnatori es.
TheIssuer does not makeany representations and does not guaranteeeligibility of any foreign investor, including
inter-aliaNRIs and FIIs for investment into theIssueeither on arepatriation basis or on anon-repatriation basis.
All foreign Investors have to verify their eligibility and ensurecompliancewith all relevant and applicableRBI
- FEMA notifications and guidelines as well as all relevant and applicableSEBI guidelines notifications and
circulars pertaining to their eligibility to invest in theIssueat thestageof investment in everytranche, at thetime
of remittance of their investment proceeds as well as at the time of disposal of the Bonds. TheIssuer will not
check or confirm eligibity of such investments into the Issue.
28. Investments by FIIs : As per the current regulations, the following restrictions are applicable for investments
by FIIs: The present limi t for investment in corporate debt Instruments like non-convertible debentures/
bonds by FIIs is USD 25 bi llion. Followi ng the announcement by the Union Finance Mi nister Shri Pranab
Mukherjee in his budget 2011-12, the Government in consultation with the regulators had raised the limit
for FII investment in long-term corporate bonds issued by companies in the infrastructure sector from USD
5 bil li on to USD 25 bi ll i on. This scheme was operationali sed vide SEBI circul ar CIR/IMD/FIIC/5/2011
dated March 31, 2011. The present limit for investment i n corporate debt Instruments l ike non-convertible
debentures / bonds by FIIs is USD 25 billion as per SEBI circular CIR/IMD/FIIC/18 /2011, dated September
30, 2011, which is split as follows : i. 3 bil lion is separate for Qualified Foreign Investor (QFI) investing
through the mutual fund route. With regard to the carve out investment limi ts of USD 5 billion out of the
remaining USD 22 billi on for FII i nvestments i n Long-term infrastructure bonds the investment limi ts are
provided in the subsequent paragraphs(ii and iii); ii. FIIs can invest in long-term infra bonds, subject to the
USD 5 billion limit, in bonds which have an ini tial maturity of five years or more at the time of issue and
residual maturity of one year at the time of first purchase by FIIs. These investments are subject to a lock-
in period of one year. FIIs can, however, trade amongst themselves but cannot sell to domestic investors
during the lock-in period of one year. iii. Further, FIIs can invest in Long-term infrastructure bonds upto the
balance USD 17 billion which have an initial maturity of five years or more at the time of issue and residual
maturity of three years at the time of first purchase by FIIs. These investments are also subject to a lock-
in period of three year. FIIs can, however, trade amongst themselves but cannot sell to domestic investors
during the lock-in period of three years. The Reserve Bank of India (RBI) vide its notification number RBI/
2011-12/244 A.P. (DIR Series) Circular No. 42 dated November 03, 2011 has revised the terms of investment
by Foreign Institutional Investors (FIIs) and the subjecti ve condi tions. The modificati ons stipulated in the
aforesai d notification are as foll ows: 1. FII s can now invest in non-converti ble debentures/bonds i ssued
by with Infrastructure Finance Companies who are Non-Banking Financial Companies (NBFCs) up to a
limit of USD 5 Bil lion withi n the overall USD 25 Billi on li mit. 2. The three year lock in peri od in respect
of i nvestments by FIIs up to USD five billion within the overall li mit of USD 25 Billion stands reduced to
one year. 3. The five year residual maturity on an instrument purchased by an FII now refers to the original
maturity date of the instrument. The lock in period will be computed from the original maturity date of the
investment. 4. These changes would also apply for Qualified Foreign Investors (QFI) investment i n units
of mutual fund debt schemes withi n the l imi t of USD 3 bil lion. Addi tionall y, there has been an increase
in the FII investment limit in corporate bonds by US$ 5 billion, raising the overall cap to US $ 20 Bi llion.
This incremental limit can be invested in listed corporate bonds vide SEBI Circular CIR/IMD/FIIC/20/2011,
dated November 18, 2011. Subject to compl iance wi th al l appli cabl e Indi an l aws, rul es, regul ations
guideli nes and approvals i n terms of Regulation 15A(1) of the Securities and Exchange Board of India
(Foreign Institutional Investors) Regulati ons, 1995, as amended (the SEBI FII Regulati ons), an FII, as
defined in the SEBI FII Regulations, may i ssue or otherwise deal in offshore derivative i nstruments (as
defined under the SEBI FII Regulations as any instrument, by whatever name call ed, which is i ssued
overseas by a FII against securities held by it that are listed or proposed to be listed on any recognized stock
exchange i n India, as i ts underlying) directly or i ndi rectl y, only in the event (i) such offshore derivati ve
instruments are i ssued only to persons who are regulated by an appropriate regulatory authori ty; and (ii)
such offshore deri vative instruments are issued after compliance wi th know your client norms. An FII is
also required to ensure that no further issue or transfer of any offshore derivative instrument is made by or
on behal f of i t to any persons that are not regulated by an appropri ate foreign regulatory authori ty as
defined under the SEBI FII Regulations. Further, as per FEMA, a FII may purchase, on repatriation basis,
these Bonds, either di rectly from the issuer of such securities or through a registered stock broker on a
recognised stock exchange in India; Provided that i) the FII shall restrict allocation of its total investment
between equity and debt i nstruments (i ncl uding dated Government Securities and Treasury Bil ls in the
Indian capital market) in the ratio of 70:30, and ii) if the FII desires to invest upto 100 per cent i n dated
Government Securi ti es i ncludi ng Treasury Bil ls, non-converti bl e debentures/bonds issued by an Indian
company, it shall form a 100% debt fund and get such fund registered with SEBI.
29. Companies, bodies corporate and societies registered under theapplicablelaws in India: Theapplication
must be accompanied by certified true copies of: (i) Any Act/Rules under which they are incorporated; (ii)
Board Resol ution authorising investments; and (i ii ) Specimen si gnature of authori zed person.
30. Applications by Trusts: In case of Applications made by trusts, settled under the Indian Trusts Act, 1882,
as amended, or any other statutory and/or regulatory provision governing the settlement of trusts in India,
must submit a (i) certified copy of the registered instrument for creation of such trust, (ii) Power of Attorney,
if any, in favour of one or more trustees thereof, (iii ) such other documents evidencing registration thereof
under appli cabl e statutory/regulatory requirements and (iv) Specimen signature of authori zed person.
Failing this, IRFC reserves the right to accept or reject any Applications in whole or in part, in either case,
without assi gning any reason therefor. Further, any trusts applying for Bonds pursuant to the Issue must
ensure that (a) they are authorised under applicable statutory/regulatory requirements and their constitution
instrument to hold and invest i n bonds, (b) they have obtained all necessary approvals, consents or other
authorisations, which may be required under applicabl e statutory and/or regulatory requirements to invest
in bonds, and (c) applications made by them do not exceed the investment limits or maxi mum number of
Bonds that can be held by them under appl icabl e statutory and or regul atory provisions.
31. Scientific and/or industrial research organizations, which areauthorizedto invest in theBonds: Theapplication
must be accompanied by certified true copies of: (i) Any Act/Rules under which they are incorporated; (ii)
Board Resol ution authorising investments; and (i ii ) Specimen si gnature of authori zed person.
32. Partnership firms in the nameof thepartners and Limited liability partnerships formed and registered under
theprovisions of the Limited Liability Partnership Act, 2008(No. 6of 2009): Theapplicationmust beaccompanied
by certified true copies of: (i) Partnership Deed; (i i) Any documents evi denci ng registration thereof under
applicable statutory/regulatory requirements; (iii) Resolution authorising investment and containing operating
instructi ons (Resol ution); (i v) Specimen si gnature of authorized person.
33. Applications under Power of Attorney : In case of Investments made pursuant to a power of attorney by
Category I investors, a certified copy of the power of attorney or the relevant resolution or authority, as the case
may be, along with a certified copy of the memorandum of association and articles of association and/or bye
laws and/or charter documents, as applicable, must be lodged along with the Application Form. In case of
Investments made pursuant to a power of attorney by Category II and Category III investors, a certified copy
of the power of attorney must be lodged along with the Application Form. Brokers having online demat account
portals may also provide a facility of submitting the application forms virtually online to their account holders.
Under this facility, a broker receives an online instruction through its portal from the applicant for making an
application on his/her behalf. Based on such instruction, and a Power of Attorney granted by the applicant to
authorize the Broker, the Broker submits an application form to the Bankers to the Issue.
34. Applications by NRIs on repatriation as well as non-repatriation basis: Theapplication must beaccompanied
by certified true copies of: (i) When payment is through demand draft then the certificate from the bank that
the draft has been made by debiting the NRE account; (ii) PIO Card (if application by PIO). We propose to issue
Bonds to NRIs on a repatriable as well as non-repatriable basis. NRI applicants should note that only such
applications as are accompanied by payment in Indian Rupees only shall be considered for Allotment. An NRI
can apply for Bonds offered in the Issue subject to the conditions and restrictions contai ned in the FEMA
(Borrowing or Lending i n Rupees) Regul ations, 2000, and other appl i cabl e statutory and/or regul atory
requirements including the interest rate requirement as provided in the CBDT Notification. Allotment of Bonds
to NRIs shall be subject to the application monies paid by the NRI as described below: 1. In case of NRIs
appl ying under repatriation basis: If it is received either by inward remittance of freely converti ble foreign
exchange through normal banking channels i.e. through rupee denomi nated demand drafts/cheque drawn
on a bank in India or by transfer of funds held in the investors rupee denominated accounts i.e. Non Resident
External (NRE) account maintained with an RBI authorised dealer or a RBI authorised bank in India. Payment
will not be accepted out of Non- Resident Ordinary (NRO) Account of the Non-Resident Indians applying on
a repatriation basis. Payment by demand draft by a Non-Resident on repatriable basis should be accompanied
by a bank certificate confirming that the draft has been issued by debiting a NRE Account. PIO Card would
require to be furnished if the application is made by the PIO. 2. In case of NRIs applying under non-repatriation
basis- If it is received either by inward remittance of freely convertible foreign exchange through normal banking
channels i.e. through rupee denominated demand drafts/cheque drawn on a bank in India or by transfer of
funds held in the investors rupee denominated accounts i.e. Non-resident Ordinary (NRO) account and Non
Resident External (NRE) maintained with an RBI authorised dealer or a RBI authorised bank in India. In the
case of Bids by NRIs applying on a non-repatriation basis, payment by demand drafts should be accompanied
by a bank certificate confirming that the draft has been issued by debiting an NRE or a NRO Account. PIO Card
would require to be furnished if the application is made by the PIO.
Applications by NRI in physical form shall besubmitted only at theCollection Centres located at Mumbai, Delhi,
Ahemdabad, Hyderabad, Chennai, Bangalore, Chandigarh and Kochi.
TheIssuer does not makeany representations and does not guaranteeeligibility of any foreign investor, including
inter-aliaNRIs and FIIs for investment into theIssueeither on arepatriation basis or on anon-repatriation basis.
All foreign Investors have to verify their eligibility and ensurecompliancewith all relevant and applicableRBI
- FEMA notifications and guidelines as well as all relevant and applicableSEBI guidelines notifications and
circulars pertaining to their eligibility to invest in theIssueat thestageof investment in everytranche, at thetime
of remittance of their investment proceeds as well as at the time of disposal of the Bonds. TheIssuer will not
check or confirm eligibity of such investments into the Issue.
35. Issue and Allotment of Bonds to NRI applicants: We confirm that: i. the rate of interest on each series
of Bonds does not exceed the prime lending rate of the State Bank of India as on the date on which the
resolution approving the Issue was passed by our Board, plus 300 basis points; ii. the period for redemption
of each seri es of Bonds is not less than 3 years; iii . IRFC does not and shall not carry on agricul tural /
pl antati on /real estate business/Trading in Transferable Devel opment Rights (TDRs) and does not and
shall not act as Ni dhi or Chit Fund company; iv. We wil l fi le the following with the nearest office of the
Reserve Bank, not later than 30 days from the date - A. of receipt of remittance of consideration received
from NRIs in connection with the Issue, full details of the remittances received, namely; (a) a list containing
names and addresses of each NRI applicant who have remitted funds for investment in the Bonds on non-
repatri ati on basi s and repatri ati on basi s, (b) amount and date of recei pt of remi ttance and i ts rupee
equival ent; and (c) names and addresses of authori sed deal ers through whom the remi ttance has been
received; The application money for the Bonds has to be paid in cheque or demand drafts onl y, in rupee
denomi nated currency onl y; and B. of cl osure of the Issue, full details of the monies received from NRI
appli cants, namely; (a) a list containing names and addresses of each NRI allottee and number of Bonds
issued to each of them on non-repatriati on basis and repatriati on basis, and (b) a certificate from our
compl iance offi cer that all provi sions of the FEMA Act, and rules and regul ations made thereunder i n
connection with the issue of nonconvertible debentures have been duly compl ied with. We further confirm
that the monies received from NRIs who are allotted Bonds pursuant to the Issue, will not be utilised for
any investment, whether by way of capital or otherwise, in any company or partnership firm or proprietorship
concern or any entity, whether incorporated or not, or for the purpose of re-l endi ng.
TDSdeduction on interest on Application Money/refund: Applicants exempt from TDSdeduction on interest
on Application money/refund, etc, are required to submit therequisitedocuments:
36. Application Size: Applications are required to be for a minimumof ten Bonds and multiples of five Bonds thereafter.
37. Application Form : The prescribed colour of the Application Form for the various categories is as follows:
CATEGORY COLOUROF
APPLICATIONFORM:
Following investors under Category I: Public Financial Institutions, Statutory Pi nk
Corporations, Commercial Banks, Co-operative Banks and Regional Rural
Banks, Provident Funds, Pension Funds, Superannuation Funds and Gratuity
Fund, which are authorised to invest in the Bonds, insurance companies
registered wi th the IRDA, National Investment Fund, Mutual Funds,
Foreign Institutional Investors, insurance funds setup and managed by the
army, navy or ai r force of the Union of India, mul tilateral and bil ateral
development financi al insti tuti ons and state i ndustrial devel opment
corporati ons which are eligible to invest in the Bonds.
Category I (excluding the abovementioned Category I i nvestors), Whi te
Category II and Category III.
38. Instructions for Completing the Application Form: Applications to be made in prescribed form only The
forms to be completed in block letters in English as per the instructions contained herein and in the Application
Form, and are liable to be rejected if not so completed. Applicants should note that the Bankers to the Issue
will not be liable for errors in data entry due to incomplete or illegible Application Forms Applications are
required to be for a minimum of ten Bond and in multiples of five Bond thereafter. Applications should be
in single or joint names not more than three, and in the same order as their Depository Participant details (in
case of applicants opting for allotment in dematerialized form) and should be applied by Karta in case of HUF
Thumb impressions and si gnatures other than in Engl ish/Hindi/Gujarati/Marathi or any other languages
specified in the 8th Schedule of the Constitution needs to be attested by a Magistrate or Notary Public or a
Special Executive Magistrate under his/her seal. All Application Forms duly completed together with cheque/
bank draft for the amount payable on application must be delivered before the closing of the subscription list
to any of the Bankers to the Public Issue or collection centre(s) as may be specified before the closure of the
Issue. No receipt will be issued for the application money. However, Bankers to the Issue and/or their branches
receiving the applications will acknowledge the same by stamping (mandatorily havi ng a date stamp) and
returning the acknowledgement slip to the applicant. Every applicant should hold valid Permanent Account
Number (PAN) and mention the same in the Application Form. All applicants are required to tick the relevant
column of Category of Investor in the Application Form.
All Applicationsby Public Financial Institutions, Statutory Corporations, Commercial Banks, Co-operativeBanks
and Regional Rural Banks,Provident Funds,Pension Funds,SuperannuationFundsandGratuity Fund, insurance
companies registered with theIRDA, National Investment Fund, Mutual Funds, Foreign Institutional Investors,
insurancefunds setup and managed by thearmy, navy or air forceof theUnionof India, multilateral and bilateral
development financial institutionsand stateindustrial development corporations applicants shall bereceivedonly
by theLead Managers and their respective affiliates. APPLICANTSMAYNOTETHATTHEALLOTMENTSHALL
BE ON THE BASIS AS DESCRIBED UNDER THE HEADING-BASIS OF ALLOTMENT. Applications for
all theSeries of Bonds may bemade in asingleApplication Form only.
IRFCwould allot Tranche1Series II Bonds toall valid applications, whereintheapplicants havenot indicated their
choiceof therelevant series of Bonds in their Application Form.
General Instructions:
39. Dos: Check if you are eligible to apply; Read all the instructions carefully and complete the Application Form;
If the allotment is sought in dematerialized form, ensure that the details about Depository Participant and
Beneficiary Account are correct and the beneficiary account is active; Applications are required to be in single
or joint names (not more than three) In case of an HUF applying through its Karta, the Applicant is required to
specify the name of an Applicant in the Application Form as XYZ Hindu Undivided Family applying through PQR,
where PQR is the name of the Karta; Ensure that the Applications are submitted to the Bankers to the Issue before
the closure of banking hours on the Issue Closing Date; Ensure that the Applicants name(s) given in the
Application Form is exactly the same as the name(s) in which the beneficiary account is held with the Depository
Participant. In case the Application Form is submitted in joint names, ensure that the beneficiary account is also
held in same joint names and such names are in the same sequence in which they appear in the Application Form
Ensure that you mention your PAN allotted under the IT Act, Please note that it is mandatory for all applicants
to furnish their PAN number as per CBDT circular. Ensure that the Demographic Details as provided in the
Application Form are updated, true and correct in all respects. Ensure that you have obtained all necessary
approvals from the relevant statutory and/or regulatory authorities to apply for, subscribe to and/or seek allotment
of Bonds pursuant to the Issue. Applicants Bank Account Details: The Bonds shall be allotted in dematerialised
and physical form. For instructions on how to apply for Allotment in the physical form, please refer Applications
for Allotment of Bonds in the physical form on page 55 of Prospectus Tranche - 1. The Applicant should note that
on the basis of the name of the Applicant, Depository Participants name, Depository Participants identification
number and beneficiary account number provided by them in the Application Form, the Registrar to the Issue will
obtain from the Applicants beneficiary account, the Applicants bank account details. The Applicants are advised
to ensure that bank account details are updated in their respective beneficiary accounts as these bank account
details would be printed on the refund order(s), if any. Failure to do so could result in delays in credit of refunds
to Applicants at the Applicants sole risk and neither the Lead Managers nor IRFC nor the Refund Bank nor the
Registrar to the Issue shall have any responsibility and undertake any liability for such delay. Applications under
Power of Attorney: Unless IRFC specifically agree in writing, and subject to such terms and conditions as IRFC may
deem fit, in the case of Applications made under power of attorney, a certified copy of the power of attorney is
required to be lodged separately and relevant documents as specified on page 51 of the Prospectus Tranche -
1, along with the submission of the Application Form, indicating the name of the Applicant along with the address,
Application number, date of submission of the Application Form, name of the bank and branch where it was
deposited, cheque/demand draft number and the bank and branch on which the cheque/demand draft was drawn.
Permanent Account Number: All Applicants should mention their PAN allotted under the Income Tax Act in the
Application Form. In case of joint applicants, the PAN of all the Applicants should be provided and for HUFs, PAN
of the HUF should be provided. The PAN would be the sole identification number for participants transacting in
the securities markets, irrespective of the amount of the transaction. Any Application Form without the PAN is liable
to be rejected. Further as per CBDT notification it is mandatory for all subscribers to provide their PAN numbers
to IRFC. Applicants should not submit the GIR Number instead of the PAN as the Application is liable to be
rejected on this ground. Joint Applications: Applications may be made in single or joint names (not exceeding
three). In the case of joint Applications, all refunds/interests/redemption amounts will be made out in favour of
the first Applicant. All communications will be addressed to the first named Applicant whose name appears in
the Application Form at the address mentioned therein. Multiple Applications: An Applicant may make multiple
applications for the total number of Bonds required and the same shall be considered valid. For the purposes of
allotment of Bonds under the Issue, applications shall be grouped based on the PAN, i.e. applications under the
same PAN shall be grouped together. Two or more applications will be deemed to be multiple applications if
the sole or first applicant is one and the same. For the sake of clarity, two or more applications shall be deemed
to be a multiple application for the aforesaid purpose if the PAN number of the sole or the first applicant is one
andthesame. Applicants arerequested to writetheir names and Application serial number on thereverseof the
instruments by which thepayments are made. All Applicants are requestedto tick the relevant column Category
of Investor in the Application Form. Tick the Series of Bonds in the Application Form that you wish to apply for.
40. Donts: Do not apply for lower than the minimum application size; Do not pay the application amount
in cash, by money order, postal order, stock invest; Do not fill up the Application Form such that the Bonds
applied for exceeds the issue size and/or investment limit or maximum number of Bonds that can be held under
the applicable laws or regulations or maximum amount permissible under the applicable regulations; Do
not submit the GIR number instead of the PAN, as the Application Form is liable to be rejected on this ground;
Do not submit the Application Forms without the full Application Amount; and Do not fill up the Application
Form such that the Bonds applied for exceeds the issue size and/or investment limit or maximum number of
Bonds that can be held under the applicable laws or regulations or maximum amount permissible under the
applicable regulations. For further instructions, investors are advised to read the Prospectus Tranche - 1 and
Application Form careful ly.
41. Applications for Allotment of Bonds in the physical form: Applicant(s) who wishto subscribeto, or hold, the
Bonds in physical form can do so in terms of Section 8(1) of the Depositories Act and IRFC is obligated to fulfill
such request of the Applicant(s). Accordingly, any Applicant who wishes to subscribe to the Bonds in physical
formshall undertakethe followingsteps: (i) Please completethe Application Form in all respects, by providing
all theinformation including PANand demographic details. However, do not provide theDepository Participant
details in the Application Form. The requirement for providing Depository Participant details shall be mandatory
only for the Applicants who wish to subscribe to the Bonds in dematerialised form. (ii) Please provide the
following documents along with the Application Form: (a) Self-attested copy of the PAN card; (b) Self-attested
copy of the proof of residence. Any of the following documents shall be considered as a verifiable proof of
residence: ration card issued by the GoI; or valid driving license issued by any transport authority of the
Republic of India; or electricity bill (not older than three months); or landline telephone bill (not older than
three months); or valid passport issued by the GoI; or Voters Identity Card issued by the GoI; or passbook
or latest bank statement issued by a bank operating in India; leave and license agreement or agreement for
sale or rent agreement or flat maintenance bill; Self-attested copy of Registered Office address in case of
applicants under Category I; or Life Insurance Policy. (c) Self-attested copy of a cancelled cheque of the bank
account to which the amounts pertaining to payment of refunds, interest and redemption, as appli cabl e,
should be credited. The Applicant shall be responsible for providing the above information accurately. Delays
or failure in credit of the payments due to inaccurate details shall be at the sole risk of the Applicants and neither
the Lead Managers nor IRFC shall have any responsibility and undertake any liability for the same. Applications
for Allotment of the Bonds in physical form, which are not accompanied with the aforestated documents, may
be rejected at the sole discretion of IRFC. In relation to the issuance of the Bonds in physical form, note the
following: (i) An Applicant has the option to seek Allotment of Bonds in either electronic or physical mode.
No partial Application for the Bonds shall be permitted and is liable to be rejected. (ii) In case of Bonds that
are being issued in physical form, IRFC will issue one certificate to the Bondholder for the aggregate amount
of the Bonds for each Series that are applied for (each such certificate a Consolidated Bond Certificate). (iii)
AnyApplicant who provides theDepository Participant details intheApplication Form shall beAllotted theBonds
in dematerialised form only. Such Applicant shall not be Allotted the Bonds in physical form. (iv) No separate
Applications for issuance of the Bonds in physical and electronic form should be made. If such Applications
are made, the Application for the Bonds in physical mode shall be rejected. This shall be considered as a
ground for technical rejection. (v) IRFC shall dispatch the Consolidated Bond Certificate to the address of the
Applicant provi ded in the Application Form.
Allottees will havetheoption to dematerialisetheBonds so Allotted as per theprovisions of theDepositories Act.
All terms and conditions disclosed in relation to the Bonds held in physical form pursuant to rematerialisation
shall be applicable mutatis mutandis to the Bonds issued in physical form.
42. Applications for Allotment of Bonds in the dematerialised form: Asper theprovisionsof the DepositoriesAct,
the Bonds can be held in dematerialised form, i.e., they shall be fungible and be represented by a statement
issued through electronic mode. In this context, the Tripartite Agreements have been executed between IRFC,
the Registrar to the Issue and the respective Depositories (CDSL/NSDL) for offering depository option to the
Bondholders, for issue and holding the Bonds in dematerialized form. a) All Applicants can seek Allotment
in dematerialised mode or in physical form. Applications made for receiving Allotment in the dematerialised
form without relevant details of his or her depository account are liable to be rejected. b) An Applicant applying
for the Bonds must have at least one beneficiary account with either of the Depository Participants of either
of the Deposi tori es, pri or to making the Appli cati on. c) The Applicant must necessaril y fi ll i n the detai ls
(including the Beneficiary Account Number and Depository Participants identification number) in the Application
Form. d) Allotment to an Applicant will be credited in electronic form directly to the beneficiary account (with
the Depository Participant) of the Applicant. e) Names in the Application Form should be identical to those
appearing in the account details in the Depositories. In case of joint holders, the names should necessarily
be in the same sequence as they appear in the account details in the Depositories. f) If incomplete or incorrect
details are given under the heading Applicants Depository Account Details, in the Application Form, it is
liable to be rejected. g) The Applicant is responsible for the correctness of his or her demographic details given
in the Application Form vis--vis those with his or her Depository Participant. h) Bonds in electronic form can
be traded onl y on the stock exchange having electronic connectivity with the Depositories. BSE and NSE,
where the Bonds are proposed to be listed, has electronic connectivity with the Depositories. i) The trading
of the Bonds shall bein dematerialised formonly. Allottees will havethe option to re-materialisethe Bonds so
Allotted as per the provisions of the Depositories Act. Inaddition tothe above, certain additional documents are
required to be submitted by the following entities: (a) With respect to Investments by FIIs and Mutual Funds,
IN THE NATURE OF FORM 2A - MEMORANDUM CONTAINING SALIENT FEATURES OF THE PROSPECTUS
6 INDIAN RAILWAY FINANCE CORPORATION LIMITED
a certified copy of their SEBI registration certificate must be lodged along with the Application Form. (b) With
respect to Investments by insurance companies registered with the Insurance Regulatory and Development
Authority, in addition to the above, a certified copy of the certificate of registration issued by the Insurance
Regulatory and Development Authority must be lodged along with the Application Form. (c) With respect
to Investments made by limited liability partnerships registered under the Limited Liability Partnership Act,
2008, a certified copy of certificate of registration must be lodged along with the Application Form.
43. Consolidated List of Documents Required for Various Categories
For the sake of simplicity, we hereby provide the details of documents required to be submitted by various
categori es of investors whi le submi tti ng the Appl icati on Form.
Typeof Investors, Documents to besubmitted with application form (in addition to thedocuments required for
applications for Allotment of Bonds in physical form); Public Financial Institutions, Statutory Corporations,
Commercial Banks, Co-operati ve Banks and Regional Rural Banks, which are authorised to invest in the
Bonds, Compani es; bodi es corporate and soci eties regi stered under the appl icabl e l aws i n Indi a and
authorised to invest in the Bonds; Scienti fic and/or i ndustrial research organisations, which are authorised
to i nvest i n the Bonds, Multi l ateral and bi l ateral devel opment fi nanci al i nsti tuti ons, State i ndustri al
development corporations ; The application must be accompanied by certified true copies of: Any Act/Rules
under which they are incorporated Board Resolution authorisi ng investments Specimen si gnature of
authorized person ; Insurance companies registered with the IRDA, The applications must be accompanied
by certified copies of Any Act/Rules under which they are incorporated Registration documents (i.e. IRDA
registration) Resolution authorising investment and containing operating instructions (Resolution) Specimen
si gnature of authorized person ; Provident Funds, Pension Funds, Superannuati on Funds and Gratui ty
Fund, which are authorised to i nvest in the Bonds; andNational Investment Fund, The application must be
accompani ed by certi fi ed true copies of : Any Act/Rul es under which they are incorporated Board
Resolution authorising investments Specimen signature of authorized person ; Mutual Funds, The applications
must be also accompanied by certified true copies of: SEBI Registration Certificate and trust deed (SEBI
Registration) Resol uti on authorising i nvestment and containi ng operati ng instructions (Resol uti on)
Specimen signature of authori zed person ; Forei gn Instituti onal Investors (i ncl uding sub-accounts); The
appli cati ons must be also accompani ed by certifi ed true copies of: SEBI Registration Certi ficate (SEBI
Regi stration) Inward Remittance certi ficate Resol ution authorising investment and containing operating
instructions (Resolution) Specimen signature of authorized person ; Registered trusts which are authorised
to invest in the Bonds; The applicants must submit a Certified copy of the registered instrument for creation
of such trust Power of Attorney, if any, in favour of one or more trustees Such other documents evidencing
registration thereof under appli cabl e statutory/regulatory requirements. Speci men signature of authori zed
person ; Partnership firms i n the name of the partnersLimited liability partnerships formed and registered
under the provisions of the Limited Liability Partnership Act, 2008 (No. 6 of 2009) Partnership Deed Any
documents evidencing registration thereof under applicable statutory/regulatory requirements. Resolution
authorising investment and containing operating instructions (Resolution) Specimen signature of authorized
SHUVRQ 3RZHU 2I $WWRUQH\ XQGHU &DWHJRU\ , $ FHUWLILHG FRS\ RI WKH SRZHU RI DWWRUQH\ RU WKH UHOHYDQW
resolution or authority, as the case may be A certified copy of the memorandum of association and articles
of association and/or bye laws and/or charter documents, as applicabl e, must be l odged along with the
Applicati on Form. Resident Indian individual s under Category II and Category III , N.A. ; Hindu Undivided
Families through the Karta under Category II and Category III, N.A ; Non Resident Indians/PIO on repatriation
as well as non-repatriation basis under Category II and Category III When payment is through demand draft
then the certificate from the bank that the draft has been made by debiting the NRE account PIO Card (if
application by PIO) ; Power Of Attorney under Category II and Category III A certified copy of the power
of attorney has to be lodged with the Application Form
PAYMENT INSTRUCTIONS
44. EscrowMechanism
IRFC shall open Escrow Account(s) with one or more Escrow Col lecti on Bank(s) i n whose favour the
Appli cants shal l make out the cheque or demand draft in respect of his or her Appli cation. Cheques or
demand drafts received for the Appl icati on Amount from Appli cants would be deposi ted in the Escrow
Account. For further detai ls pl ease see the Prospectus Tranche - 1.
45. Method of payment of purchase consideration for FII
FIIs shall make the payment for purchase of such securi ties either by i nward remittance through normal
banki ng channel s or out of funds hel d i n Forei gn Currency Account or Non-resi dent Rupee Account
maintained by the Forei gn Institutional Investor wi th a desi gnated branch of an authorised dealer wi th
the approval of Reserve Bank of India. The payment of the application money shall be made in cheque
or demand draft i n rupee denominated currency only.
46. Payment into Escrow Account
Each Appl icant shal l draw a cheque or demand draft for the Appli cati on Amount as per the foll owing
terms: a) All Appli cants would be requi red to pay the full Applicati on Amount for the number of Bonds
appl ied for, at the ti me of the submission of the Appl i cation Form. b) The Appl icants shal l, wi th the
submission of the Appli cation Form, draw a payment instrument for the full Appli cation Amount in favour
of the Escrow Account and submit the same to Bankers to the Issue. If the payment is not made favouring
the Escrow Account along with the Appli cation Form, the Application shal l be rejected. c) The payment
i nstruments from non-NRI and non-FII appl icants shall be payabl e into the Escrow Account drawn i n
favour of IRFC Tax Free Bonds Escrow Account Tranche I. d) The monies deposited in the Escrow
Account wi l l be hel d for the benefi t of the Appl i cants unti l the Desi gnated Date. e) The payment
instrument from NRI applicants shall be payable in the NRI Escrow Account drawn in favour of IRFC Tax
Free Bonds NRI Escrow Account Tranche I. f) The payment instrument from FII appli cants shall be
payabl e in the FII Escrow Account drawn i n favour of IRFC Tax Free Bonds FII Escrow Account
Tranche I. g) On the Desi gnated Date, the Escrow Coll ection Banks shal l transfer the funds from the
Escrow Account as per the terms of the Escrow Agreement into the Public Issue Account with the Bankers
to the Issue. The Escrow Col lection Bank shal l also refund al l amounts payabl e to Appl icants whose
Applicati ons have not been allotted Bonds. h) Payments shoul d be made by cheque, or a demand draft
drawn on any bank (incl udi ng a co-operative bank), which is situated at, and i s a member of or sub-
member of the bankers cl earing house located at the centre where the Appli cation Form i s submitted.
Outstati on cheques/bank drafts drawn on banks not parti cipati ng i n the cl eari ng process wi l l not be
accepted and applications accompanied by such cheques or bank drafts are liable to be rejected. i) Cash/
stock invest/money orders/postal orders wi ll not be accepted.
47. Submission of Application Forms
All Appl icati on Forms dul y compl eted and accompanied by account payee cheques or drafts shall be
submitted to the designated coll ecti on banks during the Issue Peri od. No separate receipts shal l be
issued for the money payable on the submission of Appl icati on Form. However, the col lecti on banks will
acknowl edge the recei pt of the Appl i cati on Forms by stamping and returning to the Appl i cants the
acknowl edgement sli p. Thi s acknowledgement sl ip wi ll serve as the dupl icate of the Appli cati on Form
for the records of the Appli cant. Appl icati ons shal l be deemed to have been received by us only when
submi tted to Bankers to the Issue at thei r desi gnated branches as detail ed above and not otherwi se.
All Applications by Public Financial Institutions, Statutory Corporations, Commercial Banks, Co-operative
Banks and Regional Rural Banks, Provident Funds, Pension Funds, Superannuation Funds and Gratuity
Fund, insurance companies registered with the IRDA, National Investment Fund, Mutual Funds, Foreign
Institutional Investors, insurance funds setup and managed by the army, navy or air forceof theUnion of
Indi a, multi lateral and bil ateral development financial institutions and state industrial development
corporations applicants shall be received only by theLead Managers and their respectiveaffiliates.
48. Online Applications
Lead Managers may deci de to offer an online Appli cation facili ty for the Bonds, as and when permitted
by applicable laws, subject to the terms and conditions prescribed. Accordingly the investors may download
forms for this use and submit the same together with cheques/demand drafts to the Bankers to the Issue
and their collecting centres. However, Publ ic Fi nanci al Insti tutions, Statutory Corporati ons, Commerci al
Banks, Co-operati ve Banks and Regional Rural Banks, Provident Funds, Pension Funds, Superannuation
Funds and Gratui ty Fund, i nsurance companies regi stered wi th the IRDA, Nati onal Investment Fund,
Mutual Funds and Forei gn Instituti onal Investors, i nsurance funds setup and managed by the army,
navy or ai r force of the Uni on of India, mul ti lateral and bi l ateral devel opment fi nanci al i nsti tuti ons
and state industri al development corporations can apply only through pink coloured physical appl ication
forms provided by the Lead Managers and their respecti ve affi li ates.
49. Other Instructions
A. Joint Appl ications : Applications may be made in si ngle or joint names (not exceeding three). In the
case of joint applications, all payments will be made out in favour of the first applicant. All communications
wi ll be addressed to the fi rst named appli cant whose name appears i n the Applicati on Form and at the
address mentioned therein. B. Additional/Multiple Applications : An applicant is allowed to make one
or more applications for the Bonds for the same or other series of Bonds, subject to a minimum application
si ze of ten Bonds and in multiples of five Bond thereafter, for each appl icati on. Any appl icati on for an
amount bel ow the aforesai d mi nimum appl ication si ze wi l l be deemed as an i nval i d appli cati on and
shal l be rej ected. However, any appl i cati on made by any person i n hi s i ndi vi dual capaci ty and an
appli cation made by such person i n his capaci ty as a karta of a Hi ndu Undivided famil y and/or as joint
appl icant, shall not be deemed to be a mul ti ple appl icati on. For the purposes of al lotment of Bonds
under the Issue, applications shall be grouped based on the PAN, i.e. applications under the same PAN
shal l be grouped together and treated as one appl icati on. Two or more appli cati ons will be deemed to
be multiple applications if the sol e or first appli cant i s one and the same. For the sake of clarity, two or
more appl icati ons shall be deemed to be a mul ti pl e appl icati on for the aforesaid purpose i f the PAN
number of the sole or the first applicant is one and the same. C. Depository Arrangement s: We have
entered i nto Tri partite Agreement dated January 23, 2002 among us, the Regi strar to the Issue and
NSDL and dated May 8, 2003, among us, the Registrar to the Issue and CDSL, respectivel y for offering
depository option to the investors and for issue and holding of the Bonds in dematerialized form. As per
the provisions of the Depositories Act, 1996, the Bonds issued by us can be held in a dematerialized form
as described under the heading - Applications for Allotment of Bonds in dematerialized form on page 56
of the Prospectus Tranche - 1. D. Communicati ons : All future Communicati ons i n connecti on with
Appl ications made in the Issue shoul d be addressed to the Regi strar to the Issue quoti ng all rel evant
detai ls as regards the appl i cant and its appl i cati on. Appli cants can contact the Compl iance Officer of
IRFC/Lead Managers or the Registrar to the Issue in case of any Pre-Issue related probl ems. In case of
Post-Issue rel ated probl ems such as non-recei pt of All otment Advi ce/credit of Bonds i n depository s
benefi ci ary account/refund orders, etc., appl i cants may contact the Compl i ance Officer of IRFC/Lead
Managers or Registrar to the Issue.
50. Rejection of Applications
IRFC reserves its full, unqualified and absolute right to accept or reject any Application in whole or in part and in
either case without assigning any reason thereof. Application would be liable to be rejected on one or more technical
grounds, including but not restricted to: Number of Bonds applied for is less than the minimum Application size;
Applications not duly signed by the sole/joint Applicants; Application amount paid not tallying with the number
of Bonds applied for; Applications for a number of Bonds which is not in a multiple of one; Investor category not
ticked; Bank account details not given; Applications by persons not competent to contract under the Indian Contract
Act, 1872, as amended, including a minor without a guardian name; In case of Applications under Power of Attorney
where relevant documents not submitted; Application by stock invest or accompanied by cash/money order/postal
order; Applications without PAN; GIR number furnished instead of PAN; Applications for amounts greater than
the maximum permissible amounts prescribed by applicable regulations; Applications by persons/entities who have
been debarred from accessing the capital markets by SEBI; Applications by any persons outside India, barring
applications made by NRIs on a non-repatriable and applications made by NRIs under a repatriable basis and FIIs
as described above; For option to hold Bonds in electronic/dematerialised form, Depository Participant identification
number, Client ID and PAN mentioned in the Application Form do not match with the Depository Participant
identification number, Client ID and PAN available in the records with the depositories; Application under power
of attorney or by limited companies, corporate, trust etc., where relevant documents are not submitted; Address not
provided in case of exercise of option to hold Bonds in physical form; Copy of KYC documents not provided in case
of option to hold Bonds in physical form; and Applications of Public Financial Institutions, Statutory Corporations,
Commercial Banks, Co-operative Banks and Regional Rural Banks, Provident Funds, Pension Funds, Superannuation
Funds and Gratuity Fund, Insurance companies registered with the IRDA, National Investment Fund, Mutual Funds
and Foreign Institutional Investors applicants not procured by the Lead Managers or their respective affiliates.
Applications made by investors belonging to a particular Category on an application form meant for other applicants
and vice-versa. Bank certificate not provided along with demand draft for NRI Applicants. PIO Applications without
the PIO Card. In case of NRI applications if the money is received from NRO account and the account number (in
case of application in physical form) mentioned in the application form is a repatriable account or the status of the
demat account mentioned is repatriable. In case of NRI applications, applying in physical form, submitted at
collection centres other than the centres designated for submitting the application forms by NRI applicants applying
in physical form. The collecting bank shall not be responsible for rejection of the Application on any of the technical
grounds mentioned above. Application Forms received after the closure of the Issue shall be rejected. In the event,
if any Bond(s) applied for is/are not Allotted, the Application monies in respect of such Bonds will be refunded, as
may be permitted under the provisions of applicable laws.
51. Basis of Allotment
The subscription list for the Issue shall remain open for subscription at the commencement of banking hours
and close at the close of banking hours, with an option for early closure (subject to the Issue being open for
a minimum of 3 days) or extension by such period, upto a maximum period of 30 days from the date of
opening of the Issue, as may be decided by the Board of the Company, subject to necessary approvals, if
any. In the event of such early closure of the subscription list of the Issue, IRFC shall ensure that public notice
of such early closure is published on or before the day of such early date of closure through advertisement/
s in a leading national daily newspaper. The issue shall remain open for subscription for a minimum period
of 3 days. IRFC shal l fi nali se the Basi s of Al lotment in consul tati on wi th the Lead Managers and the
Designated Stock Exchange and i n compl iance wi th the aforementi oned provi si ons of the Prospectus
Tranche - 1. The Designated Stock Exchange along with IRFC, Lead Managers and the Registrar shall be
responsible for ensuring that the Basi s of Allotment is finali sed i n a fair and proper manner.
52. Grouping of Applications and Allocation Ratio: Applications received from various applicants shall be
grouped together on the fol lowing basis: i) Applications recei ved from Category I applicants: Applications
received from Category I, shall be grouped together, (Category I Portion); ii) Applications received from
Category II applicants: Appl icati ons received from Category II shall be grouped together, (Category II
Port ion); iii ) Applications received from Category III applicants: Applications recei ved from Category III
applicants shall be grouped together, (Category III Portion). For removal of doubt, Category I Portion,
Category II Portion, and the Category III Portion are individually referred to as Portion and collectively
referred to as Portions For the purposes of determining the number of Bonds avai lable for allocati on
to each of the abovementi oned Categori es, IRFC shall have the di scretion of determi ni ng the number
of Bonds to be allotted over and above the Base Issue Size, in case IRFC opts to retain any oversubscription
in the Issue upto the Shelf Li mi t (i.e. upto ` 6,30,000 l akhs). The aggregate value of Bonds decided
to be allotted over and above the Base Issue Si ze, (in case IRFC opts to retain any oversubscription in
the Issue), and/or the aggregate value of Bonds upto the Base Issue Size shall be col lecti vely termed
asthe Overall Issue Size.
53. Allocation Ratio
Reservati ons shal l be made for each of the Portions in the bel ow mentioned format:
Particulars Category I Category II Category III
Size in % 45% of the Overall 25% of the Overall 30% of the Overall
Issue Si ze Issue Si ze Issue Si ze
54. Basis of Allotment for Bonds
(a) Allotments in the first instance: i. Applicants bel onging to the Category I, in the first instance, wil l be
allocated Bonds upto 45% of the Overall Issue Size on first come first serve basis (determined on the basis
of date of recei pt of each appl i cati on dul y acknowl edged by the Bankers to the Issue); i i. Appl i cants
bel onging to the Category II, in the first instance, wil l be allocated Bonds upto 25% of the Overall Issue
Si ze on first come first serve basis (determined on the basis of date of receipt of each application duly
acknowl edged by the Bankers to the Issue); and iii. Applicants belonging to the Category III, i n the fi rst
i nstance, wi ll be al l ocated Bonds upto 30% of the Overall Issue Si ze on fi rst come fi rst serve basi s
(determined on the basis of date of receipt of each application duly acknowledged by the Bankers to the
Issue); Al lotments, i n consul tation with the Designated Stock Exchange, shall be made on a first-come
first-serve basis, based on the date of presentation of each application to the Bankers to the Issue, in each
Portion subject to the Al location Ratio. (b) Under Subscription: If there is any under subscri pti on in any
Portion, pri ori ty in allotments wil l be given in the fol lowing order: i . Category III Portion ii. Category II
Portion iii. Category I Portion (c) For each Portion, applications received on the same day by the Bankers
to the Issue would be treated at par with each other. Allotment within a day would be on proporti onate
basis, where Bonds applied for exceeds Bonds to be allotted for each Porti on respectivel y. (d) Mi nimum
all otments of 10 Bonds and i n multi pl es of 1 Bond thereafter woul d be made in case of each val i d
application. (e) Al lotments in case of oversubscription: In case of an oversubscription, all otments to the
maximum extent possible, wil l be made on a first-come first-serve basis and thereafter on proportionate
basis i.e. full all otment of Bonds to the appl icants on a first-come first-serve basis upto the date falli ng
1 (one) day pri or to the date of oversubscri pti on and proportionate al lotment of Bonds to the appli cants
on the date of oversubscription (based on the date of submission of each applicati on to the Bankers to
the Issue, in each Portion). (f) Proportionate Allotments: For each Portion, on the date of oversubscription,
all otment shall be made on a proportionate basis. The method of proportionate al lotment is as described
bel ow: i. All otments to the appl icants shal l be made in proporti on to thei r respective appl ication si ze,
rounded off to the nearest integer, i i. If the process of roundi ng off to the nearest integer resul ts in the
actual all ocation of Bonds being hi gher than the Issue size, not all applicants will be all otted the number
of Bonds arrived at after such rounding off. Rather, each applicant whose allotment size, prior to rounding
off, had the highest decimal point would be given preference, ii i. In the event, there are more than one
applicant whose entitlement remain equal after the manner of di stribution referred to above, the Company
shal l ensure that the basi s of al lotment is finali sed by draw of lots in a fair and equitable manner. (g)
Appli cant applying for more than one series of Bonds: If an appl icant has appli ed for more than one
series of Bonds, and in case such applicant is entitled to allocation of only a part of the aggregate number
of Bonds applied for, the Series-wise allocation of Bonds to such applicants shall be in proporti on to the
number of Bonds with respect to each Series, appli ed for by such appli cant, subj ect to roundi ng off to
the nearest i nteger, as appropri ate i n consul tati on wi th the Lead Managers and Desi gnated Stock
Exchange. All decisions pertaini ng to the basis of al lotment of Bonds pursuant to the Issue shall be taken
by the Company i n consultati on wi th the Lead Managers and the Desi gnated Stock Exchange and i n
compl iance with the aforementi oned provisions of the Prospectus Tranche - 1. The Company has the
di screti on to cl ose the Issue i rrespective of whether any of the Porti on(s) are ful l y subscri bed. The
Company would all ot Tranche 1 Seri es II Bonds to all val id appli cations, wherei n the appl icants have
not indi cated thei r choi ce of the relevant Series of Bonds.
55. Allotment Advice/Refund Orders
The unuti l i sed porti on of the appl i cati on money wi l l be refunded to the appl i cant by an A/c Payee
cheque/demand draft. In case the at par facility is not available, IRFC reserves the right to adopt any other
suitabl e mode of payment. We may enter i nto an arrangement with one or more banks i n one or more
citi es for refund to the account of the applicants through Direct Credit/RTGS/NEFT. IRFC shall credit the
al lotted Bonds to the respective beneficiary accounts/di spatch the Letter(s) of All otment or Letter(s) of
Regret/Refund Orders to all applicants by Regi stered Post/Speed Post at the applicants sole ri sk, wi thin
30 days from the date of closure of the Issue. Further, a) Allotment of Bonds offered to the publi c shall
be made within a time period of 30 days from the date of closure of the Issue;b) Credi t to demat account
will be given within 2 working days from the date of allotment c) Interest at a rate of 15 per cent per annum
wi ll be paid if the allotment has not been made and/or the Refund Orders have not been dispatched to
the applicants within 30 days from the date of the closure of the Issue, for the delay beyond 30 days. d)
IRFC wi ll provi de adequate funds to the Registrars to the Issue, for thi s purpose.
56. Filing of theProspectus Tranche 1 with the Stock Exchanges : A copy of the Prospectus Tranche 1
shall be fi led with the NSE and BSE.
57. Pre-Issue Advertisement IRFC shal l, on or before the Issue Opening Date, publ ish a pre- Issue
advertisement, i n the form prescri bed by the SEBI Debt Regul ations, in one national dail y newspaper
with wi de ci rcul ati on.
58. Withdrawal of Applications by Applicants : Applicants are allowed to withdraw their applications at any
ti me prior to the cl osure of the Issue.
59. IMPERSONATION
Any person who: a) makes i n a fictitious name, an application to IRFC for acquiri ng or subscribing for,
any shares therein, or b) otherwise induces IRFC to allot, or register any transfer of shares, therein to him,
or any other person i n a fi ctitious name, shal l be punishabl e with imprisonment for a term whi ch may
extend to five years.
60. Listing
The Bonds wil l be l isted on NSE and BSE. If the permission to deal in and for an official quotati on of
the Bonds i s not granted by BSE and NSE, we shall forthwith repay, without interest, all such moneys
received from the Applicants in pursuance of the Tranche Prospectus (es). IRFC shall use best efforts to
ensure that al l steps for the completion of the necessary formaliti es for li sting at the Stock Exchange are
taken wi thin fifteen Worki ng Days from the date of All otment.
61. Utilisation of Application Money
The sums received in respect of the Issue will be kept in the Escrow Account and IRFC will have access
to such funds only after creation of security for the Bonds and as per appl icable provi si ons of l aw(s),
regulations and approvals. IRFC shall at all times ensure that any monies kept in the NRI Escrow Account
shall be util i sed onl y i n accordance with the FEMA (Borrowi ng and Lending i n Rupees) Regulati ons,
2000 and other appli cabl e statutory and/or regulatory requi rements.
62. Undertaking by the Issuer
We undertake that: a) the complaints received in respect of the Issue shall be attended to by us expeditiously
and satisfactoril y; b) we shal l take necessary steps for the purpose of getti ng the Bonds listed within the
specified time; c) the funds required for dispatch of refund orders/allotment advice/certificates by registered
post shall be made available to the Registrar to the Issue by IRFC; d) necessary cooperation to the credit
rating agency(ies) shal l be extended i n providing true and adequate information until the debt obl igati ons
in respect of the Bonds are outstandi ng; e) we shal l forward the detai ls of util isati on of the funds rai sed
through the Bonds duly certified by our statutory audi tors, to the Trustee at the end of each half year; f)
we shal l disclose the complete name and address of the Trustee in our annual report; and g) we shall
provide a compliance certificate to the Trustee (on an annual basis) in respect of compliance of with the
terms and condi tions of issue of Bonds as contained in the Tranche Prospectus(es). h) We shall make
necessary di scl osures/ reporti ng under any other legal or regulatory requirement as may be required by
IRFC from time to time.
LEAD MANAGERS TO THE ISSUE
SBI CAPITAL MARKETS LIMITED
202, Maker Tower E, Cuffe Parade,
Mumbai 400 005
Tel: +91 22 2217 8300 Fax: +91 222218 8332
E-mail: irfcbonds@sbicaps.com
Investor GrievanceEmail:investor.relations@sbicaps.com
Website: www.sbicaps.com
Contact Person: Ms. Anshika Malaviya/
Mr.Puneet Deshpande
Compliance Officer: Mr.Bhaskar Chakraborty
SEBI RegistrationNo.: INM000003531#
A. K. CAPITAL SERVICES LIMITED
30-39 Free Press House, 3rd Floor,
Free Press Journal Marg, 215,
Nariman Point, Mumbai 400 021
Tel: +912267546500/66349300 Fax:+912266100594
E-mail: irfctfbonds@akgroup.co.in
Investor GrievanceEmail: investor.grievance@akgroup.co.in
Website: www.akcapindia.com
Contact Person: Mr. Hitesh Shah
Compliance Officer: Mr. Vikas Agarwal
SEBI Registration No.: INM000010411
REGISTRAR TO THE ISSUE
ICICI SECURITIES LIMITED
ICICI Centre, H.T. Parekh Marg
Churchgate, Mumbai 400 020
Maharashtra, India
Tel : +91 22 2288 2460 Fax : +91 22 2282 6580
E-mail: irfcbonds@icicisecurities.com
Investor GrievanceEmail: customercare@icicisecurities.com
Website: www.icicisecurities.com
Contact Person:Mr. Mangesh Ghogle/ Ms.Payal Kulkarni
Compliance Officer: Mr. Subir Saha
SEBI Registration No.: INM000011179
KARVY COMPUTERSHARE PRIVATE LIMITED
Plot No. 17 to 24, Vittal Rao Nagar,
Madhapur, Hyderabad - 500 081
Toll Free No.1-800-3454001
Tel: +91 40 4465 5000
Fax: +91 40 2343 1551
E-mail ID: irfc.bonds@karvy.com
Investor Grievance Email: einward.ris@karvy.com
Website: http:\\karisma.karvy.com
Contact Person: Mr. M. Murali Krishna
SEBI Registration Number: INR000000221
INDIANBANK
Corporate Office,
254-260, Avvai Shanmugam Salai,
Royapettah
Chennai 600 014 India
Tel: 044 2813 4089/2813 4436
Fax : 044-28134088
Contact Person: Mr. T. Chandrasekaran
E-mail ID: holegal@indianbank.co.in
Website: www.indianbank.com
SEBI Registration Number: INB100000017
TRUSTEE FOR THE BONDHOLDERS


FOR FURTHER DETAILS, PLEASE REFER TO THE PROSPECTUS
ISSUE MANAGEMENT TEAM
# The SEBI registrati on of one of the Lead Managers to the Issue, SBI Capital Markets Li mi ted was val id up to July 31, 2011. The appli cation for renewal of the certi ficate of regi stration i n the prescri bed manner has been made by SBI Capi tal Markets Limited on April 29, 2011, to SEBI, three months before
the expiry of the period of the certifi cate as requi red under Regul ati on 9(1) of the SEBI (Merchant Bankers) Regulati ons, 1992. The approval of SEBI i n thi s regard i s currentl y awai ted.
InvestorsmaycontacttheComplianceOfficer orthe RegistrartotheIssueincaseofanypre-Issueor post-Issuerelated problemssuchasnon-receipt oflettersofallotment, creditof allottedBondsintherespectivebeneficiaryaccountor non-receiptof BondCertificates/ ConsolidatedBond Certificates, asapplicable, or refundorders, etc.
Consortium Members for the Issue : In addition to the Lead Managers, foll owing are also consortium members for the Issue : SBICAP Securities Limited, Regd. Address: 191, 19th Fl oor, Maker Tower - F Wi ng, Cuffe Parade, Mumbai 400005 Correspondence Address: Mafatl al Chambers, 2nd floor, C wing,
N M Joshi Marg, Lower Parel , Mumbai 400013 Tel : +91 22 4227 3446; Fax: +91 22 4227 3391 Emai l : archana.dedhi a@sbi capsec.com Investor Gri evance Emai l : compl ai nts@sbi capsec.com Contact Person: Ms. Archana Dedhi a SEBI Regi stration No.: BSE: INB 011053031 NSE: INB 231052938 A. K.
STOCKMART PRIVATE LIMITED, Address: 30-39, Free Press House, Free Press Journal Marg, 215, Nari man Point, Mumbai 400 021 Tel : +91 22 6754 6500; Fax: +91 22 6754 4666 E-mai l ID: ankit@akgroup.co.i n Website: www.akcapi ndi a.com Contact person: Mr.Ankit Gupta SEBI Regi strati on No.: BSE:
I NB011269538 NSE: I NB231269532.
STATUTORY AUDITORS : Dhawan & Co., Chartered Accountants,312, Wegmans House,21, Veer Savarkar Bl ock,New Del hi 110 092, Indi a. Tel: +91 (11) 22017651, 22025360 Emai l : dpa111@hotmai l .com Fi rm Registrati on No.: 002864N
LEGAL ADVISORS TO THE ISSUE : AZB & Partners, AZB House,Plot No. A-8, Sector 4,Noi da, 201 301,India. Tel: +91 120 4179999 Fax: +91 120 4179900
CREDIT RATING AGENCIES : CRISIL Limited, CRISIL House, Central Avenue,Hi ranandani Business Park, Powai ,Mumbai 400 076, Indi a. Tel : +91 (22) 3342 3000 Fax: +91 (22) 3342 3050 E-mai l : cri si lrati ngdesk@cri sil .com Websi te: www.cri si l.com Contact Person: Mr. Suman Chowdhury SEBI Regi stration
No.: IN/CRA/001/1999. ICRA Limited, Bui ldi ng No. 8, 2
nd
Fl oor, Tower A, DLF Cyber City, Phase- II, Gurgaon 122 002, India. Tel : +91 (124) 4545 300 Fax: +91 (124) 4545 350 E-mai l: vi vek@i craindia.com Investor Gri evance e-mail : vw@i craindia.com Website: www.i cra.i n Contact Person: Mr. Vivek Mathur
SEBI Regi strati on No.: IN/CRA/003/1999. Credit Analysis & Research Limited (CARE) B-47 3
rd
Fl oor, Inner Circl e, Connaught Pl ace, New Delhi 110 001. Tel : +91 (11) 2371 6199 Fax: +91 (11) 4533 3200 E-mai l : jyotsana.gadgi l@careratings.com Websi te: www.careratings.com Contact Person: Ms. Jyotsna
Gadgi l SEBI Regi str ati on No.: IN/CRA/004/ 1999
ESCROW COLLECTION BANKS / BANKERS TO THE ISSUE : Axis Bank Limited E-146, Near PVR Anupam,Saket, New Delhi 110 017 Tel: 011-4266 5166 Fax: 011-4166 4222 Emai l : biswaranj an.gouda@axisbank.com/ashi sh.dhall @axi sbank.com Contact Person: Mr. Bi swaranj an Gouda and Mr. Ashish
Dhal l Websi te: www.axisbank.com SEBI Regi stration No.: INBI00000017 HDFC Bank Limited HDFC Bank Li mited, FIG OPS Department,- Lodha, I Thi nk Techno Campus,O-3, Level, Next to Kanj urmarg Rail way Stati on, Kanjurmarg (East), Mumbai 400 042. Tel : 09322157474 Fax: 022-2579 9801 Email :
uday.dixi t@hdfcbank.com/ fi gdel hi @hdfcbank.com Contact Person: Mr. Uday Di xi t Website: www.hdfcbank. com SEBI Regi stration No.: INBI00000063 ICICI Bank Limited Capi tal Market Di vi sion, 30, Raj abahadur Mansi on, Mumbai Samachar Marg, Fort, Mumbai 400 001 Tel : 022-66310322 Fax: 022-
66310350 Emai l: anil .gadoo@i ci ci bank.com Contact Person: Mr. Ani l Gadoo Website: www.i ci ci bank.com SEBI Regi stration No.: INBI00000004 IDBI Bank Limited Uni t No. 2, Corporate Park, Si on Trombay Road, Chembur, Mumbai 400 071 Tel : 022-6690 8402 Fax: 022-2528 6173 Emai l : ipoteam@idbi .co.i n
Contact Person: Mr. V. Jayananthan (Head CMS Operati ons) Websi te: www.i dbi bank.com SEBI Regi strati on No.: INBI00000076 Kotak Mahindra Bank Limited 5
th
Fl oor, Dani Corporate Park 158, CST Road Kal i na Santacruz (E), Mumbai 400 098 Tel : 022-6759 5336 Fax: 022-6759 5374 Emai l :
amit.kr@kotak.com Contact Person: Mr. Ami t Kumar Website: www.kotak.com SEBI Registrati on No.: INBI00000927 State Bank of India CMP Centre, 31 Mahal Ind Estate, Andheri (E), Mumbai 400 093 Tel : 022-2687 4809/05 Fax: 022-2687 4805 Email : AGMPI.CMP@SBI.CO.IN/soumendra.mukherji @sbi .co.in
Contact Person: Mr. Ej az Hussai n Websi te: www.statebankofi ndi a.com SEBI Regi stration No.: INBI00000038
COMPANY SECRETARY
Mr. S K Ajmani, Company Secretary & GM (Term
Loans), UG Fl oor, East Tower, NBCC Pl ace,
Pr agat i Vi har, ,Lodhi Road, New Del hi -110
003,Tel . : +91 11 2436 9766/69, Fax: +91 11
2436 6710, Emai l : skai r f c@r edi ff mai l .com
Websi te: www.i rfc.ni c.i n
COMPLIANCE OFFICER
Mr. T. Behera, General Manager-Bonds,UG Floor,
East Tower, ,NBCC Pl ace, Pragati Vihar, ,Lodhi
Road, New Del hi -110 003,Tel . : +91 11 2436
9766/ 69, Fax: +91 11 2436 6710, Emai l :
gma@i rfc.ni c.i n Websi te: www.irfc.ni c.i n
IN THE NATURE OF FORM 2A - MEMORANDUM CONTAINING SALIENT FEATURES OF THE PROSPECTUS
7 INDIAN RAILWAY FINANCE CORPORATION LIMITED
Prospective investors should carefully consider all the information in the Shelf Prospectus, including the risks and
uncertainties described below, and the information provided in the section titled Our Business on page 55 and in
Annexure I of the Shelf Prospectus. i.e. Financial Statements, before making an investment in the Bonds. The risks
and uncertainties described in this section are not the only risks that we currently face. Additional risks and uncertainties
not known to us or which we currently believe to be immaterial may also have an adverse effect on our business,
prospects, results of operations and financial condition. If any of the following or any other risks actually occur, our
business prospects, results of operations and financial condition could be adversely affected and the price of, and the
value of your investment in the Bonds could decline and you may lose all or part of your redemption amounts and /
or interest amounts. The financial and other related implications of risks concerned, wherever quantifiable, have been
disclosed in the risk factors mentioned below. However, there are certain risk factors where the effect is not quantifiable
and hence have not been disclosed in such risk factors. The numbering of the risk factors have been done to facilitate
ease of reading and reference, and do not in any manner indicate the importance of one risk factor over another.
RISKSRELATINGTOOURBUSINESSANDINDUSTRY: 1. Our abilityto operateefficientlyisdependent onour ability
to maintainaloweffectivecost of funds.Inability to dosocouldhaveamaterial adverseeffect onour business, financial
condition and results of operations.: Our abilitytooperateefficientlyisdependent onour abilitytomaintainaloweffective
cost of funds. Therefore, timely access to, and the costs associated with raising capital and our ability to maintain a low
effective cost of funds in the future is critical. Historically, our access to funds has been enhanced by resorting to equity
financing which we receive directly from the Government. Our relationship with the Government and the highest credit
ratings assigned to us enables us to price our borrowings at a lower rate of interest than would otherwise be available
to us thereby reducing our cost of funds. There can be no assurance as to the level of direct or indirect support to us
provided by the Government and negative changes in the policies of the Government could materially increase the
cost of funds available to us. As we are fundamentally dependent upon funding from the debt markets and commercial
borrowings, our ability to continue to obtain funds from the debt markets and through commercial borrowings on
acceptable terms is dependent on various factors which include but are not limited to, our ability to maintain our existing
credit ratings, which are based upon several factors, many of which are outside our control, including the economic
conditions in the Indian railway sector and the Indian economy, and the liquidity in the domestic and global debt
markets, which has been severely restricted during the recent financial crisis. There can be no assurance that we will
be able to maintain our existing credit ratings. Therefore any downgrades to our credit ratings could materially increase
the cost of funds available to us, particularly from the debt markets and commercial borrowings. Further, since we are
a non-deposit taking NBFC, we have restricted access to funds in comparison to banks and deposit taking NBFCs. We
are also dependent on our classification as an IFC which enables us, among other things, to diversify our borrowings
through the issuance of infrastructure bonds that offer certain tax benefits to bondholders and to raise, under the
automatic route (without the prior approval of the RBI), ECBs up to 50%of our Owned Fund. In the event of such benefits
being withdrawn by the Government or our inability to retain the IFC status granted to us, our business, results of
operations and financial results shall be adversely effected.
2. Mismatchinthetenorof ourleasesandborrowingsmayleadtoreinvestment andliquidityriskwhichmayadverselyimpact
our financial condition and results of operations: Majority of our revenues are derived fromthe lease agreements with
the MoR. These agreements currently provide for a primary lease period of 15 years, followed by a secondary lease
period of another 15 years. We recover the full amount of principal borrowed and related interest within the primary
lease period. Repayments occur by installments during the primary lease period. Although no mismatch between our
assets and liabilities occurs on a regular basis, bullet repayment of some borrowings in certain years may give rise to
a temporary mismatch. This may potentially give rise to a liquidity risk when we are required to refinance our loans and
other borrowings. The receipt of lease rentals in an amortised fashion by the Company may lead to reinvestment risk
in a falling interest rate scenario. If we are unable to refinance our borrowings on favourable terms or reinvest lease
rentals on favourable terms, it could adversely affect our business, financial condition and results of operations.
3. Any changeintheclausesof thestandardleaseagreement enteredintobyuswiththeMoRcanhaveanadverseeffect on
our business, financial position and result of operations.:Astandardleaseagreement isenteredintobyuswiththeMoR
on an annual basis in respect of rolling stock delivered and leased by us to the MoR during the Fiscal Year ending 31
March immediately preceding the date of the standard lease agreement. Under the terms of previous standard lease
agreements, the MoR had agreed with the Company to ensure that in the event the Company is unable to redeem
the bonds on maturity and/or repay its loans due to inadequate cash flows, the MoR will make good such shortfall by
making advance payments in respect of the lease rentals. If such assurance/ undertaking ceases to be valid or the MoR
fails to comply with performance of such undertaking or such undertaking is amended or modified or altered or the
Company waives compliance with any provision of such undertaking, it may result in an event of default entitling the
acceleration of repayment under the various bonds issued by our Company and our Company will not have any direct
right of action or right of subrogation against the MoR. Also, it may happen that such assurance/ undertaking is not
provided in the subsequent lease agreement(s). Extraordinary support by the MoR in the form of early payment of lease
rentals to meet temporary cash-flow difficulties requires parliamentary approval which might be difficult to obtain.
Further, certain other risks such as those arising out of foreign exchange rate fluctuations and interest rate fluctuation
are passed on to the MoR under the standard lease agreement. However, no assurance can be given that the MoR
will continue to bear such risks under subsequent lease agreements and in the event the MoR declines to bear such
risks, it could adversely affect our financial conditions and results of operations.
4. ThestandardleaseagreementisexecutedaftertheendoftheFiscal Yeartowhichitrelatesandwecannotgiveanassurance
thatsuchanagreement willbeentered intowithrespect totherollingstock acquiredwiththeproceeds of this Issueorthat
thestandardleaseagreementwill containthetermsandconditionsnecessarytoenableustomeetourobligationsunderthis
Issue.: Standard lease agreements govern the lease rentals payable by the MoR to us and specify the rolling stock leased
to the MoR by us. The standard lease agreement applies to each unit of rolling stock on and with effect from the first
day of the month in which the relevant rolling stock is delivered into service by the Indian Railways. The lease rentals
are calculated as equal half yearly payments to be made by the MoR based on weighted average cost of incremental
borrowing during the relevant year together with a reasonable markup mutually agreed between the MoR and the
Company, so as to ensure that our obligation to repay and settle our debts are fully met during primary lease period
of 15 years. The standard lease agreement is executed after the end of the financial year but comes into effect from
the date of commencement of that year. Lease rentals during any particular year are calculated using the cost of
borrowing and margin relevant to the previous year. We expect that a standard lease agreement will be entered into
based on our previous dealings with the MoR. While the standard lease agreement is expected to be executed, we
are not in a position to give an assurance that such an agreement will be entered into with respect to the rolling stock
acquired with the proceeds of this Issue or that the standard lease agreement will contain the terms and conditions
necessary to enable us to meet our obligations under this Issue. Further, by its letter dated March 16, 2011, the MoR
informed us that the Railway budget for year 2011-12 envisages the Company to also raise funds for capacity
enhancement works in the Indian railway sector like gauge conversion, electrification, doubling, traffic facilities and
signalling and traffic works. Therefore, we intend to utilize a significant portion of the funds raised in the Issue in
diversifying into financing the aforesaid capacity enhancement works in the Indian railway sector and entering into lease
agreements for usage of such facilities by the MoR. The Company will follow the same leasing methodology as it
presently follows with MoR in relation to the financing of rolling stock. Though we expect that a lease agreement will
be entered into based on the same leasing methodology as our previous dealings with the MoR, we have not entered
into such an agreement for the capacity enhancement works with the MoR previously. Accordingly, we cannot give an
assurance that such an agreement will be entered into with respect to the capacity enhancement works to be financed
from the proceeds of this Issue or that the lease agreement, if entered, will contain the terms and conditions necessary
to enable us to meet our obligations under this Issue.
5. Weareinvolvedinanumber of legal proceedings that,ifdeterminedagainstus, could adverselyimpact ourbusiness
and financial condition. : Our Company is a party to various legal proceedings. These legal proceedings are pending
at different levels of adjudication before various courts, tribunals, statutory and regulatory authorities/ other judicial
authorities, and if determined against our Company, could have an adverse impact on the business, financial
condition and results of operations of our Company. For further information relating to outstanding litigation against
our Company, see the section titled Outstanding Litigation and Material Developments on page 93 of the Shelf
Prospectus. No assurances can be given as to whether these legal proceedings will be decided in our Companys
favor or have no adverse outcome, nor can any assurance be given that no further liability will arise out of these claims.
Details of the proceeding that have been initiated against and by our Company and the amounts claimed against
and by us in these proceedings, to the extent ascertainable as of the date of the Shelf Prospectus, are set forth below;
Litigationagainstour Company: Natureof Proceedings,Number of outstanding matters,Amount Involved(in`lakhs)*,
Writ Petitions, Nil, Nil, Income Tax, Nil, Nil; Consumer Cases, 12, 9.74; Civil, 5, 39.97; Criminal, Nil, Nil; Total, 17,
43.81, * The amounts stated do not include the interest claimed or payable. Litigation by our Company: Nature of
Proceedings, Number of outstandingmatters, Amount Involved (in `lakhs)*Writ Petitions,Nil, Nil; IncomeTax,4, 14.05;
Civil, Nil, Nil; Criminal, 1, 5.90; Total, 5, 19.95 *The amounts stated do not include the interest claimed or payable.
6. OurCompanyiswhollyownedandcontrolledbytheGovernmentandtheGovernmentcouldrequireustotakeactionsaimed
atservingthepublicinterestwhichmaynot necessarilybeprofitableorfinanciallyfeasible.TheGovernmentthroughthePresident
of India along with 7 nominee shareholders holds 100 per cent of our paid up equity share capital. The Government, acting
through the MoR, controls our Company and has the power to appoint and remove our Directors on the Board and/ or the
committees thereof. In addition, the Government influences our operations through our various departments and policies.
Pursuant to our Articles of Association, the President of India may from time to time issue such directives or instructions as
may be considered necessary in regard to the conduct of business and affairs of the Company and in like manner may vary
and annul any such directive or instruction. In particular, given the important role of the Indian railway sector in the Indian
economy, the Government could require us to take actions aimed at serving the public interest which may not necessarily
be profitable or financially feasible. The Governments objectives may not be consistent with our objectives or those of the
investors.
7. OurbusinessandourindustryaredependentonthepoliciesandsupportoftheIndianGovernmentandtheMoRandthecontinued
growthoftheIndianrailwaysector,whichmakesussusceptibletochangestosuchpoliciesandaslowdowninthegrowthofIndian
railways.: We are a Government enterprise operating in a sensitive and regulated industry. Our business is dependent, directly
and indirectly, on the policies and support of the Government, in many significant ways, including with respect to the cost
of our capital, the financial strength of the MoR, the management and growth of our business and our overall profitability.
The MoR is also significantly impacted by the policies and support of the Government. Furthermore, the growth of our
business is dependent upon the continued growth of the Indian railway sector and the Indian economy, which are significantly
impacted by the policies of the Government. The Indian Railways faces significant competition in transportation from other
means of transportation such as transport by road, sea and air. While the Indian railways is planning infrastructure
augmentation and other necessary improvements to the railway network, competition in freight traffic from the road sector
is likely to intensify further, after the present projects for upgrading road networks are completed. For many decades, the Indian
railways share of the freight market had been progressively decreasing. The Indian railways vulnerability to competition from
other means of transportation could increase if cross-subsidies between freight and passenger fares remain at the current
high levels, particularly when the road network improves, and oil pipelines are built. Therefore any slowdown in the growth
of the Indian railways sector and changes in the policies of, or in the level of direct or indirect support to us provided by, the
Government in these or other areas could have a material adverse effect on our business, financial condition and results
of operations.
8. Wefacecompetitionfromfinancialandotherinstitutionsinraisingfundsfromthemarket andmaynotbeabletoraisefunds
on terms beneficial to us.: We face competition from financial and other institutions aiming to raise funds from the market.
In the event that the terms and conditions of the debt instruments offered by such institutions is more attractive than those
offered by us, we may not be able to raise debt from the market to the extent and on terms and conditions beneficial to us.
9. Thecompositionof theCompanysAudit CommitteeandtheRemunerationCommitteeis not compliantwith the
corporategovernanceguidelinesissuedbytheDepartment ofPublicEnterprises.Asperthecorporategovernanceguidelines
issued by the Department of Public Enterprises, two-thirds of the members of the Audit Committee of the Company
are required to be independent directors and all the members of the Remuneration Committee of the Company are
required to be independent directors or nominee directors. In October 2011, due to completion of tenure of two
independent directors of the Company, they ceased to be the Directors on the board of the Company. As a result, the
Audit Committee which previously comprised of two independent directors and the Managing Director, now comprises
only of the Managing Director. Further, before the corporate governance guidelines were issued by the Department
of Public Enterprises, the Board had constituted a Remuneration Committee on January 30, 2009, which comprised
of three Independent Directors and the Managing Director. The Company has not reconstituted the Remuneration
Committee after the issuance of the aforesaid guidelines. The Remuneration Committee would be reconstituted after
the appointment of the new Independent Directors. The Independent Directors on the board of the Company are
appointed by the Ministry of Railways for which the Company has already put in a request by its letter dated January
7, 2011.
10. Wearesubjecttorestrictivecovenantsunderourcredit facilitiesthat couldlimitour flexibilityinmanagingourbusiness.
: There are restrictive covenants in the agreements we have entered into with certain banks and financial institutions
in relation to our borrowings and the consents received from our lenders in relation to the Issue. These restrictive
covenants require us to maintain certain financial ratios, obtaining insurance for our assets and seek the prior permission
of these banks/financial institutions for various activities, including, amongst others, selling, leasing, transferring or
otherwise disposing of any part of our assets, effecting any scheme of amalgamation or reconstitution, implementing
a new scheme of expansion or taking up an allied line of business etc. Further certain of such agreements contain cross
default provisions as per which we may be held to be in breach of such agreements if we breach the terms of other loan
agreements. Further certain of our lenders have the right to recall the loans advanced at anytime at their discretion. We
cannot assure that we will be able to comply with all such conditions at all times. Accordingly, such restrictive covenants
in our loan and bond documents may restrict our operations or ability to expand and thereby may adversely affect our
business.
11. Oursuccessisdependent uponourmanagementteamandour ability toattract and retainskilledpersonnel.: Wehave
a management structure comprising 19 employees as on November 30, 2011. Besides the Managing Director, Director
Finance and officers in the executive rank comprise of 3 general managers, 1 manager and 1 assistant manager. Our
future performance will be dependent on the continued service of our management team and our ability to attract and
retain skilled personnel, as we rely on their experience and their ability to identify risks and opportunities in our business,
and grow our business activities. Considering the small size of our management team, our ability to identify, recruit and
retain our employees is critical. We do not maintain any key man insurance policy. Inability to attract and retain
appropriate managerial personnel, or the loss of key personnel could adversely affect our business, prospects, results
of operations, financial condition.
12. Wedonot ownourregisteredofficepremisesandconsequentlydonothavetitletothepremisesatpresent.:Wehaveentered
into agreements to sale dated April 11, 2002 and November 21, 2002 in respect of the premises where our registered
office is located, pursuant to terms of agreements to sale we took possession of our registered office. However, execution
of the sale deed in respect such premises is pending and is subject to the permission of the government. Accordingly,
wepresentlydonot holdtitletosuchpremises. 13. Wemayfail to obtain certainregulatory approvalsintheordinary course
of our businessinatimelymanner or atall,orto complywiththetermsandconditionsof our existingregulatoryapprovals
andlicenseswhichmayhaveamaterialadverseeffectonthecontinuityofourbusinessandmayimpedeoureffectiveoperations
in the future. We require certain regulatory approvals, sanctions, licenses, registrations and permissions for operating
and expanding our business. We may not receive or be able to renew such approvals in the time frames anticipated
by us, or at all, which could adversely affect our business. If we do not receive, renew or maintain the regulatory approvals
required to operate our business it may have a material adverse effect on the continuity of our business and may impede
our effective operations in the future. In addition to the numerous conditions required for the registration as a NBFC
with the RBI, we are required to maintain certain statutory and regulatory approvals for our business. In the future, we
will be required to obtain new approvals for any proposed operations. There can be no assurance that the relevant
authorities will issue any of such approvals in the time-frame anticipated by us or at all. Failure by us to obtain the required
approvals may result in the interruption of our operations and may have a material adverse effect on our business,
financial condition and results of operations. There may be future changes in the regulatory systemor in the enforcement
of the laws and regulations including policies or regulations or legal interpretations of existing regulations, relating to
or affecting interest rates, taxation, inflation or exchange controls, that could have an adverse effect on non-deposit
taking NBFCs. In addition, we are required to make various filings with the RBI, the RoC and other relevant authorities
pursuant to the provisions of RBI regulations, Companies Act and other regulations. If we fail to comply with these
requirements, or a regulator claims we have not complied with such requirements, we may be subject to penalties.
Moreover, these laws and regulations can be amended, supplemented or changed at any time such that we may be
required to restructure our activities and incur additional expenses in complying with such laws and regulations, which
could materially and adversely affect our business. In addition, any historical or future failure to comply with the terms
and conditions of our existing regulatory or statutory approvals may cause us to lose or become unable to renew such
approvals. For further details, see section titled Regulations and Policies on page 65 of the Shelf Prospectus.
14. OurCompanydoes nothavearegisteredtrademarkforourlogo andourabilitytousethetrademark andlogomay
be impaired. : Our Company does not have its logo , registered under the Trademarks Act, 1999, as amended.
In the event that the Companys logo either infringe the intellectual property rights of another person or the logo is used
or claimed by a third party, our Companys ability to use such logo may be restricted or lost.
15. Ifweareunabletomanageourgrowtheffectively,ourbusinessandfinancialresultscouldbeadverselyaffected.:Ourbusiness
has grown since we began operations in 1986. Our total assets increased from ` 26,22,597.02 lakhs as of March 31,
2007 to ` 53,60,651.62 lakhs as of September 30, 2011.We intend to continue to grow our business, which could place
significant demands on our financial and other internal risk controls. It may also exert pressure on the adequacy of our
capitalization, making management of asset quality increasingly important. Our asset growth will be primarily funded
by the issuance of new debt. We may have difficulty in obtaining funding on attractive terms. Adverse developments
in the Indian credit markets, such as the recent increase in interest rates, may significantly increase our debt service costs
and the overall cost of our funds. Any inability to manage our growth effectively on favorable terms could have a material
adverse effect on our business and financial performance.
16. Theproposed adoptionof IFRScouldresultinour financial conditionandresultsof operationsappearingmaterially
different than under Indian GAAP. : We may berequired to prepare annual and interimfinancial statements under IFRS
in accordance with the roadmap for the adoption of, and convergence with, IFRS announced by the Ministry of
Corporate Affairs, Government in January, 2010. The convergence of certain Indian Accounting Standards with IFRS
was notified by the Ministry of Corporate Affairs on February 25, 2011. The date of implementing such converged Indian
accounting standards has not yet been determined, and will be notified by the Ministry of Corporate Affairs in due course
after various tax-related and other issues are resolved. Our financial condition, results of operations, cash flows or
changes in shareholders equity may appear materially different under IFRS than under Indian GAAP. This may have
a material adverse effect on the amount of income recognized during that period and in the corresponding period in
the comparative period. In addition, in our transition to IFRS reporting, we may encounter difficulties in the ongoing
process of implementing and enhancing our management information systems. Moreover, our transition may be
hampered by increasing competition and increased costs for the relatively small number of IFRS-experienced accounting
personnel available as more Indian companies begin to prepare IFRS financial statements.
17. FortheFinancial Yearscommencingonor after April 1,2011,theCompanyisrequired to prepareitsannual financial
statementsasperrevisedScheduleVItotheCompaniesAct,asnotifiedbytheMinistryofCorporateAffairs,asaresultofwhich
our financial ratios may appear materially different.: The revisedSchedule VI of theCompanies Act deals withthe form
of balance sheet, profit and loss account and disclosures to be made therein and will lead to realignment of items
appearing in the balance sheet and profit and loss statement. Thus our financial ratios may appear materially different
under the revised Schedule VI than as under the existing format being followed by us.
RISKS RELATING TO THE INDIANECONOMY: We are an Indian company and all of our assets and customers are
located in India. Consequently, our financial performance will be influenced by political, social and economic
developments in India and in particular by the policies of the Government.
18. Aslowdown in economic growth in Indiacould adversely impact our business.: Wearedependent onprevailing
economic conditions in India and our results of operations are significantly affected by factors influencing the Indian
economy. Any slowdown in economic growth in India could adversely affect us, including our ability to grow our loan
portfolio, the quality of our assets, and our ability to implement our strategy. Any slowdown in the growth or negative
growth of the Indian railways sectors where we have a high exposure could adversely impact our performance. Any such
slowdown could adversely affect our business, prospects, results of operations and financial condition.
19. Financial instability in other countriesmaycauseincreasedvolatility in Indianfinancial markets.: TheIndianmarketand
the Indian economy are influenced by global economic and market conditions. Financial turmoil in Asia and elsewhere
in the world in recent years has affected the Indian economy. Although economic conditions are different in each country,
investors reactions to developments in one country can have adverse effects on the securities of companies in other
countries, including India. A loss of investor confidence in the financial systems of other markets may cause increased
volatility in Indian financial markets and, indirectly, in the Indian economy in general. The global credit and equity
markets have recently experienced substantial dislocations, liquidity disruptions and market corrections. In particular,
sub-prime mortgage loans in the United States have experienced increased rates of delinquency, foreclosure and loss.
Since September 2008, liquidity and credit concerns and volatility in the global credit and financial markets increased
significantly with the bankruptcy or acquisition of, and government assistance extended to, several major U.S. and
European financial institutions. These and other related events have had a significant impact on the global credit and
financial markets as a whole, including reduced liquidity, greater volatility, widening of credit spreads and a lack of price
transparency in the United States and global credit and financial markets. In response to such developments, legislators
and financial regulators in the United States and other jurisdictions, including India, have implemented a number of
policy measures designed to add stability to the financial markets. However, the overall impact of these and other
legislative and regulatory efforts on the global financial markets is uncertain, and they may not have the intended
stabilising effects. In the event that the current difficult conditions in the global credit markets continue or if there are
any significant financial disruption, this could have an adverse effect on the Companys business, our future financial
performance and the price of the Bonds.
20. NaturalcalamitiescouldhaveanegativeimpactontheIndianeconomywhichcouldadverselyaffectourbusiness,ourfuture
financial performanceand thepriceof theBonds.: Natural calamitiescouldhaveanegativeimpact ontheIndianeconomy
and harm our business. India has experienced natural calamities such as earthquakes, floods, drought and a tsunami
in recent years, including the tsunami that struck the southern coast of India and other Asian countries in December
2004, the severe flooding in Mumbai in July 2005 and the earthquake that struck India and other Asian countries in
October 2005. Natural calamites could have an adverse impact on the Indian economy which could adversely affect
our business, our future financial performance and the price of the Bonds.
21. Anydown-gradingofIndiasdebtratingbyaninternationalratingagencycouldhaveanegativeimpact onourbusiness
and the trading price of the Bonds.: Any adverse revisions to Indias credit ratings for domestic and international debt
by international rating agencies may adversely affect the terms on which the Company is able to raise finance, our future
financial performance and the price of the Bonds.
22. Investorsmay havedifficultyenforcingforeign judgmentsinIndiaagainst theCompanyor ourmanagement.: Weare
a public limited company incorporated under the laws of India. All of the Companys Directors and executive officers
are residents of India and all the assets of the Company and such persons are located in India. As a result, it may not
be possible for investors to effect service of process on the Company or such persons in jurisdictions outside of India,
or to enforce against them judgments obtained in courts outside of India. In addition, India is not a party to any
international treaty in relation to the recognition or enforcement of foreign judgments. Recognition and enforcement
of foreign judgments is provided for under section 13 and section 44A of the Code of Civil Procedure, 1908 of India
(Civil Code). Section 44A of the Civil Code provides that where a foreign judgment has been rendered by a superior
court in any country or territory outside India which the Indian Government has by notification declared to be a
reciprocating territory, it may be enforced in India by proceedings in execution as if the judgment had been rendered
by the relevant court in India. However, section 44A of the Civil Code is applicable only to monetary decrees not being
in the nature of any amounts payable in respect of taxes or other charges of a like nature or in respect of a fine or other
penalty and is not applicable to arbitration awards, even if such awards are enforceable as a decree or judgment. The
United States has not been declared by the Indian Government to be a reciprocating territory for the purposes of section
44A of the Civil Code. However, the United Kingdom has been declared by the Indian Government to be a reciprocating
territory and the High Courts in England as the relevant superior courts. Accordingly, a judgment of a court in the United
States may be enforced only by a fresh suit upon the judgment and not by proceedings in execution whereas, a
judgment of a superior court in the United Kingdom may be enforceable by proceedings in execution, and a judgment
not of a superior court, by a fresh suit resulting in judgment or order. A judgment of a court in a jurisdiction which is not
a reciprocating territory may be enforced only by a new suit upon the judgment and not by proceedings in execution.
Section 13 of the Civil Code provides that a foreign judgment shall be conclusive as to any matter thereby directly
adjudicated upon except: (i) where it has not been pronounced by a court of competent jurisdiction; (ii) where it has
not been given on the merits of the case; (iii) where it appears on the face of the proceedings to be founded on an
incorrect view of international law or a refusal to recognise the law of India in cases where such law is applicable; (iv)
where the proceedings in which the judgment was obtained were opposed to natural justice; (v) where it has been
obtained by fraud; or (vi) where it sustains a claim founded on a breach of any law in force in India. The suit must be
brought in India within three years from the date of the judgment in the same manner as any other suit filed to enforce
a civil liability in India. It is unlikely that a court in India would award damages on the same basis as a foreign court
if an action is brought in India. Furthermore, it is unlikely that an Indian court would enforce a foreign judgment if it
viewed the amount of damages awarded as excessive or inconsistent with Indian practice and it is uncertain whether
an Indian court would enforce foreign judgments that would contravene or violate Indian law. A party seeking to enforce
a foreign judgment in India is required to obtain approval from the RBI under the Foreign Exchange Management
Act, 1999 to execute such a judgment to repatriate outside India any amount recovered pursuant to execution. Any
judgment in a foreign currency would be converted into Indian Rupees on the date of the judgment and not on the
date of the payment. The Company cannot predict whether a suit brought in an Indian court will be disposed of in a
timely manner or be subject to considerable delays.
23. TheremaybelessinformationavailableintheIndiansecurities markets pertaining toour Company as comparedto
informationavailablefor companies insecurities market of moredevelopedcountries.:Thereisadifferencebetweenthe
level of regulation, disclosure and monitoring of the Indian securities market and the activities of investors, brokers and
other participants and that of markets in the United States and other more developed economies. SEBI is responsible
for ensuring and improving disclosure and other regulatory standards for the Indian securities markets. SEBI has issued
regulations and guidelines on disclosure requirements and other matters. There may, however, be less publicly
available information about Indian companies than is regularly made available by public companies in more
developed economies. As a result investors may have access to less information about the business, results of
operations and financial conditions of the Company, and those of the competitors that are listed on the BSE Limited
and the National Stock Exchange of India Limited and other stock exchanges in India on an on-going basis than an
investor may find in the case of companies subject to reporting requirements of other more developed countries. There
is a lower level of regulation and monitoring of the Indian securities market and the activities of investors, brokers and
other participants than in certain organisations for economic cooperation and development (OECD) countries. SEBI
received statutory powers in 1992 to assist it in carrying out our responsibilities for improving disclosure and other
regulatory standards for the Indian securities market. Subsequently, SEBI has prescribed certain regulations and
guidelines in relation to disclosure requirements and other matters relevant to the Indian securities markets. However,
there may still be less publicly available information about Indian companies than is regularly made available by public
companies in certain OECD countries.
24. Theproposed newtaxation system couldadverselyaffect ourbusinessandthepriceof thebonds.: TheGovernment
proposes to introduce two major reforms in Indian tax laws, namely the Goods and Services Tax and the Direct Taxes
Code, both of which are currently proposed to be effective from 1 April, 2012. The Goods and Services Tax would replace
the indirect taxes on good and services such as central excise duty, service tax, customs duty, central sales tax, surcharge
and cess currently being collected by the central and state governments. The Government has tabled a Direct Taxes
Code Bill in the Parliament but is yet to be passed. The proposed DTC aims to reduce distortions in tax structure,
introduce moderate levels of taxation and expand the tax base. It appears to consolidate and amend laws relating to
all direct taxes such as income tax, dividend distribution tax, fringe benefit tax and wealth tax and to facilitate voluntary
compliance. Since the taxation system is likely to be overhauled, our long-term effects on the Company and other
NBFCs are unclear as at the date of the Shelf Prospectus and it could adversely affect our business, financial condition
and results of operations and the price of the notes.
25. TheBondsareclassified astaxfreebonds eligiblefortaxbenefitsunder Section10(15)(iv)(h)of theIncomeTaxAct,up
to an amount of interest on such bonds. : The Bonds are classified as tax free bonds issued in terms of Section
10(15)(iv)(h)of the Income Tax Act and the notification dated September 23, 2011, issued by the CBDT. In accordance
with the said section, the amount of interest on such bonds shall be entitled to exemption under the provisions of Income
Tax Act. Therefore only the amount of interest on bonds is exempt and not the actual amount of investment.
26. Political instabilityorchangesinthegovernment coulddelaytheliberalizationoftheIndianeconomyandadverselyaffect
economic conditions in Indiagenerally, which couldimpact our financial resultsandprospects.:Weareincorporatedin
India, derive our revenues from operations in India and all our assets are located in India. Consequently, our
performance may be affected by interest rates, government policies, taxation, social and ethnic instability and other
political and economic developments affecting India. The Government has traditionally exercised and continues to
exercise significant influence over many aspects of the Indian economy. Our business may be affected by changes in
the Governments policies, including taxation. Since 1991, successive Indian governments have pursued policies of
economic liberalization, including significantly relaxing restrictions on the private sector. However, there can be no
assurance that such policies will be continued and any significant change in the Governments policies in the future
could affect our business and economic conditions in India in general. In addition, any political instability in India or
geo-political instability affecting India will adversely affect the Indian economy in general, which could affect our
business. Although, the current government has announced policies and taken initiatives that support the economic
liberalization policies, the rate of economic liberalization could change, and specific laws and policies affecting
banking and finance companies, foreign investment and other matters affecting investment in our securities could
change as well. Any major change in government policies might affect the growth of Indian economy and thereby
negatively impact our growth prospects.
27. Difficulties facedbyotherfinancial institutionsortheIndianfinancialsectorgenerallycouldcauseourbusinesstosuffer.:
We are exposed to the risks consequent to being part of the Indian financial sector. This sector in turn may be affected
by financial difficulties and other problems faced by Indian financial institutions. Certain Indian financial institutions
have experienced difficulties during recent years. Any major difficulty or instability experienced by the Indian financial
sector could create adverse market perception, which in turn could adversely affect our business andfinancial performance.
28.OurbusinessandactivitieswillberegulatedbytheCompetitionAct,2002(CompetitionAct)andanyapplicationof the
Competition Act touscouldhaveamaterial adverseeffect onour business,financial condition and resultsof operations.:
The Competition Act is designed to prevent business practices that have an appreciable adverse effect on competition
in India. Under the Competition Act, any arrangement, understanding or action in concert between enterprises,
whether formal or informal, which causes or is likely to cause an appreciable adverse effect on competition in India
is void and attracts substantial monetary penalties. Any agreement which directly or indirectly determines purchase or
sale prices, limits or controls production, shares the market by way of geographical area, market or number of customers
in the market is presumed to have an appreciable adverse effect on competition. Further, if it is proved that the
contravention committed by a company took place with the consent or connivance or is attributable to any neglect on
the part of, any director, manager, secretary or other officer of such company, that person shall be guilty of the
contravention and liable to be punished. For more information, see section titled Regulations and Policies on page
65 of the Shelf Prospectus. The effect of the Competition Act on the business environment in India is unclear. If we
are affected, directly or indirectly, by any provision of the Competition Act, or its application or interpretation, including
any enforcement proceedings initiated by the Competition Commission and any adverse publicity that may be
generated due to scrutiny or prosecution by the Competition Commission, it may have a material adverse effect on
our business, financial condition and results of operations.
29. Terrorist attacks,civil unrestandotheractsofviolenceorwarinvolvingIndiaandothercountriescouldadverselyaffect the
financial markets and our business.: India has fromtime to time experienced social and civil unrest and hostilities within
itself and with neighbouring countries. India has also experienced terrorist attacks in some parts of the country. These
hostilities and tensions and/or the occurrence of terrorist attacks have the potential to cause political or economic
instability in India and adversely affect our business and future financial performance. Further, India has also experienced
social unrest in some parts of the country. If such tensions occur in other parts of the country, leading to overall political
and economic instability, it could have an adverse effect on our business, prospects, results of operations and financial
condition. These acts may also result in a loss of business confidence, make travel and other services more difficult and
ultimately adversely affect our business.
30. Ourabilitytoraiseforeigncurrency borrowings maybeconstrained by Indianlaw.: AsanIndiancompany, wearesubject
to exchange controls that regulate borrowing in foreign currencies. Such regulatory restrictions limit our financing
sources and hence could constrain our ability to obtain financing on competitive terms and refinance existing indebtedness.
In addition, we cannot assure you that the required approvals will be granted to us without onerous conditions, if at
all. Limitations on raising foreign debt may have an adverse effect on our business, financial condition and results of
operations.
RISKSRELATINGTOTHEBONDS:31. Therehasbeen nopriorpublicmarket fortheBondsandthesamemaynot develop
in future, therefore thepriceof theBonds may bevolatile. TheBondshavenoestablishedtradingmarket. Therecanbe
no assurance that an active public market for the Bonds will develop or be sustained. The liquidity and market prices
of the Bonds can be expected to vary with changes in market and economic conditions, our financial condition and
prospects and other factors that generally influence market price of Bonds. Accordingly, the Bonds, may trade at a
discount to the price at which the Bonds are being issued.
32. Thereisnoguaranteethat theBondsissued pursuant tothisIssuewill belisted on NSEandBSEin atimelymanner,
or at all. : In accordance with Indian law and practice, permissions for listing and trading of the Bonds issued pursuant
to this Issue will not be granted until after the Bonds have been issued and allotted. Approval for listing and trading
will require all relevant documents authorising the issuing of Bonds to be submitted. There could be a failure or delay
in listing the Bonds on the NSE and/ or BSE.
33. Foreigninvestors,includingNRIsandFIIs subscribing totheBonds aresubject torisksinconnectionwith(i)exchange
control regulations, and, (ii)fluctuations in foreign exchangerates.: TheBondswill bedenominatedinIndianrupeesand
the payment of interest and redemption amount shall be made in Indian rupees. Various statutory and regulatory
requirements and restrictions apply in connection with the Bonds held by NRIs and FIIs (Exchange Control Regulations).
Amounts payable to NRIs and FIIs holding the Bonds, on redemption of the Bonds and/or the interest paid/payable
in connection with such Bonds would accordingly be subject to prevailing Exchange Control Regulations in case of
RISK FACTORS
IN THE NATURE OF FORM 2A - MEMORANDUM CONTAINING SALIENT FEATURES OF THE PROSPECTUS
8 INDIAN RAILWAY FINANCE CORPORATION LIMITED
applicants who have invested on repatriation basis. Any change in the Exchange Control Regulations may adversely
affect the ability of such NRIs and FIIs to convert such amounts into other currencies, in a timely manner or at all. Further,
fluctuations in the exchange rates between the Indian rupee and other currencies could adversely affect the amounts
realized by NRIs and FIIs on redemption or payment of interest on the Bonds by us.
34. Theremay beadelay in making refunds to applicants.: Wecannot assurethat themoniesrefundabletoapplicants,
on account of (a) withdrawal applications, (b) withdrawal of the Issue, or (c) failure to obtain the final approval from the
exchanges for listing of Bonds, (d) non allotment due to technical rejections or over subscriptions, will be refunded to
the applicants in a timely manner.
35. Risksrelatingtoanyinternational regulations,taxationrulesapplyastheIssuemaybemarketedtoFIIs.: TheBondshavenot
been recommended by any U.S. federal or state securities commission or regulatory authority. Furthermore, the foregoing
authorities have not confirmed the accuracy or determined the adequacy of the Shelf Prospectus. Any representation to
the contrary is a criminal offence in the United States and may be a criminal offence in other jurisdictions. The Bonds have
not been and will not be registered under the U.S. Securities Act of 1933, as amended (the U.S. Securities Act) or any
state securities laws in the United States and may not be offered or sold within the United States under the U.S. Securities
Act, except pursuant to an exemption from, or in a transaction not subject to, the registration requirements of the U.S.
Securities Act and applicable state securities laws in the United States. Further, any person making or intending to make
an offer within the European Economic Area of Bonds which are the subject of the Issue contemplated in the Shelf
Prospectus should only do so in circumstances in which no obligation arises for IRFC to produce a prospectus for such offer.
Additionally, our Bonds are quoted in Indian rupees in India and investors may be subject to potential losses arising out
GENERAL INFORMATION
Our Company was i ncorporated on December 12, 1986 under the Compani es Act as a publ ic li mi ted
company registered wi th the Regi strar of Compani es, National Capi tal Terri tory of Delhi and Haryana
and received our certificate for commencement of business on December 23, 1986. The GoI, Ministry of
Rail ways, incorporated our Company as a financial arm of Indi an Rail ways, for the purpose of rai si ng
the necessary resources for meeting the developmental needs of the Indian Railways. The President of
Indi a al ong wi th nomi nees i s hol di ng 100% of our equi ty share capi tal. For further detai ls see secti on
titled History and Certain Corporate Matter on page 70 of the Shelf Prospectus. The Ministry of Corporate
Affai rs, through its notification dated October 8, 1993 publ ished in the Official Gazette of India, classified
our Company, as a Publi c Fi nancial Institution under Section 4(A) of the Compani es Act. Our Company
was registered wi th the RBI under 45-IA of RBI Act as a Non-Banki ng Fi nance Company wi thout
accepting publ ic deposits vi de certi fi cate of regi strati on no. B-14.00013 dated February 16, 1998. The
Company was l ater classi fi ed under the category Infrastructure Finance Company by the RBI through
a fresh certifi cate of registration bearing no. B-14.00013 dated November 22, 2010. CBDT has vide i ts
Notifi cati on No. 52/2011 [F.No. 178/56/2011-(ITA 1)] dated September 23, 2011 authorised the Company
to raise tax free Bonds aggregating up to ` 10,00,000 lakhs i n one or more tranches in the Fiscal Year
2012, out of whi ch, the Company has already rai sed through private placement route, an amount of `
73,111 l akhs. The deemed date of al l ot ment was November 8, 2011 and the date of refund was
December 1, 2011. The li sti ng and tradi ng i n these bonds have commenced on NSE and BSE from
December 11, 2011 and December 8, 2011 respectively. Hence, the Company shall issue the Bonds upto
an aggregate amount of ` 6,30,000 lakhs through this Issue during the financial year 2011-12 out of the
total permi ssibl e amount of ` 10,00,000 l akhs, as approved by i ts Board through i ts resolution dated
January 10, 2012. Regist ered Office : UG Floor, East Tower, NBCC Pl ace, Pragati Vihar, Lodhi Road,
New Delhi -110 003. Tel.: +91 11 2436 9766/69. Fax: +91 11 2436 6710. Websi te: www.i rfc.nic.in. For
details on changes in our Registered Office, see History and Certain Corporate Matters on page 70 of the
Shel f Prospectus.
Credit Rating and Rationale
1. CRISIL has reaffi rmed the credit rating of CRISIL AAA/Stable (pronounced as CRISIL Triple A with
stable outlook) for ` 20,59,438 lakhs long term borrowing programme of the Company (Debt Programme)
vide its letter no. VR/FSR/IRFC/2011-12/1208 dated December 14, 2011. Instruments wi th this rating
are consi dered to have the hi ghest degree of safety regardi ng timely servicing of fi nanci al obl igati ons.
Such instruments carry lowest credit risk. 2. ICRA has reaffirmed the credi t rati ng assigned of [ICRA]
AAA (pronounced as ICRA triple A) for the Debt Programme of the Company vide its letter no. D/RAT/
2011-2012/11/13 dated December 19, 2011. Instruments with thi s rati ng are consi dered to have the
hi ghest degree of safety regardi ng ti mel y servi ci ng of fi nancial obl i gations. Such i nstruments carry
lowest credit ri sk. 3. CARE has reaffirmed the credi t rati ng of CARE AAA (pronounced as tripl e A) for
the Debt Programme of the Company vi de its letter dated December 14, 2011. Instruments wi th thi s
rating are considered to have the highest degree of safety regarding timely servicing of financial obligations.
Such instruments carry l owest credit risk. For detai ls i n relation to the rati onale for the credit rati ng by
CRISIL, ICRA and CARE, see Annexure II of the Shelf Prospectus. Further, kindly note these ratings are
not a recommendation to buy, sell or hold securi ties and investors should take their own decision. These
ratings are subject to revisi on or withdrawal at any ti me by the assigning rating agency (ies) and should
be eval uated i ndependentl y of any other rati ngs.
Expert Opini on: Except the letters dated December 14, 2011, December 19, 2011 and December 14,
2011 i ssued by CRISIL, ICRA and CARE respecti vel y, i n respect of the credi t rati ng for the Debt
Programme (bonds and long term loans) of the Company, and the report dated January 9, 2012 on our
audi ted fi nanci al statements for the fi nancial year ending March 31, 2007, March 31, 2008, March 31,
2009, March 31, 2010, March 31, 2011 and for the half year ended September 30, 2011 and statement
of tax benefi ts dated January 9, 2012 i ssued by Dhawan & Co., Chartered Accountants, Statutory
Auditors of the Company, the Company has not obtained any expert opini on.
Minimum Subscription: In terms of the SEBI Debt Regulations, an issuer undertaki ng a public i ssue of
debt securities may di sclose the mini mum amount of subscription that it proposes to rai se through the
issue in the offer document. The Company has deci ded not to sti pul ate mi ni mum subscri ption amount
for this Issue.
Underwriting
This Issue i s not underwri tten.
ISSUE PROGRAMME*
ISSUE OPENS ON FRIDAY, JANUARY 27, 2012
ISSUE CLOSES ON FRIDAY, FEBRUARY 10, 2012
*The subscri pti on l i st f or the Issue shal l r emai n open for subscr i pti on at the commencement of
banki ng hours and close at the close of banki ng hours, with an option for early cl osure (subj ect to the
Issue being open for a minimum of 3 days) or extension by such period, upto a peri od of 30 days from
the date of openi ng of the Issue, as may be deci ded by the Board of Di rectors/ Commi ttee of the
Company, subj ect to necessary approval s, if any. In the event of such earl y closure of the subscri pti on
l ist of the Issue, our Company shal l ensure that publi c notice of such earl y cl osure i s publ i shed on
or before the day of such earl y date of cl osure through adverti sement/s i n a l eadi ng nati onal dai l y
newspaper.
CAPITAL STRUCTURE
Details of Share Capital
Our share capi tal as on the date of the Shel f Prospectus i s set forth bel ow:
(in ` lakhs)
Aggregatevalue
Authorised share capital
50,000,000 Equi ty Shares of ` 1,000 each 500, 000. 00
Issued, subscribed and paid up share capital
16,020,000 Equi ty Shares of ` 1,000 each 160, 200. 00
Securities premium account Ni l
For further detai ls on Capi tal Structure pl ease refer to page no. 40 of the Shel f Prospectus.
OBJECTS OFTHE ISSUE
IssueProceeds
The Company shall issue Bonds upto an aggregate amount of ` 6,30,000 lakhs in one or more tranche(s),
on or prior to March 31, 2012 pursuant to CBDTs Notifi cation No. 52/2011 [F.No. 178/56/2011-(ITA 1)]
dated September 23, 2011 which authorised the Company to rai se tax free bonds aggregating up to `
10,00,000 lakhs in the fi nanci al year 2011-12. Out of the sai d ` 10,00,000 lakhs, the Company has
already raised through pri vate placement route, tax free bonds aggregating ` 73,111 l akhs.
Utilisation of Issue Proceeds
The funds rai sed through this Issue wi ll be util ized towards the foll owi ng purposes: 1. Fi nanci ng the
acquisiti on of rolli ng stock which wi ll be l eased to the MoR i n l ine with present busi ness activi ties; and
2. Financing the capacity enhancement works in the Indian Railways like gauge conversion, electrification,
doubli ng, traffi c facil ities and signalli ng and traffic works ( S&T Works ). For further details in rel ati on
to the aforesaid busi ness and associ ated risk, see sections titl ed Our Busi ness and Ri sk Fact ors
begi nning on page 55 and 9 respectivel y of the Shel f Prospectus. We shall uti li ze the Issue proceeds
only upon creation of security as stated in the Prospectus Tranche - 1 in the section titled Terms of the
Issue - Securit y and after permission or consent for creation of security pursuant to the terms of the
Debenture Trust Deed sought to be provi ded as security.
The main objects cl ause of our Memorandum of Associ ati on permi ts our Company to undertake i ts
existing activi ti es as well as the activi ti es for which the funds are being rai sed through this Issue.
Our Company is a public sector enterprise and, as such, we do not have any identifiable group companies
or companies under the same management. Further, in accordance with the SEBI Debt Regulati ons,
IRFC will not utilize the proceeds of the Issue for providing loans to or acquisition of shares of any person
who is part of the same group or who i s under the same management.
Interim useof Proceeds
The Board of Di rectors of the Company, i n accordance with the policies formulated by them from ti me
to time, wil l have fl exibility in depl oying the proceeds received from the Issue. Pendi ng utilization of the
proceeds out of the Issue for the purposes described above, the Company intends to temporari ly invest
funds i n high qual ity i nterest beari ng li qui d instruments i ncl udi ng money market mutual funds, deposi ts
wi th banks or temporari l y depl oy the funds i n i nvestment grade i nterest beari ng securi ties or inter
corporate loans as may be approved by the Board. Such investment woul d be i n accordance wi th the
i nvestment poli cies approved by the Board or any commi ttee thereof from ti me to ti me.
Monitoring of Utilization of Funds
In terms of the SEBI Debt Regulations, there is no requirement for appointment of a monitoring agency
in relation to the use of proceeds of the Issue. Our Board of Directors shall monitor the utili sation of the
proceeds of the Issue. Our Company wi ll disclose i n our financi al statements for the relevant fi scal
commencing from Fiscal 2012, the util isation of the proceeds of the Issue under a separate head along
with any detail s in rel ati on to al l such proceeds of the Issue that have not been util ized thereby also
indicating investments, if any, of such unuti lized proceeds of the Issue. We shall utili ze the proceeds of
the Issue onl y upon the executi on of the documents for creati on of securi ty as stated i n the Shel f
Prospectus in the section titled Terms of the Issue - Security on page 42 of Prospectus Tranche -1 and
upon the li sting of the Bonds. We propose to i ssue Bonds to NRIs on a non-repatri abl e as wel l as
repatriabl e basi s. Under the provi si ons of the Foreign Exchange Management (Borrowi ng and Lendi ng
in Rupees) Regul ati ons, 2000, as amended, any moni es borrowed from a person resident outsi de India
cannot be used: (a) for any purpose except i n ones own business other than (i) the business of chit fund,
(i i) as Nidhi Company, (iii ) agricultural or plantation activi ties or real estate business; or construction of
farm houses; or (iv) trading in Transferable Development Rights (TDRs); or (b) for any investment, whether
by way of capital or otherwise, in any company or partnership firm or proprietorship concern or any entity,
whether incorporated or not, or for the purpose of re-lending. To ensure compliance with the aforementioned,
the Company shall open and maintain a separate escrow account wi th the Escrow Collection Bank(s) in
connecti on with all appl icati on moni es received from NRIs, (NRI Escrow Account ). All appl ication
monies received from NRI appl icants shall be deposited in the NRI Escrow Account maintai ned with
each Escrow Coll ection Bank(s). Upon creation of securi ty as di sclosed i n the Shelf Prospectus, the
Escrow Collecti on Bank(s) shall transfer the monies from the NRI Escrow Accounts to a separate bank
account, (NRI Account), which shall be different from the Public Issue Account. The Company shal l at
all times ensure that any monies kept in the NRI Escrow Account and/or the NRI Account shall be utilised
only in accordance with and subject to the restrictions contained i n the Forei gn Exchange Management
(Borrowi ng and Lendi ng i n Rupee) Regul ations, 2000, and other appl icable statutory and/or regulatory
requi rements.
Issue Expenses* : For details please refer to page no. 23 of the Prospectus Tranche - 1.
Undertakings with respect to Issue Proceeds : The Company undertakes the following: 1. That in accordance
with the SEBI Debt Regulati ons, it will not utilize the issue proceeds for providing loans to or acquisi tion
of shares of any person who i s part of the same group or who i s under the same management; 2. Other
than as menti oned in the section titled Objects of the Issue, the Issue proceeds shall not be util ized
towards full or part consideration for the purchase or any acquisition, including by way of a lease, of any
property; and 3. The Issue Proceeds from Bonds allotted to Banks wil l not be uti li zed for any purpose
which may be i n contravention of the RBI guidelines on bank financing to NBFCs including those rel ating
to cl assifi cation as capi tal market exposure or any other sectors that are prohi bi ted under the RBI
regul ati ons.
STATEMENT OF TAX BENEFITS : For details please refer to page no. 25 of the Prospectus Tranche - 1.
INDUSTRY OVERVIEW : For detai ls please refer to page no. 48 of the Shelf Prospectus.
OUR BUSINESS : For details please refer to page no. 55 of the Shelf Prospectus.
REGULATIONS AND POLICIES : For detail s please refer to page no. 65 of the Shelf Prospectus.
HISTORY AND CERTAIN CORPORATE MATTERS : For details please refer to page no. 70 of the Shelf
Prospectus.
OUR MANAGEMENT : The foll owing are Directors on the Board of the Company Ms. Vijaya Kanth, Mr.
Rajiv Datt, Mr. D. C. Arya , Mr. Rajesh Khul lar. For detail s please refer to page no. 74 of the Shel f
Prospectus.
FINANCIAL INDEBTEDNESS
For detai ls of the outstandi ng borrowings of the Company as on November 30, 2011, see Financial
Indebtedness on page no. 79 of the Shelf Prospectus.
LEGAL AND OTHER INFORMATION
OUTSTANDING LITIGATION AND MATERIAL DEVELOPMENTS : Except as described below, there are
no outstandi ng liti gations, suits or crimi nal or civil prosecutions, proceedings or tax liabili ties against us
and our Directors, that would have a material adverse effect on our business and there are no defaults,
non-payment or overdue of statutory dues, i nstitutional / bank dues and dues payable to holders of any
debentures, bonds and fixed deposi ts that would have a material adverse effect on our business other
than unclai med li abil iti es against us, as of the date of the Shelf Prospectus. For detail s please refer to
page no. 93 of the Shel f Prospectus.
OTHER REGULATORY ANDSTATUTORY DISCLOSURES
Authority for the Issue : The Board of Directors, at their meeting held on January 10, 2012 have approved
the Issue, in one or more tranche(s), of tax free, secured, redeemable, non-convertible bonds in the nature
of debentures of face value of ` 1,000 each, having tax benefits under Section 10(15)(iv)(h) of the Income
Tax Act, as amended, aggregating upto ` 6,30,000 lakhs in one or more tranche(s), on or prior to March
31, 2012, subject to the provisions of the CBDT Notification. In accordance with the terms of the CBDT
Notification, the aggregate vol ume of the issue of Bonds (having benefits under Section 10(15)(iv)(h) of
the Income Tax Act) by the Company duri ng the Fiscal 2012 shall not exceed ` 10,00,000 lakhs.
Eligibility to make the Issue : The Company, the persons in control of the Company or its promoter have
not been restrained, prohibi ted or debarred by SEB1 from accessi ng the securi ties market or deali ng in
securi ties and no such order or di rection is in force.
Consents : Consents in writing from the Directors, the Compliance Officer, the Statutory Auditors, Bankers
to the Company, Bankers to the Issue, Lead Managers, Registrar to the Issue, Consortium Members for
the Issue, Legal Advi sors to the Issue, Credi t Rating Agencies and the Debenture Trustee, to act in their
respective capacities, have been obtained and shall be filed along with a copy of each tranche prospectus
wi th the RoC. The Company has appointed Indian Bank as Debenture Trustee under regulati on 4(4) of
the SEBI Debt Regul ati ons. The Debenture Trustee has gi ven i ts consent to the Company for i ts
appoi ntment under regul ation 4(4) and also in al l the subsequent peri odi cal communications sent to the
holders of debt securities.
Common Form of Transfer : There shall be a common form of transfer for the Bonds held in physical form
and relevant provi sions of the Companies Act and all other applicabl e laws shall be dul y compl ied with
in respect of all transfer of the Bonds and regi stration thereof.
No Reservation or Discount : There is no reservation in this Issue nor will any discount be offered in this
Issue, to any category of Investors.
Previous Public or Rights Issues by the Company during last five years : TheCompany hasnot undertaken
any publ ic or rights issue i n last five years.
Change in auditors of Our Company during the last three years : There has been no change in auditors of
our Company duri ng the last three years and M/s Dhawan& Co. have been our audi tors si nce Financi al
Year 2008-09.
Revaluation of assets : Our Company has not revalued its assets in the last five years.
Statement by the Board of Directors: (i) All monies received out of each Tranche Issue of the Bonds to the
publ ic shal l be transferred to a separate bank account other than the bank account referred to i n sub-
section (3) of section 73 of the Companies Act; (ii) Details of all monies utilised out of each Tranche Issue
referred to i n sub-item (i ) shal l be di sclosed under an appropriate separate head i n our bal ance sheet
indicating the purpose for which such monies were uti lised; and (ii i) Details of al l unuti lised moni es out
of the Tranche Issue referred to in sub-item (i), i f any, shall be disclosed under an appropriate separate
head i n our balance sheet indicating the form in whi ch such unutil ised monies have been i nvested. The
funds raised by us from previ ous bonds i ssues have been uti li sed for our busi ness as stated i n the
respective offer documents.
DISCLAIMERCLAUSEOF NSE &BSE: AS REQUIRED, A COPYOF THEDRAFT OFFERDOCUMENT HAS
BEEN SUBMITTEDTO NSE & BSE (THE STOCK EXCHANGES). NSE & BSE HAVE GIVENVIDE THEIR
LETTER REF.: NSE/LIST/157151-7 AND DCS/SP/PI-BOND/07/11-12, RESPECTIVELY BOTH DATED
JANUARY 19, 2012, PERMISSION TO THE ISSUER TO USE THE EXCHANGES NAME IN THIS OFFER
DOCUMENT AS ONE OF THE STOCK EXCHANGES ON WHICH THIS ISSUERS SECURITIES ARE
PROPOSED TO BE LISTED. THE EXCHANGES HAVE SCRUTINIZED THE DRAFT OFFER DOCUMENT
FOR THEIR LIMITED INTERNAL PURPOSE OF DECIDING ON THE MATTER OF GRANTING THE
AFORESAID PERMISSION TO THIS ISSUER. IT IS TO BE DISTINCTLY UNDERSTOOD THAT THE
AFORESAIDPERMISSIONGIVENBYTHE STOCK EXCHANGESSHOULDNOTINANY WAYBE DEEMED
ORCONSTRUEDTHAT THEOFFERDOCUMENT HAS BEENCLEAREDORAPPROVEDBYTHE STOCK
EXCHANGES; NORDOTHEY INANYMANNERWARRANT, CERTIFYORENDORSETHECORRECTNESS
ORCOMPLETENESSOF ANYOFTHECONTENTSOF THISOFFERDOCUMENT; NORDOTHEYWARRANT
THAT THIS ISSUERS SECURITIES WILL BE LISTED OR WILL CONTINUE TO BE LISTED ON THE
EXCHANGES; NOR DO THEY TAKE ANY RESPONSIBILITY FOR THE FINANCIAL OR OTHER
SOUNDNESSOF THISISSUER, ITSPROMOTERS, ITS MANAGEMENT ORANYSCHEMEOF PROJECT OF
THISISSUER. EVERYPERSONWHODESIRESTOAPPLYFOROROTHERWISEACQUIREANYSECURITIES
OF THIS ISSUERMAYDOSOPURSUANT TOINDEPENDENT INQUIRY, INVESTIGATIONANDANALYSIS
ANDSHALL NOTHAVE ANY CLAIMAGAINST THE EXCHANGES WHATSOEVER BYREASONOF ANY
LOSS WHICH MAY BE SUFFERED BY SUCH PERSON CONSEQUENT TO OR IN CONNECTION WITH
SUCHSUBSCRIPTION/ ACQUISITIONWHETHERBY REASONOF ANYTHINGSTATEDOROMITTEDTO
BE STATED HEREIN OR ANY OTHER REASONWHATSOEVER.
Li sting : The Bonds wi ll be listed on NSE and BSE. We have obtai ned in-princi ple approval from NSE
and BSE vi de t hei r l et t er no. NSE/ LI ST/ 157151-7 and l et t er no. DCS/ SP/PI -BOND/ 07/11-12
respectively, both dated January 19, 2012, for thi s Issue. If permi ssi on to deal i n and for an offi cial
quotati on of the Bonds i s not granted by NSE and or BSE, the Company wi l l for thwi th repay al l
moneys received from the Applicants in terms of the relevant tranche prospectus. If such money i s not
repaid within ei ght days after the Company becomes li abl e to repay it (i .e. from the date of refusal
or within seven days from the Tranche Issue Closi ng Date, whi chever is earli er), then the Company
and every Director of the Company who is an officer in defaul t shall, on and from such expiry of eight
days, be l i abl e to repay the money, wi th i nterest at the rate of 15% p.a. on appl i cati on money, as
prescri bed under Section 73 of the Compani es Act. The Company shall use best efforts to ensure that
al l steps for the compl eti on of the necessary formal iti es for l i sti ng at BSE and NSE wi l l be taken
wi thin fi fteen Worki ng Days from the date of Al l otment.
Di vi dend : The Company has consi stentl y pai d di vidend of 68.97 %, 20 %, 20 %, 9.17 % & 6.24 %
for the fi nanci al years ended March 31, 2007, March 31, 2008, March 31, 2009, March 31, 2010 &
March 31, 2011 respecti vel y. The Total di vi dend pai d for the fi nanci al year 2010-11 was ` 10,000
Lakhs.
Mechanism for redressal of Investor grievances : Karvy Computershare PrivateLimited has been appointed
as the Regi str ar to t he I ssue to ensure that Invest or gri evances are handl ed expedi t i ousl y and
sati sfactori l y and to effecti vel y deal wi th Investor compl ai nts. Al l gri evances rel ati ng to the Issue
shoul d be addressed to the Regi strar to the Issue and the Compl i ance Offi cer gi vi ng full detai l s of
the Appl i cant, number of Bonds appl i ed for, amount pai d on appl i cati on and Bankers to the Issue
/ Desi gnated Col l ecti on Centre / Agent to whi ch the appl i cati on was submi tted.
FINANCIAL INFORMATION
Statement of Asset and Liability for last Five Years and Latest Period:
(` in Lacs)
Particulars Schedule Audited for Audited for theyear ended
Halfyearended 31.03.11 31.03.10 31.03.09 31.03.08 31.03.07
30.09.2011
Sources of Funds
1. Shar ehol der s Funds
i. Shar e Capi tal 1 1 6 0 , 2 0 0 . 0 0 1 6 0 , 2 0 0 . 0 0 1 0 9 , 1 0 0 . 0 0 5 0 , 0 0 0 . 0 0 5 0 , 0 0 0 . 0 0 2 3 , 2 0 0 . 0 0
ii. Shar e Appl i cati on Money - - - 3 0 , 0 0 0 . 0 0 - 2 6 , 8 0 0 . 0 0
ii i. Reser ves and Surpl us 2 2 8 8 , 5 4 9 . 6 0 2 6 8 , 3 9 6 . 6 1 2 3 1 , 4 4 7 . 9 5 1 9 8 , 0 7 0 . 4 6 1 9 2 , 5 7 6 . 4 6 1 6 2 , 1 2 4 . 6 3
448,749.60 428,596.61 340,547.95 278,070.46 242,576.46 212,124.63
2. Loan Funds 3
i. Secur ed
- In India 3, 484,260. 61 3, 110,939. 11 2, 778,269. 76 2, 240,248. 18 1, 884,459. 82 1, 614,605. 96
- Outsi de Indi a 1 5 , 4 4 4 . 4 5 1 4 , 7 3 4 . 5 0 1 6 , 2 0 0 . 0 0 1 9 , 7 7 6 . 9 0 1 6 , 8 0 0 . 0 0 1 9 , 5 8 8 . 5 0
3,499,705.06 3,125,673.61 2,794,469.76 2,260,025.08 1,901,259.82 1,634,194.46
ii . Unsecured Loans
- In Indi a - - 1 4 4 , 8 9 9 . 8 2 1 2 4 , 6 1 6 . 0 0 1 9 4 , 7 5 0 . 0 0 1 7 7 , 3 2 0 . 0 0
- Outsi de Indi a 8 4 5 , 6 9 8 . 6 9 6 8 6 , 7 7 4 . 0 2 4 2 1 , 4 8 7 . 8 9 3 5 4 , 2 2 9 . 8 9 3 1 3 , 8 4 6 . 9 5 3 6 7 , 9 0 2 . 0 5
845,698.69 686,774.02 566,387.71 478,845.89 508,596.95 545,222.05
Tot al Loan Funds 4,345,403.75 3,812,447.63 3,360,857.47 2,738,870.97 2,409,856.77 2,179,416.51
3. Deferred Tax Liability (Net) 283,891.42 270,143.21 246,702.23 225,655.23 185,465.08 171,014.01
Tot al 5,078,044.77 4,511,187.45 3,948,107.65 3,242,596.66 2,837,898.31 2,562,555.15
Appli cati on of Funds 4. Assets
Fi xed Assets- Gr oss Bl ock 4 1 , 7 0 1 . 9 3 1 , 7 0 1 . 4 7 1 , 6 9 8 . 8 7 1 , 7 0 7 . 6 1 1 , 7 0 0 . 9 9 1 , 6 9 7 . 9 2
Less: Depr eci ati on Net Bl ock 3 8 1 . 0 9 3 6 4 . 4 9 3 2 9 . 8 5 3 0 8 . 5 2 2 8 0 . 9 1 2 4 0 . 7 6
1,320.84 1,336.98 1,369.02 1,399.09 1,420.08 1,457.16
5. Long Term Loans & Advances 5 4,973,085.41 4,531,822.44 3,839,232.51 3,156,191.09 2,702,551.90 2,473,072.20
6. Investments 6 1,779.98 1,897.56 199.85 199.85 199.85 199.85
7.Current Assets, Loans & Advances 7
Cur r ent Assets 3 3 3 , 9 7 6 . 5 0 9 9 , 0 2 2 . 6 0 1 9 3 , 9 0 0 . 3 5 1 3 7 , 3 0 2 . 0 2 1 7 3 , 0 0 8 . 8 3 1 0 8 , 7 4 3 . 6 0
Loans & Advances 5 0 , 4 8 8 . 8 9 3 4 , 9 4 1 . 8 1 3 1 , 5 8 9 . 2 7 4 2 , 6 3 0 . 7 4 4 2 , 0 7 8 . 1 2 3 9 , 1 2 4 . 2 1
384,465.39 133,964.41 225,489.62 179,932.76 215,086.95 147,867.81
8. Less: Cur rent Li abi liti es & Provi sions 8
Cur r ent Li abi li ti es 2 4 2 , 5 8 0 . 5 0 1 2 6 , 2 8 5 . 5 3 9 0 , 0 4 8 . 8 8 7 7 , 3 7 2 . 2 5 6 3 , 4 7 6 . 0 8 4 9 , 3 8 2 . 1 3
P r ov i s i ons 4 0 , 0 2 6 . 3 5 3 1 , 5 4 8 . 4 1 2 8 , 2 5 2 . 7 4 2 1 , 1 6 3 . 3 5 1 7 , 9 0 4 . 3 9 1 0 , 6 5 9 . 7 4
282,606.85 157,833.94 118,301.62 98,535.60 81,380.47 60,041.87
9. Net Current Assets 101,858.54 (23,869.53) 107,188.00 81,397.16 133,706.48 87,825.94
10.For ei gn Cur rency Monetr ay Item - - 118.27 3,409.47 - -
Tr anslat ion Di fference
11.Mi scell aneous Expendi ture - - - - 20.00 -
( to the extent not wr i tten off)
Tot al 5,078,044.77 4,511,187.45 3,948,107.65 3,242,596.66 2,837,898.31 2,562,555.15
Statement of Profit & Loss for last Five Years:
(` in Lacs)
Particulars Schedule Audited for Audited for theyear ended
Halfyearended 31.03.11 31.03.10 31.03.09 31.03.08 31.03.07
30.09.2011
Inc ome
Lease Income 2 0 0 , 2 3 4 . 4 1 3 4 9 , 1 9 8 . 7 8 3 0 7 , 3 7 6 . 1 0 2 7 2 , 6 4 5 . 1 7 2 3 7 , 4 3 3 . 6 1 2 1 0 , 2 3 6 . 7 9
Income on Loans & Deposi ts 1 7 , 5 5 1 . 5 8 3 2 , 6 0 6 . 3 4 3 5 , 9 8 5 . 6 2 2 8 , 6 8 8 . 7 4 2 0 , 7 9 2 . 8 2 1 4 , 1 9 3 . 2 3
Income on i nvestments 8 2 . 1 2 1 3 . 6 0 7 . 5 4 7 . 3 2 6 4 . 4 7 4 , 4 5 7 . 2 2
Exchange r ate var i ati on ( Gai n) - 4 . 8 5 1 , 1 1 6 . 1 0 1 9 5 . 8 5 1 , 4 0 5 . 0 0 -
Other Income 9 8 1 1 . 3 4 2 , 3 4 1 . 5 8 3 , 9 0 8 . 3 1 9 4 1 . 0 1 2 , 7 8 2 . 5 7 4 . 9 0
Tot al 218,679.45 384,165.15 348,393.67 302,478.09 262,478.47 228,892.14
Expend i t ur e
Inter est on B onds & l oans 1 0 1 6 7 , 1 0 6 . 5 9 2 8 2 , 9 0 1 . 5 1 2 4 5 , 7 5 7 . 6 4 2 1 6 , 2 7 9 . 6 2 1 8 1 , 0 2 8 . 4 2 1 4 7 , 7 0 7 . 9 9
Lease Rental s Pai d 2 , 3 1 5 . 7 4 4 , 2 9 5 . 5 1 1 0 , 3 3 9 . 5 6 1 8 , 6 0 3 . 4 5 1 6 , 7 4 9 . 3 9 1 8 , 2 5 7 . 3 6
Sal ar y & Empl oyee Benefi ts 1 1 8 8 . 5 6 2 0 2 . 5 8 1 5 5 . 5 0 1 6 6 . 1 4 9 5 . 4 6 6 7 . 6 2
Admi ni str ati ve & Ot her Expenses 1 2 6 4 1 . 7 0 4 1 4 . 3 1 2 6 9 . 3 2 4 6 4 . 3 4 2 3 2 . 5 9 2 4 6 . 8 6
Bond Ser vi ci ng Expenses 1 3 1 5 1 . 4 2 2 1 5 . 2 5 1 9 7 . 7 3 1 8 5 . 3 8 1 5 2 . 2 8 1 1 2 . 7 6
Bond Issue Expens es / 1 4 3 , 3 1 6 . 9 4 6 , 0 8 5 . 3 6 9 , 3 4 2 . 7 7 9 6 9 . 2 5 1 7 7 . 7 1 6 1 2 . 9 1
Expenses on l oans
D e pr e c i a t i o n 4 1 7 . 6 0 3 5 . 1 0 3 5 . 1 5 3 6 . 7 4 4 1 . 0 4 4 0 . 6 1
Exchange r ate var i ati on ( Loss) 2 , 6 4 4 . 3 8 - - - - 6 7 4 . 9 7
Amor ti sati on of For ei gn Cur r ency
Monetr ay It em Tr ansl ati on Di ff. A/c - 1 8 1 . 0 4 3 , 4 5 5 . 1 5 - - -
Tot al 176,282.93 294,330.66 269,552.82 236,704.92 198,476.89 167,721.08
Profi t for t he Year 42,396.52 89,834.49 78,840.85 65,773.17 64,001.58 61,171.06
Pri or Per iod Adj ustment ( Net Income) 1 5 ( 1 7 . 3 8 ) 0 . 0 2 ( 1 2 . 2 8 ) ( 4 . 4 4 ) ( 1 6 6 . 7 3 ) 2 . 6 2
Profi t Before Tax 42,379.14 89,834.51 78,828.57 65,768.73 63,834.85 61,173.68
Pr ovi si on for Taxat i on
- Cur r ent Year 8 , 4 7 7 . 9 4 1 7 , 9 2 3 . 1 3 1 3 , 5 1 2 . 5 0 7 , 5 0 0 . 0 0 7 , 2 2 7 . 0 0 6 , 3 7 5 . 4 0
- Ear l i er Year s - ( 5 0 . 0 0 ) - ( 1 . 5 3 ) - 4 3 1 . 3 1
Defer r ed Tax
- Cur r ent Year 1 3 , 7 4 8 . 2 1 2 3 , 4 4 0 . 9 8 2 1 , 0 4 7 . 0 0 2 2 , 3 5 5 . 9 2 1 4 , 4 5 1 . 0 7 1 4 , 4 9 0 . 5 3
- Ear l i er Year s - - 1 7 , 8 2 8 . 3 7 - -
Fr i nge Benefi t Tax - - - 6 . 8 1 5 . 4 5 6 . 6 9
Net Profit af ter Tax 20,152.99 48,520.40 44,269.07 18,079.16 42,151.33 39,869.75
Appr opr i at i ons:
Inter i m Di v i dend Pai d - 1 0 , 0 0 0 . 0 0 1 0 , 0 0 0 . 0 0 1 0 , 0 0 0 . 0 0 1 0 , 0 0 0 . 0 0 1 6 , 0 0 0 . 0 0
Di vi dend Tax - 1 , 6 6 0 . 8 7 1 , 6 9 9 . 5 0 1 , 6 9 9 . 5 0 1 , 6 9 9 . 5 0 2 , 2 4 4 . 0 0
Tr ansfer t o Gener al Res er ve - 5 , 0 0 0 . 0 0 4 , 5 0 0 . 0 0 1 , 9 0 0 . 0 0 4 , 2 1 6 . 0 0 4 , 0 0 0 . 0 0
Transfer to Exchange Variation Reserve - - - 1 , 9 4 7 . 0 0 8 9 7 . 0 0 3 , 1 5 0 . 0 0
Transfer to Bond Redemption Reserve 2 0 , 1 5 2 . 9 9 3 1 , 8 5 9 . 5 3 2 8 , 0 6 9 . 5 7 2 , 5 3 2 . 6 6 2 5 , 3 3 8 . 8 3 1 4 , 4 7 5 . 7 5
Tot al 20,152.99 48,520.40 44,269.07 18,079.16 42,151.33 39,869.75
RESERVES AND DIVIDENDS : For detai ls please refer to Annexure - I of the Shel f Prospectus.
For changes in Accounti ng Poli cesand Financial Statements, please refer to Annexure - I of the Shelf
Prospect us.
MATERIAL CONTRACTS AND DOCUMENTS FOR INSPECTION :
These contracts (not bei ng contracts entered i nto in the ordi nary course of business carried on by the
Company or entered into more than two years before the date of the Prospectus Tranche - 1) which are or
may be deemed materi al have been entered or are to be entered into by the Company. These contracts
and al so the documents for i nspecti on referred to hereunder, may be inspected on Working Days at the
Registered Office of the Company situated at UG Fl oor, East Tower, NBCC Place, Pragati Vihar, Lodhi
Road, New Delhi -110 003, India, from 10.00 a.m. and 12.00 noon on any working day (Monday to Friday)
during which the Issue is open for public subscription under the Prospectus Tranche - 1. For further details
please refer to page no. 67 of the Prospectus Tranche - 1.
DECLARATION
We, the Directors of the Company, certify that all appl icabl e legal requirements i n connecti on with the
Issue, including under the Companies Act, the SEBI Debt Regul ations, and all rel evant guideli nes issued
by SEBI, the Government of Indi a and any other competent authority i n this behal f, have been dul y
compli ed with, and that no statement made i n this Prospectus Tranche 1 contravenes such appl icable
l egal requi rements.
We further certify that this Prospectus Tranche 1 does not omit disclosure of any material fact which may
make the statements made therein, in light of circumstances under which they were made, misleading and
that no statements in this Prospectus Tranche 1are false, untrue or misleading, and that this Prospectus
Tranche 1 does not contain any mis-statements.
Signed by all theDirectors of the Company
Ms. Vijaya Kanth - Chairperson / Nominee Director Mr. Rajiv Datt - Managing Director Mr. D. C. Arya -
Director (Finance) Mr. RajeshKhullar - Nominee Director
Place: New Delhi Date: January 19, 2012
of exchange rate risk on the Indian rupee and risks associated with the conversion of Indian rupee proceeds into foreign
currency. Investors are subject to currency fluctuation risk and convertibility risk since the Bonds are quoted in Indian rupees
on the Indian stock exchanges on which they are listed. Returns on the Bonds will also be paid in Indian rupees. The volatility
of the Indian rupee against the U.S. dollar and other currencies subjects investors who convert funds into Indian rupees to
purchase our bonds to currency fluctuation risks.
36. You maynot beableto recover, on atimely basis or at all,thefullvalueoftheoutstandingamounts and/ortheinterest
accrued thereon in connection with theBonds.: Ourabilitytopayinterest accruedontheBondsand/or theprincipal amount
outstanding from time to time in connection therewith would be subject to various factors, including our financial
condition, profitability and the general economic conditions in India and the global financial markets. We cannot assure
you that we would be able to repay the principal amount outstanding from time to time on the Bonds and/or the interest
accrued thereon in a timely manner, or at all.
37. Changesin prevailing interest ratesmayaffect thepriceof theBonds. :All securitieswhereafixedrateofinterest isoffered,
such as the Bonds, are subject to price risk. The price of such securities will vary inversely with changes in prevailing
interest rates, i.e., when interest rates rise, prices of fixed income securities fall and when interest rates drop, the prices
increase. The extent of fall or rise in the prices is a function of the existing coupon rate, days to maturity and the increase
or decrease in the level of prevailing interest rates. Increased rates of interest, which frequently accompany inflation
and/or a growing economy, are likely to have a negative effect on the trading price of the Bonds.
38. Anydowngradinginourdomesticand international credit ratingofour Bondsmayaffectthetradingpriceof ourBonds.
: CRISIL has reaffirmed the credit rating of CRISIL AAA/Stable (pronounced as CRISIL Triple A with stable outlook)
for the ` 20,59,438 lakhs long term borrowing programme of the Company (Debt Programme) vide its letter no. VR/
FSR/IRFC/2011-12/1208 dated December 14, 2011. ICRA has reaffirmed the credit rating of [ICRA] AAA (pronounced
ICRA triple A) of the Debt Programme of the Company vide its letter no. D/RAT/2011-2012/11/13 dated December
19, 2011. CARE has reaffirmed the credit rating of CARE AAA (pronounced as CARE triple A) for the Debt
Programme of the Company vide its letter dated December 14, 2011. Further international rating agencies like Japan
Credit Rating Agency Limited has affirmed its BBB+ rating on the long term senior debts and the Japanese Yen bonds
issued by the Company and Standard and Poors has assigned BBB- rating to the foreign currency and the local currency
issues and senior unsecured issues. For further details, see section titled Our Business on page 55 of the Shelf
Prospectus. These ratings may be suspended, withdrawn or revised at any time. Any revision or downgrading in the
credit rating may lower the trading price of the Bonds and may also affect our ability to raise further debt. For the rationale
for these ratings, see Annexure II of the Shelf Prospectus.
39. Payments madeontheBonds will besubordinatetocertain tax and other liabilities aslaid down bylaw. :TheBonds
will be subordinate to certain liabilities preferred by law such as to claims of the Government on account of taxes,
and certain liabilities incurred in the ordinary course of our transactions. In particular, in the event of bankruptcy,
liquidation or winding-up, our assets will be available to pay obligations on the Bonds only after all of the liabilities
that rank senior to these Bonds have been paid. In the event of bankruptcy, liquidation or winding-up, there may
not be sufficient assets remaining, after paying the aforesaid senior ranking claims, to pay amounts due on the
Bonds. Further, there is no restriction on the amount of debt securities that we may issue that may rank above the
Bonds. The issue of any such debt securities may reduce the amount recoverable by investors in the Bonds on our
bankruptcy, winding-up or liquidation.